Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3940
Gene name
LocationContig_252:367..2710
Strand-
Gene length (bp)2343
Transcript length (bp)2343
Coding sequence length (bp)2343
Protein length (aa) 781

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08318 COG4 COG4 transport protein 2.8E-128 165 505

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74990|COG4_SCHPO Conserved oligomeric Golgi complex subunit 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cog4 PE=3 SV=1 85 741 7.0E-67
sp|Q06096|COG4_YEAST Conserved oligomeric Golgi complex subunit 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COG4 PE=1 SV=1 5 776 7.0E-60
sp|Q3MHG0|COG4_BOVIN Conserved oligomeric Golgi complex subunit 4 OS=Bos taurus GN=COG4 PE=2 SV=1 13 776 3.0E-48
sp|Q8R1U1|COG4_MOUSE Conserved oligomeric Golgi complex subunit 4 OS=Mus musculus GN=Cog4 PE=1 SV=1 11 776 5.0E-48
sp|Q9H9E3|COG4_HUMAN Conserved oligomeric Golgi complex subunit 4 OS=Homo sapiens GN=COG4 PE=1 SV=3 11 776 1.0E-47
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74990|COG4_SCHPO Conserved oligomeric Golgi complex subunit 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cog4 PE=3 SV=1 85 741 7.0E-67
sp|Q06096|COG4_YEAST Conserved oligomeric Golgi complex subunit 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COG4 PE=1 SV=1 5 776 7.0E-60
sp|Q3MHG0|COG4_BOVIN Conserved oligomeric Golgi complex subunit 4 OS=Bos taurus GN=COG4 PE=2 SV=1 13 776 3.0E-48
sp|Q8R1U1|COG4_MOUSE Conserved oligomeric Golgi complex subunit 4 OS=Mus musculus GN=Cog4 PE=1 SV=1 11 776 5.0E-48
sp|Q9H9E3|COG4_HUMAN Conserved oligomeric Golgi complex subunit 4 OS=Homo sapiens GN=COG4 PE=1 SV=3 11 776 1.0E-47
sp|Q5R7R6|COG4_PONAB Conserved oligomeric Golgi complex subunit 4 OS=Pongo abelii GN=COG4 PE=2 SV=1 11 776 3.0E-47
sp|Q95TN4|COG4_DROME Conserved oligomeric Golgi complex subunit 4 OS=Drosophila melanogaster GN=CG7456 PE=1 SV=1 13 769 1.0E-39
sp|Q8L838|COG4_ARATH Conserved oligomeric Golgi complex subunit 4 OS=Arabidopsis thaliana GN=COG4 PE=2 SV=1 10 770 2.0E-37
sp|Q95XZ0|COG4_CAEEL Conserved oligomeric Golgi complex subunit 4 OS=Caenorhabditis elegans GN=cogc-4 PE=3 SV=1 67 745 3.0E-19
sp|Q55FT5|COG4_DICDI Conserved oligomeric Golgi complex subunit 4 OS=Dictyostelium discoideum GN=cog4 PE=3 SV=1 71 311 1.0E-12
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3940
MSASIDEASSAAEVRAALTVLHEHEAVITTQLGALAASQADLSRHLSRLDLLRASLGAQAIAVRSIGSEMLTSAA
ETAGRLSNGVKQLDSEKERVEATLGVVEQVAELKACVNGVVGSMGAPQDWEAAAAYLDRASRIPDEVARGAFAGS
IVPSVEVPDAPWVTLDQARESLCNLFLREFENAAAAGDGAKVTRFFKLFPLIGRADVGLDVYGRYVCQGVAGTAR
AALKDTAAARRDVFFYASALTRLFEHIAQIIDSHGVLVERHYGSGKMVRVIERLQMEADVQGGIILDTWSDERDV
DRKLTDVKSYPFSFLVQSFLPQGPRGGIVGNARGASPALGNSAARNSEDEGVNMKEVDGLLSEIALMLGRWALYT
RFIATKCRDTTADKEPLVVPELLVKSNLHRKVGSKLTTPYNLMTTFFFRRSVEKAFQLDEYPTGLSLSMSKQIQG
NAPYIIMAVDDVMYIVNTVLDKCLSTRQREIIASVLPTVGRVLSSDFIGMIQRKMRDESYPKPIVQGGFPPEEKI
IQFIVLVNSLDMANEYLDRIISTRIAIDQDKELPRLRDDGVADWFPFGRDCAFVAGALQTLEASVVAKSTELLNE
GIQVLFNQVVKLRLRPVLSDSFRDADYTLSQAELAEVAQENDETEAQVLEQVPRRFEQGWEQLMKPIARIMTPRT
FSSLLDMTARHLARVLEKRVLSYGGRATAYGAVRLERDFGGIVDCVARGDYGVREGFARVTQLLMVANMEDEEWD
EVEAGEAGMDWVLSMEERRRARSMVIRERE*
Coding >OphauB2|3940
ATGTCAGCAAGCATCGACGAGGCCAGCAGCGCGGCCGAGGTGAGGGCGGCGCTGACGGTTCTGCACGAGCACGAA
GCAGTCATTACGACGCAGCTGGGCGCCCTCGCAGCCTCGCAGGCAGACTTGTCGCGGCACCTGAGCCGTCTAGAC
CTGCTCCGGGCCAGTCTAGGAGCGCAGGCCATTGCAGTGCGGTCGATTGGCAGCGAGATGCTGACGTCTGCGGCC
GAGACGGCAGGGCGCCTAAGCAACGGGGTCAAGCAACTCGACAGCGAAAAGGAAAGAGTGGAGGCGACCTTGGGC
GTGGTGGAGCAGGTGGCGGAGCTCAAGGCCTGCGTGAATGGCGTGGTGGGCTCCATGGGGGCGCCGCAAGACTGG
GAGGCGGCAGCGGCATACCTGGACCGGGCGAGTCGGATCCCGGACGAGGTGGCCCGCGGCGCCTTTGCGGGCAGC
ATCGTGCCGAGCGTCGAGGTGCCGGATGCGCCGTGGGTGACGCTGGACCAAGCCCGCGAGAGCTTGTGCAATTTA
TTCTTGCGCGAGTTTGAAAACGCAGCGGCAGCGGGCGACGGGGCCAAGGTGACGCGCTTCTTCAAGCTCTTTCCC
CTCATTGGACGAGCCGACGTTGGTCTGGATGTCTATGGGCGCTACGTCTGCCAGGGCGTAGCTGGGACGGCGCGC
GCGGCGCTCAAGGACACGGCTGCGGCGAGACGAGACGTCTTTTTCTACGCGAGTGCTCTGACGCGTCTCTTTGAG
CACATTGCTCAGATTATCGACAGCCACGGAGTCCTGGTGGAGCGGCACTATGGCTCGGGAAAGATGGTGCGCGTC
ATTGAGCGACTGCAAATGGAGGCGGATGTTCAGGGCGGCATCATCCTCGATACGTGGAGCGACGAACGCGACGTG
GACAGGAAGCTGACGGATGTCAAGAGTTATCCCTTTTCCTTTCTCGTGCAGAGCTTTTTACCGCAGGGTCCGCGG
GGTGGTATTGTGGGCAATGCCCGAGGTGCTTCCCCTGCTCTGGGCAACAGCGCTGCCCGCAACAGCGAGGACGAG
GGCGTCAATATGAAGGAGGTGGATGGCCTGCTCAGTGAGATTGCCTTGATGCTGGGACGCTGGGCTCTATACACA
CGCTTCATTGCGACAAAGTGTCGAGACACGACGGCCGACAAGGAGCCCTTGGTGGTGCCAGAGTTGCTTGTCAAG
TCGAATCTACACCGCAAAGTTGGGAGCAAGCTAACGACGCCGTACAATCTCATGACGACCTTTTTCTTTCGCCGC
TCGGTTGAAAAGGCCTTTCAGCTTGACGAGTACCCGACGGGCTTGTCTCTTAGCATGAGCAAGCAGATTCAAGGC
AATGCGCCCTACATCATCATGGCTGTTGACGACGTCATGTACATTGTCAATACTGTGCTTGACAAGTGCTTGTCT
ACACGACAGAGAGAGATTATTGCCTCGGTCTTGCCCACGGTTGGGCGTGTCTTGAGCTCTGATTTCATTGGCATG
ATTCAGCGCAAGATGCGCGACGAGTCGTATCCCAAGCCCATTGTTCAAGGAGGATTCCCCCCTGAAGAGAAGATT
ATTCAATTCATTGTGCTTGTCAACAGCCTCGACATGGCAAATGAATACTTGGACAGAATCATTAGCACACGCATC
GCCATTGACCAGGACAAGGAGCTGCCACGCCTACGAGACGATGGGGTGGCTGACTGGTTTCCCTTTGGCCGCGAC
TGCGCGTTTGTTGCAGGCGCCTTGCAAACACTGGAAGCAAGCGTGGTGGCCAAGTCTACAGAATTGCTCAACGAG
GGCATCCAAGTGCTCTTCAACCAAGTAGTCAAGCTGCGACTCAGGCCGGTGCTCAGCGATAGCTTTCGCGACGCC
GACTACACGCTAAGCCAGGCGGAGCTGGCCGAGGTGGCGCAGGAAAACGACGAGACGGAGGCGCAAGTCTTGGAA
CAAGTGCCGCGGCGTTTTGAGCAAGGCTGGGAGCAGCTCATGAAGCCCATTGCACGCATAATGACGCCGCGGACA
TTTAGCAGCCTGCTCGACATGACGGCACGCCACTTGGCGCGGGTGCTGGAAAAGCGGGTGCTGAGCTATGGCGGG
CGGGCAACGGCCTATGGAGCAGTGAGGCTGGAGCGCGACTTTGGCGGCATTGTGGATTGTGTGGCCAGGGGGGAC
TATGGAGTGCGCGAGGGGTTTGCGCGGGTGACGCAGTTGCTCATGGTGGCGAATATGGAGGATGAGGAGTGGGAT
GAGGTGGAGGCGGGAGAGGCTGGCATGGATTGGGTCTTGAGCATGGAGGAGAGGAGGAGGGCGAGGAGCATGGTT
ATACGGGAGCGGGAGTGA
Transcript >OphauB2|3940
ATGTCAGCAAGCATCGACGAGGCCAGCAGCGCGGCCGAGGTGAGGGCGGCGCTGACGGTTCTGCACGAGCACGAA
GCAGTCATTACGACGCAGCTGGGCGCCCTCGCAGCCTCGCAGGCAGACTTGTCGCGGCACCTGAGCCGTCTAGAC
CTGCTCCGGGCCAGTCTAGGAGCGCAGGCCATTGCAGTGCGGTCGATTGGCAGCGAGATGCTGACGTCTGCGGCC
GAGACGGCAGGGCGCCTAAGCAACGGGGTCAAGCAACTCGACAGCGAAAAGGAAAGAGTGGAGGCGACCTTGGGC
GTGGTGGAGCAGGTGGCGGAGCTCAAGGCCTGCGTGAATGGCGTGGTGGGCTCCATGGGGGCGCCGCAAGACTGG
GAGGCGGCAGCGGCATACCTGGACCGGGCGAGTCGGATCCCGGACGAGGTGGCCCGCGGCGCCTTTGCGGGCAGC
ATCGTGCCGAGCGTCGAGGTGCCGGATGCGCCGTGGGTGACGCTGGACCAAGCCCGCGAGAGCTTGTGCAATTTA
TTCTTGCGCGAGTTTGAAAACGCAGCGGCAGCGGGCGACGGGGCCAAGGTGACGCGCTTCTTCAAGCTCTTTCCC
CTCATTGGACGAGCCGACGTTGGTCTGGATGTCTATGGGCGCTACGTCTGCCAGGGCGTAGCTGGGACGGCGCGC
GCGGCGCTCAAGGACACGGCTGCGGCGAGACGAGACGTCTTTTTCTACGCGAGTGCTCTGACGCGTCTCTTTGAG
CACATTGCTCAGATTATCGACAGCCACGGAGTCCTGGTGGAGCGGCACTATGGCTCGGGAAAGATGGTGCGCGTC
ATTGAGCGACTGCAAATGGAGGCGGATGTTCAGGGCGGCATCATCCTCGATACGTGGAGCGACGAACGCGACGTG
GACAGGAAGCTGACGGATGTCAAGAGTTATCCCTTTTCCTTTCTCGTGCAGAGCTTTTTACCGCAGGGTCCGCGG
GGTGGTATTGTGGGCAATGCCCGAGGTGCTTCCCCTGCTCTGGGCAACAGCGCTGCCCGCAACAGCGAGGACGAG
GGCGTCAATATGAAGGAGGTGGATGGCCTGCTCAGTGAGATTGCCTTGATGCTGGGACGCTGGGCTCTATACACA
CGCTTCATTGCGACAAAGTGTCGAGACACGACGGCCGACAAGGAGCCCTTGGTGGTGCCAGAGTTGCTTGTCAAG
TCGAATCTACACCGCAAAGTTGGGAGCAAGCTAACGACGCCGTACAATCTCATGACGACCTTTTTCTTTCGCCGC
TCGGTTGAAAAGGCCTTTCAGCTTGACGAGTACCCGACGGGCTTGTCTCTTAGCATGAGCAAGCAGATTCAAGGC
AATGCGCCCTACATCATCATGGCTGTTGACGACGTCATGTACATTGTCAATACTGTGCTTGACAAGTGCTTGTCT
ACACGACAGAGAGAGATTATTGCCTCGGTCTTGCCCACGGTTGGGCGTGTCTTGAGCTCTGATTTCATTGGCATG
ATTCAGCGCAAGATGCGCGACGAGTCGTATCCCAAGCCCATTGTTCAAGGAGGATTCCCCCCTGAAGAGAAGATT
ATTCAATTCATTGTGCTTGTCAACAGCCTCGACATGGCAAATGAATACTTGGACAGAATCATTAGCACACGCATC
GCCATTGACCAGGACAAGGAGCTGCCACGCCTACGAGACGATGGGGTGGCTGACTGGTTTCCCTTTGGCCGCGAC
TGCGCGTTTGTTGCAGGCGCCTTGCAAACACTGGAAGCAAGCGTGGTGGCCAAGTCTACAGAATTGCTCAACGAG
GGCATCCAAGTGCTCTTCAACCAAGTAGTCAAGCTGCGACTCAGGCCGGTGCTCAGCGATAGCTTTCGCGACGCC
GACTACACGCTAAGCCAGGCGGAGCTGGCCGAGGTGGCGCAGGAAAACGACGAGACGGAGGCGCAAGTCTTGGAA
CAAGTGCCGCGGCGTTTTGAGCAAGGCTGGGAGCAGCTCATGAAGCCCATTGCACGCATAATGACGCCGCGGACA
TTTAGCAGCCTGCTCGACATGACGGCACGCCACTTGGCGCGGGTGCTGGAAAAGCGGGTGCTGAGCTATGGCGGG
CGGGCAACGGCCTATGGAGCAGTGAGGCTGGAGCGCGACTTTGGCGGCATTGTGGATTGTGTGGCCAGGGGGGAC
TATGGAGTGCGCGAGGGGTTTGCGCGGGTGACGCAGTTGCTCATGGTGGCGAATATGGAGGATGAGGAGTGGGAT
GAGGTGGAGGCGGGAGAGGCTGGCATGGATTGGGTCTTGAGCATGGAGGAGAGGAGGAGGGCGAGGAGCATGGTT
ATACGGGAGCGGGAGTGA
Gene >OphauB2|3940
ATGTCAGCAAGCATCGACGAGGCCAGCAGCGCGGCCGAGGTGAGGGCGGCGCTGACGGTTCTGCACGAGCACGAA
GCAGTCATTACGACGCAGCTGGGCGCCCTCGCAGCCTCGCAGGCAGACTTGTCGCGGCACCTGAGCCGTCTAGAC
CTGCTCCGGGCCAGTCTAGGAGCGCAGGCCATTGCAGTGCGGTCGATTGGCAGCGAGATGCTGACGTCTGCGGCC
GAGACGGCAGGGCGCCTAAGCAACGGGGTCAAGCAACTCGACAGCGAAAAGGAAAGAGTGGAGGCGACCTTGGGC
GTGGTGGAGCAGGTGGCGGAGCTCAAGGCCTGCGTGAATGGCGTGGTGGGCTCCATGGGGGCGCCGCAAGACTGG
GAGGCGGCAGCGGCATACCTGGACCGGGCGAGTCGGATCCCGGACGAGGTGGCCCGCGGCGCCTTTGCGGGCAGC
ATCGTGCCGAGCGTCGAGGTGCCGGATGCGCCGTGGGTGACGCTGGACCAAGCCCGCGAGAGCTTGTGCAATTTA
TTCTTGCGCGAGTTTGAAAACGCAGCGGCAGCGGGCGACGGGGCCAAGGTGACGCGCTTCTTCAAGCTCTTTCCC
CTCATTGGACGAGCCGACGTTGGTCTGGATGTCTATGGGCGCTACGTCTGCCAGGGCGTAGCTGGGACGGCGCGC
GCGGCGCTCAAGGACACGGCTGCGGCGAGACGAGACGTCTTTTTCTACGCGAGTGCTCTGACGCGTCTCTTTGAG
CACATTGCTCAGATTATCGACAGCCACGGAGTCCTGGTGGAGCGGCACTATGGCTCGGGAAAGATGGTGCGCGTC
ATTGAGCGACTGCAAATGGAGGCGGATGTTCAGGGCGGCATCATCCTCGATACGTGGAGCGACGAACGCGACGTG
GACAGGAAGCTGACGGATGTCAAGAGTTATCCCTTTTCCTTTCTCGTGCAGAGCTTTTTACCGCAGGGTCCGCGG
GGTGGTATTGTGGGCAATGCCCGAGGTGCTTCCCCTGCTCTGGGCAACAGCGCTGCCCGCAACAGCGAGGACGAG
GGCGTCAATATGAAGGAGGTGGATGGCCTGCTCAGTGAGATTGCCTTGATGCTGGGACGCTGGGCTCTATACACA
CGCTTCATTGCGACAAAGTGTCGAGACACGACGGCCGACAAGGAGCCCTTGGTGGTGCCAGAGTTGCTTGTCAAG
TCGAATCTACACCGCAAAGTTGGGAGCAAGCTAACGACGCCGTACAATCTCATGACGACCTTTTTCTTTCGCCGC
TCGGTTGAAAAGGCCTTTCAGCTTGACGAGTACCCGACGGGCTTGTCTCTTAGCATGAGCAAGCAGATTCAAGGC
AATGCGCCCTACATCATCATGGCTGTTGACGACGTCATGTACATTGTCAATACTGTGCTTGACAAGTGCTTGTCT
ACACGACAGAGAGAGATTATTGCCTCGGTCTTGCCCACGGTTGGGCGTGTCTTGAGCTCTGATTTCATTGGCATG
ATTCAGCGCAAGATGCGCGACGAGTCGTATCCCAAGCCCATTGTTCAAGGAGGATTCCCCCCTGAAGAGAAGATT
ATTCAATTCATTGTGCTTGTCAACAGCCTCGACATGGCAAATGAATACTTGGACAGAATCATTAGCACACGCATC
GCCATTGACCAGGACAAGGAGCTGCCACGCCTACGAGACGATGGGGTGGCTGACTGGTTTCCCTTTGGCCGCGAC
TGCGCGTTTGTTGCAGGCGCCTTGCAAACACTGGAAGCAAGCGTGGTGGCCAAGTCTACAGAATTGCTCAACGAG
GGCATCCAAGTGCTCTTCAACCAAGTAGTCAAGCTGCGACTCAGGCCGGTGCTCAGCGATAGCTTTCGCGACGCC
GACTACACGCTAAGCCAGGCGGAGCTGGCCGAGGTGGCGCAGGAAAACGACGAGACGGAGGCGCAAGTCTTGGAA
CAAGTGCCGCGGCGTTTTGAGCAAGGCTGGGAGCAGCTCATGAAGCCCATTGCACGCATAATGACGCCGCGGACA
TTTAGCAGCCTGCTCGACATGACGGCACGCCACTTGGCGCGGGTGCTGGAAAAGCGGGTGCTGAGCTATGGCGGG
CGGGCAACGGCCTATGGAGCAGTGAGGCTGGAGCGCGACTTTGGCGGCATTGTGGATTGTGTGGCCAGGGGGGAC
TATGGAGTGCGCGAGGGGTTTGCGCGGGTGACGCAGTTGCTCATGGTGGCGAATATGGAGGATGAGGAGTGGGAT
GAGGTGGAGGCGGGAGAGGCTGGCATGGATTGGGTCTTGAGCATGGAGGAGAGGAGGAGGGCGAGGAGCATGGTT
ATACGGGAGCGGGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail