Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|391
Gene name
LocationContig_104:30493..30862
Strand+
Gene length (bp)369
Transcript length (bp)369
Coding sequence length (bp)369
Protein length (aa) 123

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03330 DPBB_1 Lytic transglycolase 2.5E-09 31 116

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4B2H3|ALL7_ARTBC Allergen Asp f 7 homolog OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02701 PE=3 SV=1 22 107 2.0E-11
sp|O42799|ALL7_ASPFU Allergen Asp f 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_4G06670 PE=1 SV=2 31 115 6.0E-07
sp|P86242|PAPI_STRMB Papain inhibitor OS=Streptomyces mobaraensis GN=pi PE=1 SV=2 30 106 5.0E-06

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 27 0.999723

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup336
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1525
Ophiocordyceps australis map64 (Brazil) OphauB2|391 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7992
Ophiocordyceps camponoti-floridani Ophcf2|01995
Ophiocordyceps camponoti-rufipedis Ophun1|7171
Ophiocordyceps kimflemingae Ophio5|5939
Ophiocordyceps kimflemingae Ophio5|6574
Ophiocordyceps subramaniannii Hirsu2|3974
Ophiocordyceps subramaniannii Hirsu2|6444

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|391
MLSTKLSTLLALALAVCAAPAPDTAAAASSGQITYYYPGLGACGQTNGANDAIVAVSAPLFDSQRPCGRNIRVKY
GGRSVVVRVVDRCAGCAYNDLDLSPTAFQQVVGDLGKGRVPASWEWA*
Coding >OphauB2|391
ATGCTTTCCACCAAACTCTCCACCCTCTTGGCCCTCGCCCTCGCCGTCTGCGCCGCCCCCGCGCCAGACACCGCC
GCCGCTGCCTCTTCGGGGCAGATTACTTACTACTATCCCGGCCTCGGCGCATGCGGCCAGACAAACGGCGCAAAC
GACGCCATTGTCGCCGTCTCGGCTCCCCTCTTTGATAGCCAGAGGCCGTGTGGGCGCAATATTCGCGTCAAGTAT
GGCGGCCGCTCGGTTGTCGTGCGCGTCGTGGATCGCTGCGCCGGTTGCGCCTATAATGATCTCGATCTCTCGCCT
ACCGCCTTTCAGCAGGTCGTGGGCGATCTCGGAAAGGGTCGCGTTCCGGCGTCGTGGGAGTGGGCCTAG
Transcript >OphauB2|391
ATGCTTTCCACCAAACTCTCCACCCTCTTGGCCCTCGCCCTCGCCGTCTGCGCCGCCCCCGCGCCAGACACCGCC
GCCGCTGCCTCTTCGGGGCAGATTACTTACTACTATCCCGGCCTCGGCGCATGCGGCCAGACAAACGGCGCAAAC
GACGCCATTGTCGCCGTCTCGGCTCCCCTCTTTGATAGCCAGAGGCCGTGTGGGCGCAATATTCGCGTCAAGTAT
GGCGGCCGCTCGGTTGTCGTGCGCGTCGTGGATCGCTGCGCCGGTTGCGCCTATAATGATCTCGATCTCTCGCCT
ACCGCCTTTCAGCAGGTCGTGGGCGATCTCGGAAAGGGTCGCGTTCCGGCGTCGTGGGAGTGGGCCTAG
Gene >OphauB2|391
ATGCTTTCCACCAAACTCTCCACCCTCTTGGCCCTCGCCCTCGCCGTCTGCGCCGCCCCCGCGCCAGACACCGCC
GCCGCTGCCTCTTCGGGGCAGATTACTTACTACTATCCCGGCCTCGGCGCATGCGGCCAGACAAACGGCGCAAAC
GACGCCATTGTCGCCGTCTCGGCTCCCCTCTTTGATAGCCAGAGGCCGTGTGGGCGCAATATTCGCGTCAAGTAT
GGCGGCCGCTCGGTTGTCGTGCGCGTCGTGGATCGCTGCGCCGGTTGCGCCTATAATGATCTCGATCTCTCGCCT
ACCGCCTTTCAGCAGGTCGTGGGCGATCTCGGAAAGGGTCGCGTTCCGGCGTCGTGGGAGTGGGCCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail