Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3938
Gene name
LocationContig_251:7464..8127
Strand-
Gene length (bp)663
Transcript length (bp)663
Coding sequence length (bp)663
Protein length (aa) 221

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P25576|POF1_YEAST Nicotinamide mononucleotide adenylyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=POF1 PE=1 SV=1 13 207 6.0E-24
sp|Q9P7T7|POF1L_SCHPO Putative nicotinamide mononucleotide adenylyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC694.03 PE=3 SV=1 22 198 4.0E-18

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6388
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4967
Ophiocordyceps australis map64 (Brazil) OphauB2|3938 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|03717
Ophiocordyceps camponoti-rufipedis Ophun1|4693
Ophiocordyceps kimflemingae Ophio5|3412

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3938
MDGEDGECKTRGRDADTRDSSTRILLLLAVKNADKAPQPASFPVRLSMMTALAEALQQDTQLGIDIGVTRLPYFH
DKARGIGESGLYDVALEQVYLAGYDTLVRVFDEKYYGVGRESTEGNMTLGKRGRMKAALDTFFQSAVLQVFLRPD
DGWGSIEEQRDWLRAAVDARWAERILIVEGEDLAGVSSSRVRNKVKMGGQLDGLVDDGVKWWIEQEKLYQ*
Coding >OphauB2|3938
ATGGACGGCGAGGACGGTGAATGTAAAACAAGAGGCAGGGACGCTGACACAAGAGACTCGTCAACTCGAATCCTG
CTTCTCCTAGCCGTCAAGAATGCCGATAAGGCACCGCAGCCAGCCAGCTTTCCCGTGCGACTCTCCATGATGACG
GCTCTGGCTGAGGCCTTGCAGCAAGACACGCAGCTGGGGATCGACATTGGGGTGACGAGGCTGCCCTATTTCCAC
GACAAGGCGCGAGGCATCGGTGAATCGGGCTTGTATGACGTGGCGCTGGAGCAAGTTTACCTTGCGGGATACGAT
ACCCTGGTGCGAGTCTTTGATGAAAAGTACTATGGCGTTGGCCGCGAATCGACCGAGGGCAACATGACCTTGGGC
AAGAGAGGGCGCATGAAAGCTGCTTTGGATACTTTTTTCCAGAGTGCGGTGCTGCAGGTGTTTCTGAGGCCGGAT
GATGGCTGGGGAAGCATTGAGGAGCAGCGAGACTGGCTGCGGGCGGCGGTGGATGCGAGGTGGGCGGAGAGGATC
TTGATTGTGGAGGGTGAGGACTTGGCTGGTGTGAGTAGTTCGCGGGTGAGAAACAAGGTCAAGATGGGAGGGCAG
CTGGACGGCTTGGTGGATGATGGAGTAAAGTGGTGGATTGAACAAGAGAAGTTGTATCAGTAG
Transcript >OphauB2|3938
ATGGACGGCGAGGACGGTGAATGTAAAACAAGAGGCAGGGACGCTGACACAAGAGACTCGTCAACTCGAATCCTG
CTTCTCCTAGCCGTCAAGAATGCCGATAAGGCACCGCAGCCAGCCAGCTTTCCCGTGCGACTCTCCATGATGACG
GCTCTGGCTGAGGCCTTGCAGCAAGACACGCAGCTGGGGATCGACATTGGGGTGACGAGGCTGCCCTATTTCCAC
GACAAGGCGCGAGGCATCGGTGAATCGGGCTTGTATGACGTGGCGCTGGAGCAAGTTTACCTTGCGGGATACGAT
ACCCTGGTGCGAGTCTTTGATGAAAAGTACTATGGCGTTGGCCGCGAATCGACCGAGGGCAACATGACCTTGGGC
AAGAGAGGGCGCATGAAAGCTGCTTTGGATACTTTTTTCCAGAGTGCGGTGCTGCAGGTGTTTCTGAGGCCGGAT
GATGGCTGGGGAAGCATTGAGGAGCAGCGAGACTGGCTGCGGGCGGCGGTGGATGCGAGGTGGGCGGAGAGGATC
TTGATTGTGGAGGGTGAGGACTTGGCTGGTGTGAGTAGTTCGCGGGTGAGAAACAAGGTCAAGATGGGAGGGCAG
CTGGACGGCTTGGTGGATGATGGAGTAAAGTGGTGGATTGAACAAGAGAAGTTGTATCAGTAG
Gene >OphauB2|3938
ATGGACGGCGAGGACGGTGAATGTAAAACAAGAGGCAGGGACGCTGACACAAGAGACTCGTCAACTCGAATCCTG
CTTCTCCTAGCCGTCAAGAATGCCGATAAGGCACCGCAGCCAGCCAGCTTTCCCGTGCGACTCTCCATGATGACG
GCTCTGGCTGAGGCCTTGCAGCAAGACACGCAGCTGGGGATCGACATTGGGGTGACGAGGCTGCCCTATTTCCAC
GACAAGGCGCGAGGCATCGGTGAATCGGGCTTGTATGACGTGGCGCTGGAGCAAGTTTACCTTGCGGGATACGAT
ACCCTGGTGCGAGTCTTTGATGAAAAGTACTATGGCGTTGGCCGCGAATCGACCGAGGGCAACATGACCTTGGGC
AAGAGAGGGCGCATGAAAGCTGCTTTGGATACTTTTTTCCAGAGTGCGGTGCTGCAGGTGTTTCTGAGGCCGGAT
GATGGCTGGGGAAGCATTGAGGAGCAGCGAGACTGGCTGCGGGCGGCGGTGGATGCGAGGTGGGCGGAGAGGATC
TTGATTGTGGAGGGTGAGGACTTGGCTGGTGTGAGTAGTTCGCGGGTGAGAAACAAGGTCAAGATGGGAGGGCAG
CTGGACGGCTTGGTGGATGATGGAGTAAAGTGGTGGATTGAACAAGAGAAGTTGTATCAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail