Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3961
Gene name
LocationContig_257:781..1926
Strand+
Gene length (bp)1145
Transcript length (bp)1017
Coding sequence length (bp)1017
Protein length (aa) 339

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04495 GRASP55_65 GRASP55/65 PDZ-like domain 9.1E-46 78 210

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10149|YAT2_SCHPO Uncharacterized protein C1D4.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1D4.02c PE=4 SV=2 1 301 2.0E-62
sp|Q91X51|GORS1_MOUSE Golgi reassembly-stacking protein 1 OS=Mus musculus GN=Gorasp1 PE=1 SV=3 41 209 2.0E-35
sp|O35254|GORS1_RAT Golgi reassembly-stacking protein 1 OS=Rattus norvegicus GN=Gorasp1 PE=1 SV=4 41 209 4.0E-35
sp|Q9BQQ3|GORS1_HUMAN Golgi reassembly-stacking protein 1 OS=Homo sapiens GN=GORASP1 PE=1 SV=3 41 209 1.0E-34
sp|Q99JX3|GORS2_MOUSE Golgi reassembly-stacking protein 2 OS=Mus musculus GN=Gorasp2 PE=1 SV=3 25 209 3.0E-33
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10149|YAT2_SCHPO Uncharacterized protein C1D4.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1D4.02c PE=4 SV=2 1 301 2.0E-62
sp|Q91X51|GORS1_MOUSE Golgi reassembly-stacking protein 1 OS=Mus musculus GN=Gorasp1 PE=1 SV=3 41 209 2.0E-35
sp|O35254|GORS1_RAT Golgi reassembly-stacking protein 1 OS=Rattus norvegicus GN=Gorasp1 PE=1 SV=4 41 209 4.0E-35
sp|Q9BQQ3|GORS1_HUMAN Golgi reassembly-stacking protein 1 OS=Homo sapiens GN=GORASP1 PE=1 SV=3 41 209 1.0E-34
sp|Q99JX3|GORS2_MOUSE Golgi reassembly-stacking protein 2 OS=Mus musculus GN=Gorasp2 PE=1 SV=3 25 209 3.0E-33
sp|Q9H8Y8|GORS2_HUMAN Golgi reassembly-stacking protein 2 OS=Homo sapiens GN=GORASP2 PE=1 SV=3 25 209 4.0E-33
sp|Q9R064|GORS2_RAT Golgi reassembly-stacking protein 2 OS=Rattus norvegicus GN=Gorasp2 PE=1 SV=3 25 209 1.0E-32
sp|Q04410|GRH1_YEAST GRASP65 homolog protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GRH1 PE=1 SV=1 28 320 1.0E-25
sp|Q9BQQ3|GORS1_HUMAN Golgi reassembly-stacking protein 1 OS=Homo sapiens GN=GORASP1 PE=1 SV=3 102 207 2.0E-08
sp|Q91X51|GORS1_MOUSE Golgi reassembly-stacking protein 1 OS=Mus musculus GN=Gorasp1 PE=1 SV=3 118 207 3.0E-08
sp|O35254|GORS1_RAT Golgi reassembly-stacking protein 1 OS=Rattus norvegicus GN=Gorasp1 PE=1 SV=4 118 207 6.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 51 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3961
MFNALNRFMSRLDGAEHQQRQHDRGSFGFQVLRNTTLGLSVEPWFDYVVGINGRPLDGPNPTLFAQEIRNCAGRT
VTLGLWNAKGQRTREMHIPVPVDTATLGLSLQYAPLSLAANVWHVLDVAPNSPAADASLLPYSDYILGSPEGTLG
GESALGELVEDHIGRPLRLYIYNNEYDVTREVTIQPSRDWGGEGALGCMLGYGALHRLPAPLSEPVSGPGETMFD
GDINEKSEATLIPAASAAQTIPASQLLVPTQVLDSVPVNTSSKPGKKKERHSHRGQNQLMDDYFKEEEKKSRELD
NAPTPKASGVAPPPKAPAATIPRTAEPTDAVKDDEECK*
Coding >OphauB2|3961
ATGTTCAATGCTCTGAATCGCTTCATGTCGCGCCTCGATGGTGCTGAGCATCAACAACGCCAGCATGATAGAGGC
TCCTTTGGCTTCCAGGTCTTGAGAAACACCACTCTTGGGCTATCGGTCGAACCATGGTTTGACTATGTCGTGGGT
ATCAACGGACGACCTCTTGACGGCCCGAATCCAACTCTCTTTGCCCAAGAGATTCGAAACTGCGCAGGCAGAACT
GTCACACTAGGCCTTTGGAACGCCAAGGGTCAACGCACGAGAGAAATGCATATTCCAGTGCCAGTCGATACTGCA
ACTCTTGGCTTGTCTCTTCAATACGCACCACTTTCCCTCGCTGCTAATGTATGGCACGTGCTCGATGTGGCGCCA
AACTCCCCTGCCGCCGATGCTTCCCTGCTGCCCTACAGCGATTATATCTTGGGGAGTCCTGAAGGTACTCTTGGC
GGGGAAAGCGCCTTGGGCGAGCTGGTTGAAGATCACATTGGCAGACCCTTGCGACTCTATATATACAACAATGAG
TACGATGTAACAAGAGAGGTGACGATACAGCCAAGTCGGGACTGGGGTGGCGAGGGAGCCTTGGGCTGCATGTTA
GGTTACGGCGCTCTACATCGGCTTCCTGCTCCGCTCAGTGAGCCTGTCAGTGGGCCCGGAGAGACAATGTTCGAT
GGTGACATCAACGAGAAGAGCGAAGCTACCTTGATCCCCGCTGCTTCAGCCGCACAAACAATACCAGCGAGTCAA
TTACTCGTACCGACTCAGGTGCTTGACTCAGTACCCGTGAACACCTCTTCCAAGCCAGGAAAGAAGAAAGAGCGC
CACAGCCACCGTGGACAAAACCAGCTCATGGATGACTACTTCAAGGAAGAGGAGAAGAAGAGTCGAGAACTGGAC
AATGCCCCGACGCCAAAAGCTTCTGGCGTGGCTCCTCCTCCAAAGGCACCTGCAGCAACAATTCCACGGACAGCC
GAGCCCACAGACGCTGTGAAAGACGATGAGGAGTGCAAATAA
Transcript >OphauB2|3961
ATGTTCAATGCTCTGAATCGCTTCATGTCGCGCCTCGATGGTGCTGAGCATCAACAACGCCAGCATGATAGAGGC
TCCTTTGGCTTCCAGGTCTTGAGAAACACCACTCTTGGGCTATCGGTCGAACCATGGTTTGACTATGTCGTGGGT
ATCAACGGACGACCTCTTGACGGCCCGAATCCAACTCTCTTTGCCCAAGAGATTCGAAACTGCGCAGGCAGAACT
GTCACACTAGGCCTTTGGAACGCCAAGGGTCAACGCACGAGAGAAATGCATATTCCAGTGCCAGTCGATACTGCA
ACTCTTGGCTTGTCTCTTCAATACGCACCACTTTCCCTCGCTGCTAATGTATGGCACGTGCTCGATGTGGCGCCA
AACTCCCCTGCCGCCGATGCTTCCCTGCTGCCCTACAGCGATTATATCTTGGGGAGTCCTGAAGGTACTCTTGGC
GGGGAAAGCGCCTTGGGCGAGCTGGTTGAAGATCACATTGGCAGACCCTTGCGACTCTATATATACAACAATGAG
TACGATGTAACAAGAGAGGTGACGATACAGCCAAGTCGGGACTGGGGTGGCGAGGGAGCCTTGGGCTGCATGTTA
GGTTACGGCGCTCTACATCGGCTTCCTGCTCCGCTCAGTGAGCCTGTCAGTGGGCCCGGAGAGACAATGTTCGAT
GGTGACATCAACGAGAAGAGCGAAGCTACCTTGATCCCCGCTGCTTCAGCCGCACAAACAATACCAGCGAGTCAA
TTACTCGTACCGACTCAGGTGCTTGACTCAGTACCCGTGAACACCTCTTCCAAGCCAGGAAAGAAGAAAGAGCGC
CACAGCCACCGTGGACAAAACCAGCTCATGGATGACTACTTCAAGGAAGAGGAGAAGAAGAGTCGAGAACTGGAC
AATGCCCCGACGCCAAAAGCTTCTGGCGTGGCTCCTCCTCCAAAGGCACCTGCAGCAACAATTCCACGGACAGCC
GAGCCCACAGACGCTGTGAAAGACGATGAGGAGTGCAAATAA
Gene >OphauB2|3961
ATGTTCAATGCTCTGAATCGCTTCATGTCGCGCCTCGATGGTGCTGAGCATCAACAACGCCAGCATGATAGAGGC
TCCTTTGGCTTCCAGGTCTTGAGAAACACCACTCTTGGGCTATCGGTCGAACCATGGTTTGACTATGTCGTGGGT
ATCAACGGACGACCTCTTGTGCGTGCGAACTGGCTAGAGCTCGTGTACACATGCAATTCTGACTTGTGCCCGGCA
TTCTCTAGGACGGCCCGAATCCAACTCTCTTTGCCCAAGAGATTCGAAACTGCGCAGGCAGAACTGTCACACTAG
GCCTTTGGAACGCCAAGGTTAGAGTTGTGTGGCTTTGGCAGCATAGGTCAACCTTGTCTTGCTAATGGACATGTG
TCTAGGGTCAACGCACGAGAGAAATGCATATTCCAGTGCCAGTCGATACTGCAACTCTTGGCTTGTCTCTTCAAT
ACGCACCACTTTCCCTCGCTGCTAATGTATGGCACGTGCTCGATGTGGCGCCAAACTCCCCTGCCGCCGATGCTT
CCCTGCTGCCCTACAGCGATTATATCTTGGGGAGTCCTGAAGGTACTCTTGGCGGGGAAAGCGCCTTGGGCGAGC
TGGTTGAAGATCACATTGGCAGACCCTTGCGACTCTATATATACAACAATGAGTACGATGTAACAAGAGAGGTGA
CGATACAGCCAAGTCGGGACTGGGGTGGCGAGGGAGCCTTGGGCTGCATGTTAGGTTACGGCGCTCTACATCGGC
TTCCTGCTCCGCTCAGTGAGCCTGTCAGTGGGCCCGGAGAGACAATGTTCGATGGTGACATCAACGAGAAGAGCG
AAGCTACCTTGATCCCCGCTGCTTCAGCCGCACAAACAATACCAGCGAGTCAATTACTCGTACCGACTCAGGTGC
TTGACTCAGTACCCGTGAACACCTCTTCCAAGCCAGGAAAGAAGAAAGAGCGCCACAGCCACCGTGGACAAAACC
AGCTCATGGATGACTACTTCAAGGAAGAGGAGAAGAAGAGTCGAGAACTGGACAATGCCCCGACGCCAAAAGCTT
CTGGCGTGGCTCCTCCTCCAAAGGCACCTGCAGCAACAATTCCACGGACAGCCGAGCCCACAGACGCTGTGAAAG
ACGATGAGGAGTGCAAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail