Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3937
Gene name
LocationContig_251:4601..5856
Strand+
Gene length (bp)1255
Transcript length (bp)1140
Coding sequence length (bp)1140
Protein length (aa) 380

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05181 XPA_C XPA protein C-terminus 1.9E-25 224 274

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P53709|RAD14_CANAL DNA repair protein RAD14 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RAD14 PE=3 SV=2 27 377 4.0E-55
sp|O59753|RAD14_SCHPO DNA repair protein rad14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp14 PE=1 SV=1 114 379 9.0E-49
sp|P28519|RAD14_YEAST DNA repair protein RAD14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD14 PE=1 SV=2 24 379 1.0E-41
sp|P28518|XPA_DROME DNA repair protein complementing XP-A cells homolog OS=Drosophila melanogaster GN=Xpac PE=2 SV=3 189 370 7.0E-19
sp|P27088|XPA_XENLA DNA repair protein complementing XP-A cells homolog OS=Xenopus laevis GN=xpa PE=2 SV=1 193 374 2.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P53709|RAD14_CANAL DNA repair protein RAD14 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RAD14 PE=3 SV=2 27 377 4.0E-55
sp|O59753|RAD14_SCHPO DNA repair protein rad14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp14 PE=1 SV=1 114 379 9.0E-49
sp|P28519|RAD14_YEAST DNA repair protein RAD14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD14 PE=1 SV=2 24 379 1.0E-41
sp|P28518|XPA_DROME DNA repair protein complementing XP-A cells homolog OS=Drosophila melanogaster GN=Xpac PE=2 SV=3 189 370 7.0E-19
sp|P27088|XPA_XENLA DNA repair protein complementing XP-A cells homolog OS=Xenopus laevis GN=xpa PE=2 SV=1 193 374 2.0E-18
sp|P27089|XPA_CHICK DNA repair protein complementing XP-A cells homolog OS=Gallus gallus GN=XPA PE=2 SV=1 193 374 4.0E-18
sp|P23025|XPA_HUMAN DNA repair protein complementing XP-A cells OS=Homo sapiens GN=XPA PE=1 SV=1 193 374 3.0E-16
sp|Q64267|XPA_MOUSE DNA repair protein complementing XP-A cells homolog OS=Mus musculus GN=Xpa PE=1 SV=2 193 374 7.0E-16
sp|Q64029|XPA_CRIGR DNA repair protein complementing XP-A cells homolog (Fragment) OS=Cricetulus griseus GN=XPA PE=2 SV=1 209 297 2.0E-10
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2914
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4968
Ophiocordyceps australis map64 (Brazil) OphauB2|3937 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|03718
Ophiocordyceps camponoti-rufipedis Ophun1|4694
Ophiocordyceps kimflemingae Ophio5|3411
Ophiocordyceps subramaniannii Hirsu2|4888

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3937
MEPSSTPPPSKASPASEPPSRSPQVNQRIAENRLRAKAIREQREAEQRRSHTLPHVPKSASGFVPTDSIHVSKPA
NAKRPYDAALGVAESNRHGSNQSSQDAHRLPPAPKFAKFVDYNMSSMTDTKGGFLSAEDDPHNRAFATAKPDDGQ
RPNNMTVQEWERLRLLRNLRRQKAGPFEPALTVLSDESQRKPCRECRSLEIDFVWEEVFHICVCTKCKESMPQKY
SLLTKTECKEDYLLTDAELRDPQLLPHLSRPNPHKSHWHDMMLFLRFQVEEYAIKTKWGSAEALDAEYERRETQK
KARKEAKFKSKLLDLKRKTRTDAFRRQAGTLGKTGASRFGDTVGASRHLHEWGRTVENHQGITVKTCIECGMEVE
ELEL*
Coding >OphauB2|3937
ATGGAACCCTCGTCCACTCCGCCGCCGTCCAAGGCGTCCCCTGCCTCTGAGCCGCCGTCACGCTCTCCACAAGTC
AATCAACGCATAGCCGAAAACCGCCTCCGCGCAAAGGCCATCCGCGAGCAGCGCGAAGCCGAGCAACGCCGCTCC
CATACACTGCCCCATGTCCCAAAGTCTGCTTCAGGCTTCGTCCCAACAGACTCGATACACGTCTCCAAGCCCGCC
AACGCAAAGCGGCCCTACGACGCTGCCCTCGGCGTCGCCGAATCCAACCGCCATGGAAGCAACCAATCCTCGCAA
GACGCGCATCGTCTCCCGCCTGCGCCCAAGTTTGCAAAGTTTGTGGATTACAATATGAGCTCCATGACGGACACA
AAAGGTGGCTTCCTCTCCGCTGAGGATGATCCGCATAACCGCGCCTTCGCTACCGCCAAGCCCGACGACGGACAG
CGGCCCAACAACATGACGGTCCAAGAGTGGGAGCGACTGCGCCTCTTGCGCAATCTGCGTCGCCAAAAGGCTGGT
CCTTTTGAGCCCGCTCTCACCGTCTTGAGCGACGAGAGCCAGCGCAAGCCATGTCGCGAGTGTAGGAGCCTTGAA
ATCGACTTTGTCTGGGAAGAAGTCTTCCACATTTGTGTCTGCACCAAGTGCAAGGAGAGCATGCCCCAAAAGTAC
TCTCTACTCACCAAGACGGAGTGCAAAGAGGATTACCTCTTGACAGATGCCGAGTTACGCGACCCCCAACTTCTT
CCCCATCTGTCACGCCCAAATCCACACAAGTCCCACTGGCACGACATGATGCTCTTTCTCCGTTTTCAAGTCGAG
GAATACGCCATCAAGACCAAGTGGGGTTCCGCCGAGGCTCTCGACGCCGAGTACGAGCGTCGCGAGACGCAGAAA
AAAGCACGCAAGGAGGCAAAGTTCAAGTCTAAACTACTAGACCTCAAGCGCAAGACGCGTACCGACGCCTTTCGC
CGCCAGGCTGGCACCCTCGGCAAAACGGGTGCCAGCCGCTTTGGAGACACTGTTGGCGCTTCCAGGCACCTTCAT
GAGTGGGGGCGCACCGTGGAGAATCACCAAGGCATCACGGTAAAGACATGTATTGAGTGCGGCATGGAGGTTGAA
GAGCTTGAATTATAA
Transcript >OphauB2|3937
ATGGAACCCTCGTCCACTCCGCCGCCGTCCAAGGCGTCCCCTGCCTCTGAGCCGCCGTCACGCTCTCCACAAGTC
AATCAACGCATAGCCGAAAACCGCCTCCGCGCAAAGGCCATCCGCGAGCAGCGCGAAGCCGAGCAACGCCGCTCC
CATACACTGCCCCATGTCCCAAAGTCTGCTTCAGGCTTCGTCCCAACAGACTCGATACACGTCTCCAAGCCCGCC
AACGCAAAGCGGCCCTACGACGCTGCCCTCGGCGTCGCCGAATCCAACCGCCATGGAAGCAACCAATCCTCGCAA
GACGCGCATCGTCTCCCGCCTGCGCCCAAGTTTGCAAAGTTTGTGGATTACAATATGAGCTCCATGACGGACACA
AAAGGTGGCTTCCTCTCCGCTGAGGATGATCCGCATAACCGCGCCTTCGCTACCGCCAAGCCCGACGACGGACAG
CGGCCCAACAACATGACGGTCCAAGAGTGGGAGCGACTGCGCCTCTTGCGCAATCTGCGTCGCCAAAAGGCTGGT
CCTTTTGAGCCCGCTCTCACCGTCTTGAGCGACGAGAGCCAGCGCAAGCCATGTCGCGAGTGTAGGAGCCTTGAA
ATCGACTTTGTCTGGGAAGAAGTCTTCCACATTTGTGTCTGCACCAAGTGCAAGGAGAGCATGCCCCAAAAGTAC
TCTCTACTCACCAAGACGGAGTGCAAAGAGGATTACCTCTTGACAGATGCCGAGTTACGCGACCCCCAACTTCTT
CCCCATCTGTCACGCCCAAATCCACACAAGTCCCACTGGCACGACATGATGCTCTTTCTCCGTTTTCAAGTCGAG
GAATACGCCATCAAGACCAAGTGGGGTTCCGCCGAGGCTCTCGACGCCGAGTACGAGCGTCGCGAGACGCAGAAA
AAAGCACGCAAGGAGGCAAAGTTCAAGTCTAAACTACTAGACCTCAAGCGCAAGACGCGTACCGACGCCTTTCGC
CGCCAGGCTGGCACCCTCGGCAAAACGGGTGCCAGCCGCTTTGGAGACACTGTTGGCGCTTCCAGGCACCTTCAT
GAGTGGGGGCGCACCGTGGAGAATCACCAAGGCATCACGGTAAAGACATGTATTGAGTGCGGCATGGAGGTTGAA
GAGCTTGAATTATAA
Gene >OphauB2|3937
ATGGAACCCTCGTCCACTCCGCCGCCGTCCAAGGCGTCCCCTGCCTCTGAGCCGCCGTCACGCTCTCCACAAGTC
AATCAACGCATAGTAGGCAGCCCTAGCCAAGTTTGAATGAGGCAAGCATCAATGCTCACTCCAACCCACAGGCCG
AAAACCGCCTCCGCGCAAAGGCCATCCGCGAGCAGCGCGAAGCCGAGCAACGCCGCTCCCATACACTGCCCCATG
TCCCAAAGTCTGCTTCAGGCTTCGTCCCAACAGACTCGATACACGTCTCCAAGCCCGCCAACGCAAAGCGGCCCT
ACGACGCTGCCCTCGGCGTCGCCGAATCCAACCGCCATGGAAGCAACCAATCCTCGCAAGACGCGCATCGTCTCC
CGCCTGCGCCCAAGTTTGCAAAGTTTGTGGATTACAATATGAGCTCCATGACGGACACAAAAGGTGGCTTCCTCT
CCGCTGAGGATGATCCGCATAACCGCGCCTTCGCTACCGCCAAGCCCGACGACGGACAGCGGCCCAACAACATGA
CGGTCCAAGAGTGGGAGCGACTGCGCCTCTTGCGCAATCTGCGTCGCCAAAAGGCTGGTCCTTTTGAGCCCGCTC
TCACCGTCTTGAGCGACGAGAGCCAGCGCAAGCCATGTCGCGAGTGTAGGAGCCTTGAAATCGACTTTGTCTGGG
AAGAAGTCTTCCACATTTGTGTCTGCACCAAGTGCAAGGAGAGCATGCCCCAAAAGTACTCTCTACTCACCAAGA
CGGAGTGCAAAGAGGATTACCTCTTGACAGATGGTACGCCCCTTTTGTCACGCCATGATGCAAACACCAGCAGCT
CTGACACGTTGCAGCCGAGTTACGCGACCCCCAACTTCTTCCCCATCTGTCACGCCCAAATCCACACAAGTCCCA
CTGGCACGACATGATGCTCTTTCTCCGTTTTCAAGTCGAGGAATACGCCATCAAGACCAAGTGGGGTTCCGCCGA
GGCTCTCGACGCCGAGTACGAGCGTCGCGAGACGCAGAAAAAAGCACGCAAGGAGGCAAAGTTCAAGTCTAAACT
ACTAGACCTCAAGCGCAAGACGCGTACCGACGCCTTTCGCCGCCAGGCTGGCACCCTCGGCAAAACGGGTGCCAG
CCGCTTTGGAGACACTGTTGGCGCTTCCAGGCACCTTCATGAGTGGGGGCGCACCGTGGAGAATCACCAAGGCAT
CACGGTAAAGACATGTATTGAGTGCGGCATGGAGGTTGAAGAGCTTGAATTATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail