Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3909
Gene name
LocationContig_25:133223..134625
Strand+
Gene length (bp)1402
Transcript length (bp)1086
Coding sequence length (bp)1086
Protein length (aa) 362

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00149 Metallophos Calcineurin-like phosphoesterase 9.6E-23 45 178

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A0C1E4|PPX3_PARTE Serine/threonine-protein phosphatase PP-X homolog 3 OS=Paramecium tetraurelia GN=Ppx3 PE=3 SV=1 2 153 9.0E-81
sp|A0CCD2|PPX4_PARTE Serine/threonine-protein phosphatase PP-X homolog 4 OS=Paramecium tetraurelia GN=Ppx4 PE=3 SV=1 2 153 1.0E-80
sp|P48529|PPX1_ARATH Serine/threonine-protein phosphatase PP-X isozyme 1 OS=Arabidopsis thaliana GN=PPX1 PE=2 SV=1 1 153 1.0E-80
sp|Q6P861|PP4C_XENTR Serine/threonine-protein phosphatase 4 catalytic subunit OS=Xenopus tropicalis GN=ppp4c PE=2 SV=1 1 155 4.0E-80
sp|Q6IP91|PP4C_XENLA Serine/threonine-protein phosphatase 4 catalytic subunit OS=Xenopus laevis GN=ppp4c PE=2 SV=1 1 155 4.0E-80
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A0C1E4|PPX3_PARTE Serine/threonine-protein phosphatase PP-X homolog 3 OS=Paramecium tetraurelia GN=Ppx3 PE=3 SV=1 2 153 9.0E-81
sp|A0CCD2|PPX4_PARTE Serine/threonine-protein phosphatase PP-X homolog 4 OS=Paramecium tetraurelia GN=Ppx4 PE=3 SV=1 2 153 1.0E-80
sp|P48529|PPX1_ARATH Serine/threonine-protein phosphatase PP-X isozyme 1 OS=Arabidopsis thaliana GN=PPX1 PE=2 SV=1 1 153 1.0E-80
sp|Q6P861|PP4C_XENTR Serine/threonine-protein phosphatase 4 catalytic subunit OS=Xenopus tropicalis GN=ppp4c PE=2 SV=1 1 155 4.0E-80
sp|Q6IP91|PP4C_XENLA Serine/threonine-protein phosphatase 4 catalytic subunit OS=Xenopus laevis GN=ppp4c PE=2 SV=1 1 155 4.0E-80
sp|Q5BJ92|PP4C_RAT Serine/threonine-protein phosphatase 4 catalytic subunit OS=Rattus norvegicus GN=Ppp4c PE=2 SV=1 1 155 4.0E-80
sp|Q5R6K8|PP4C_PONAB Serine/threonine-protein phosphatase 4 catalytic subunit OS=Pongo abelii GN=PPP4C PE=2 SV=1 1 155 4.0E-80
sp|P97470|PP4C_MOUSE Serine/threonine-protein phosphatase 4 catalytic subunit OS=Mus musculus GN=Ppp4c PE=1 SV=2 1 155 4.0E-80
sp|P60510|PP4C_HUMAN Serine/threonine-protein phosphatase 4 catalytic subunit OS=Homo sapiens GN=PPP4C PE=1 SV=1 1 155 4.0E-80
sp|A6H772|PP4C_BOVIN Serine/threonine-protein phosphatase 4 catalytic subunit OS=Bos taurus GN=PPP4C PE=1 SV=1 1 155 4.0E-80
sp|A9JRC7|PP4CB_DANRE Serine/threonine-protein phosphatase 4 catalytic subunit B OS=Danio rerio GN=ppp4cb PE=2 SV=1 1 155 6.0E-80
sp|P11084|PP4C_RABIT Serine/threonine-protein phosphatase 4 catalytic subunit OS=Oryctolagus cuniculus GN=PPP4C PE=1 SV=2 1 155 6.0E-79
sp|P48528|PPX2_ARATH Serine/threonine-protein phosphatase PP-X isozyme 2 OS=Arabidopsis thaliana GN=PPX2 PE=2 SV=2 1 153 9.0E-79
sp|A8WGP3|PP4CA_DANRE Serine/threonine-protein phosphatase 4 catalytic subunit A OS=Danio rerio GN=ppp4ca PE=2 SV=1 1 155 5.0E-78
sp|Q9Y0B7|PP4C_DICDI Serine/threonine-protein phosphatase 4 catalytic subunit OS=Dictyostelium discoideum GN=ppp4c PE=1 SV=1 2 155 1.0E-77
sp|O76932|PP4C_DROME Serine/threonine-protein phosphatase 4 catalytic subunit OS=Drosophila melanogaster GN=Pp4-19C PE=2 SV=1 2 155 1.0E-77
sp|A8XE00|PP4C1_CAEBR Serine/threonine-protein phosphatase 4 catalytic subunit 1 OS=Caenorhabditis briggsae GN=pph-4.1 PE=3 SV=1 3 155 1.0E-75
sp|Q9XW79|PP4C1_CAEEL Serine/threonine-protein phosphatase 4 catalytic subunit 1 OS=Caenorhabditis elegans GN=pph-4.1 PE=1 SV=1 3 155 8.0E-75
sp|O74789|YOU5_SCHPO Putative serine/threonine-protein phosphatase C26H8.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC26H8.05c PE=1 SV=1 3 155 1.0E-74
sp|P49576|PPX1_PARTE Serine/threonine-protein phosphatase PP-X homolog 1 OS=Paramecium tetraurelia GN=Ppx1 PE=3 SV=2 1 153 3.0E-74
sp|A0DJ90|PPX2_PARTE Serine/threonine-protein phosphatase PP-X homolog 2 OS=Paramecium tetraurelia GN=Ppx2 PE=3 SV=1 1 153 6.0E-74
sp|P32345|PP4C_YEAST Serine/threonine-protein phosphatase 4 catalytic subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPH3 PE=1 SV=2 1 153 2.0E-72
sp|P48463|PP2AA_CHICK Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Gallus gallus GN=PPP2CA PE=2 SV=1 3 162 5.0E-72
sp|P23778|PP2A_BRANA Serine/threonine-protein phosphatase PP2A catalytic subunit (Fragment) OS=Brassica napus PE=2 SV=2 3 153 1.0E-71
sp|Q0P594|PP2AB_BOVIN Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform OS=Bos taurus GN=PPP2CB PE=1 SV=1 2 162 3.0E-71
sp|P36614|PPE1_SCHPO Serine/threonine-protein phosphatase ppe1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppe1 PE=1 SV=1 1 153 4.0E-71
sp|Q9XGH7|PP2A_TOBAC Serine/threonine-protein phosphatase PP2A catalytic subunit OS=Nicotiana tabacum PE=2 SV=1 3 153 4.0E-71
sp|P0C5D7|PP2A4_ORYSI Putative serine/threonine-protein phosphatase PP2A-4 catalytic subunit OS=Oryza sativa subsp. indica GN=PP2A4 PE=3 SV=1 4 153 5.0E-71
sp|A3C4N5|PP2A4_ORYSJ Serine/threonine-protein phosphatase PP2A-4 catalytic subunit OS=Oryza sativa subsp. japonica GN=PP2A4 PE=2 SV=2 4 153 6.0E-71
sp|P11611|PP2AB_RABIT Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform OS=Oryctolagus cuniculus GN=PPP2CB PE=1 SV=1 2 162 1.0E-70
sp|Q06009|PP2A_MEDSA Serine/threonine-protein phosphatase PP2A catalytic subunit OS=Medicago sativa GN=PP2A PE=2 SV=1 3 153 1.0E-70
sp|P62716|PP2AB_RAT Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform OS=Rattus norvegicus GN=Ppp2cb PE=2 SV=1 2 162 1.0E-70
sp|P62715|PP2AB_MOUSE Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform OS=Mus musculus GN=Ppp2cb PE=1 SV=1 2 162 1.0E-70
sp|P62714|PP2AB_HUMAN Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform OS=Homo sapiens GN=PPP2CB PE=1 SV=1 2 162 1.0E-70
sp|Q07098|PP2A2_ARATH Serine/threonine-protein phosphatase PP2A-2 catalytic subunit OS=Arabidopsis thaliana GN=PP2A2 PE=1 SV=1 3 153 2.0E-70
sp|P48578|PP2A3_ARATH Serine/threonine-protein phosphatase PP2A-3 catalytic subunit OS=Arabidopsis thaliana GN=PP2A3 PE=2 SV=1 3 153 2.0E-70
sp|Q10BT5|PP2A2_ORYSJ Serine/threonine-protein phosphatase PP2A-2 catalytic subunit OS=Oryza sativa subsp. japonica GN=PP2A2 PE=2 SV=1 4 153 2.0E-70
sp|A2XN40|PP2A2_ORYSI Serine/threonine-protein phosphatase PP2A-2 catalytic subunit OS=Oryza sativa subsp. indica GN=PP2A2 PE=2 SV=2 4 153 2.0E-70
sp|O04860|PP2A5_TOBAC Serine/threonine-protein phosphatase PP2A-5 catalytic subunit OS=Nicotiana tabacum GN=NPP5 PE=2 SV=1 3 153 2.0E-70
sp|Q0DBD3|PP2A1_ORYSJ Serine/threonine-protein phosphatase PP2A-1 catalytic subunit OS=Oryza sativa subsp. japonica GN=PP2A1 PE=2 SV=1 2 153 2.0E-70
sp|A2YEB4|PP2A1_ORYSI Serine/threonine-protein phosphatase PP2A-1 catalytic subunit OS=Oryza sativa subsp. indica GN=PP2A1 PE=2 SV=1 2 153 2.0E-70
sp|Q9XZE5|PP2AA_DICDI Serine/threonine-protein phosphatase 2A catalytic subunit A OS=Dictyostelium discoideum GN=pho2a PE=1 SV=1 3 153 4.0E-70
sp|Q07100|PP2A4_ARATH Serine/threonine-protein phosphatase PP2A-4 catalytic subunit OS=Arabidopsis thaliana GN=PP2A4 PE=2 SV=2 3 153 6.0E-70
sp|P23696|PP2A_DROME Serine/threonine-protein phosphatase PP2A OS=Drosophila melanogaster GN=mts PE=2 SV=1 3 162 6.0E-70
sp|P63331|PP2AA_RAT Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Rattus norvegicus GN=Ppp2ca PE=1 SV=1 3 162 1.0E-69
sp|P63330|PP2AA_MOUSE Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Mus musculus GN=Ppp2ca PE=1 SV=1 3 162 1.0E-69
sp|P67777|PP2AA_RABIT Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Oryctolagus cuniculus GN=PPP2CA PE=2 SV=1 3 162 1.0E-69
sp|P67776|PP2AA_PIG Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Sus scrofa GN=PPP2CA PE=2 SV=1 3 162 1.0E-69
sp|P67775|PP2AA_HUMAN Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Homo sapiens GN=PPP2CA PE=1 SV=1 3 162 1.0E-69
sp|P67774|PP2AA_BOVIN Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Bos taurus GN=PPP2CA PE=1 SV=1 3 162 1.0E-69
sp|Q0E2S4|PP2A3_ORYSJ Serine/threonine-protein phosphatase PP2A-3 catalytic subunit OS=Oryza sativa subsp. japonica GN=PP2A3 PE=2 SV=1 3 153 1.0E-69
sp|A2X2G3|PP2A3_ORYSI Serine/threonine-protein phosphatase PP2A-3 catalytic subunit OS=Oryza sativa subsp. indica GN=PP2A3 PE=2 SV=2 3 153 1.0E-69
sp|Q9ZSE4|PP2A_HEVBR Serine/threonine-protein phosphatase PP2A catalytic subunit OS=Hevea brasiliensis GN=PP2A PE=2 SV=1 3 153 2.0E-69
sp|Q9U9A3|PPP6_DICDI Serine/threonine-protein phosphatase 6 catalytic subunit OS=Dictyostelium discoideum GN=ppp6c PE=2 SV=2 4 155 3.0E-69
sp|Q07099|PP2A1_ARATH Serine/threonine-protein phosphatase PP2A-1 catalytic subunit OS=Arabidopsis thaliana GN=PP2A1 PE=1 SV=1 3 153 4.0E-69
sp|P23636|PP2A2_SCHPO Major serine/threonine-protein phosphatase PP2A-2 catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppa2 PE=3 SV=1 1 153 4.0E-69
sp|Q9HFQ2|PP2A1_EMENI Serine/threonine-protein phosphatase PP2A catalytic subunit OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pphA PE=3 SV=2 1 153 5.0E-69
sp|P48579|PP2A_HELAN Serine/threonine-protein phosphatase PP2A catalytic subunit OS=Helianthus annuus PE=2 SV=1 2 153 5.0E-69
sp|Q6FM81|PP4C_CANGA Serine/threonine-protein phosphatase 4 catalytic subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PPH3 PE=3 SV=1 1 153 7.0E-69
sp|Q9XTT8|PP4C2_CAEEL Serine/threonine-protein phosphatase 4 catalytic subunit 2 OS=Caenorhabditis elegans GN=pph-4.2 PE=2 SV=1 2 155 1.0E-68
sp|Q8X178|PP2A2_BLUGH Serine/threonine-protein phosphatase PP2A-2 catalytic subunit OS=Blumeria graminis f. sp. hordei GN=PP2A-2 PE=3 SV=1 1 153 1.0E-68
sp|Q74ZR2|PP4C_ASHGO Serine/threonine-protein phosphatase 4 catalytic subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PPH3 PE=3 SV=2 4 155 2.0E-68
sp|P48580|PP2A1_NEUCR Serine/threonine-protein phosphatase PP2A catalytic subunit OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pph-1 PE=3 SV=3 4 153 1.0E-67
sp|P11493|PP2AB_PIG Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform (Fragment) OS=Sus scrofa GN=PPP2CB PE=2 SV=2 11 162 2.0E-67
sp|Q9LHE7|FYPP3_ARATH Phytochrome-associated serine/threonine-protein phosphatase 3 OS=Arabidopsis thaliana GN=FYPP3 PE=1 SV=1 3 156 8.0E-67
sp|O04951|PP2A5_ARATH Serine/threonine-protein phosphatase PP2A-5 catalytic subunit OS=Arabidopsis thaliana GN=PP2A5 PE=1 SV=1 3 153 2.0E-66
sp|Q8LSN3|FYPP_PEA Phytochrome-associated serine/threonine-protein phosphatase OS=Pisum sativum GN=FYPP PE=1 SV=1 3 181 3.0E-66
sp|Q27884|PPP6_DROME Serine/threonine-protein phosphatase 6 catalytic subunit OS=Drosophila melanogaster GN=PpV PE=2 SV=1 1 153 6.0E-66
sp|P20604|PP11_YEAST Serine/threonine-protein phosphatase PP1-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIT4 PE=1 SV=1 5 155 1.0E-65
sp|P48577|PP2A_ACEPE Serine/threonine-protein phosphatase PP2A-1 catalytic subunit OS=Acetabularia peniculus PE=2 SV=1 4 153 1.0E-65
sp|Q6CNT6|PP4C_KLULA Serine/threonine-protein phosphatase 4 catalytic subunit OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PPH3 PE=3 SV=1 1 153 1.0E-65
sp|Q9SX52|FYPP1_ARATH Phytochrome-associated serine/threonine-protein phosphatase 1 OS=Arabidopsis thaliana GN=FYPP1 PE=2 SV=1 3 156 2.0E-65
sp|O00743|PPP6_HUMAN Serine/threonine-protein phosphatase 6 catalytic subunit OS=Homo sapiens GN=PPP6C PE=1 SV=1 3 153 3.0E-65
sp|Q64620|PPP6_RAT Serine/threonine-protein phosphatase 6 catalytic subunit OS=Rattus norvegicus GN=Ppp6c PE=2 SV=2 3 153 4.0E-65
sp|Q9CQR6|PPP6_MOUSE Serine/threonine-protein phosphatase 6 catalytic subunit OS=Mus musculus GN=Ppp6c PE=1 SV=1 3 153 4.0E-65
sp|Q59KY8|SIT4_CANAL Serine/threonine-protein phosphatase SIT4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SIT4 PE=1 SV=1 5 155 2.0E-64
sp|P23635|PP2A1_SCHPO Minor serine/threonine-protein phosphatase PP2A-1 catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppa1 PE=3 SV=1 1 153 3.0E-64
sp|P23594|PP2A1_YEAST Serine/threonine-protein phosphatase PP2A-1 catalytic subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPH21 PE=1 SV=1 1 153 3.0E-63
sp|P23595|PP2A2_YEAST Serine/threonine-protein phosphatase PP2A-2 catalytic subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPH22 PE=1 SV=1 1 153 5.0E-63
sp|Q54RD6|PP2AB_DICDI Probable serine/threonine-protein phosphatase 2A catalytic subunit B OS=Dictyostelium discoideum GN=DDB_G0283187 PE=3 SV=1 3 153 7.0E-63
sp|Q10298|YD44_SCHPO Putative serine/threonine-protein phosphatase C22H10.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22H10.04 PE=3 SV=1 1 153 1.0E-61
sp|Q6BFF6|PP2A3_PARTE Serine/threonine-protein phosphatase PP2A catalytic subunit 3 OS=Paramecium tetraurelia GN=Ppn3 PE=3 SV=1 1 153 8.0E-61
sp|A0CNL9|PP2A2_PARTE Serine/threonine-protein phosphatase PP2A catalytic subunit 2 OS=Paramecium tetraurelia GN=Ppn2 PE=3 SV=1 1 153 1.0E-60
sp|P48726|PP2A1_PARTE Serine/threonine-protein phosphatase PP2A catalytic subunit 1 OS=Paramecium tetraurelia GN=Ppn1 PE=3 SV=2 1 153 2.0E-60
sp|P32838|PP2A4_YEAST Serine/threonine-protein phosphatase PP2A-like PPG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPG1 PE=1 SV=2 3 153 5.0E-59
sp|Q09496|PPH6_CAEEL Putative serine/threonine-protein phosphatase pph-6 OS=Caenorhabditis elegans GN=pph-6 PE=3 SV=2 5 153 1.0E-54
sp|Q5A6B6|PPG1_CANAL Serine/threonine-protein phosphatase PP2A-like PPG1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PPG1 PE=1 SV=1 1 155 2.0E-54
sp|Q27497|GLC7A_CAEEL Serine/threonine-protein phosphatase PP1-alpha OS=Caenorhabditis elegans GN=gsp-1 PE=3 SV=2 1 153 5.0E-43
sp|Q61JR3|GLC7A_CAEBR Serine/threonine-protein phosphatase PP1-alpha OS=Caenorhabditis briggsae GN=gsp-1 PE=3 SV=1 1 153 5.0E-43
sp|Q9UW86|PP1_NEUCR Serine/threonine-protein phosphatase PP1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pph-3 PE=2 SV=1 3 153 1.0E-41
sp|P20654|PP1_EMENI Serine/threonine-protein phosphatase PP1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bimG PE=2 SV=1 3 153 3.0E-41
sp|P30366|PP11_ARATH Serine/threonine-protein phosphatase PP1 isozyme 1 OS=Arabidopsis thaliana GN=TOPP1 PE=2 SV=1 1 153 5.0E-41
sp|Q5I085|PP1B_XENTR Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Xenopus tropicalis GN=ppp1cb PE=2 SV=1 3 153 7.0E-41
sp|Q6GQL2|PP1B_XENLA Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Xenopus laevis GN=ppp1cb PE=2 SV=1 3 153 7.0E-41
sp|P48462|PP1B_DROME Serine/threonine-protein phosphatase beta isoform OS=Drosophila melanogaster GN=flw PE=1 SV=1 4 153 8.0E-41
sp|P62142|PP1B_RAT Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Rattus norvegicus GN=Ppp1cb PE=1 SV=3 8 153 9.0E-41
sp|P62143|PP1B_RABIT Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Oryctolagus cuniculus GN=PPP1CB PE=1 SV=3 8 153 9.0E-41
sp|Q5R740|PP1B_PONAB Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Pongo abelii GN=PPP1CB PE=2 SV=1 8 153 9.0E-41
sp|P61292|PP1B_PIG Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Sus scrofa GN=PPP1CB PE=1 SV=3 8 153 9.0E-41
sp|P62141|PP1B_MOUSE Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Mus musculus GN=Ppp1cb PE=1 SV=3 8 153 9.0E-41
sp|P62140|PP1B_HUMAN Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Homo sapiens GN=PPP1CB PE=1 SV=3 8 153 9.0E-41
sp|P62207|PP1B_CHICK Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Gallus gallus GN=PPP1CB PE=1 SV=3 8 153 9.0E-41
sp|Q8MJ47|PP1B_CANLF Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Canis lupus familiaris GN=PPP1CB PE=2 SV=4 8 153 9.0E-41
sp|Q3SWW9|PP1B_BOVIN Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Bos taurus GN=PPP1CB PE=2 SV=1 8 153 9.0E-41
sp|P13681|PP11_SCHPO Serine/threonine-protein phosphatase PP1-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dis2 PE=1 SV=1 3 153 1.0E-40
sp|P48484|PP14_ARATH Serine/threonine-protein phosphatase PP1 isozyme 4 OS=Arabidopsis thaliana GN=TOPP4 PE=1 SV=1 1 153 2.0E-40
sp|P48489|PP1_ORYSJ Serine/threonine-protein phosphatase PP1 OS=Oryza sativa subsp. japonica GN=Os03g0268000 PE=2 SV=2 1 153 2.0E-40
sp|P48480|PP11_ACEPE Serine/threonine-protein phosphatase PP1 isozyme 1 OS=Acetabularia peniculus PE=3 SV=1 1 153 2.0E-40
sp|P36873|PP1G_HUMAN Serine/threonine-protein phosphatase PP1-gamma catalytic subunit OS=Homo sapiens GN=PPP1CC PE=1 SV=1 1 153 3.0E-40
sp|P32598|PP12_YEAST Serine/threonine-protein phosphatase PP1-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GLC7 PE=1 SV=1 3 153 3.0E-40
sp|P62137|PP1A_MOUSE Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Mus musculus GN=Ppp1ca PE=1 SV=1 3 153 4.0E-40
sp|O82734|PP18_ARATH Serine/threonine-protein phosphatase PP1 isozyme 8 OS=Arabidopsis thaliana GN=TOPP8 PE=2 SV=3 17 153 4.0E-40
sp|P32945|PPQ1_YEAST Serine/threonine-protein phosphatase PPQ OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPQ1 PE=1 SV=1 16 153 5.0E-40
sp|Q8WMS6|PP1A_CANLF Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Canis lupus familiaris GN=PPP1CA PE=2 SV=1 3 153 5.0E-40
sp|Q627N3|GLC7B_CAEBR Serine/threonine-protein phosphatase PP1-beta OS=Caenorhabditis briggsae GN=gsp-2 PE=3 SV=1 3 153 5.0E-40
sp|P48727|GLC7B_CAEEL Serine/threonine-protein phosphatase PP1-beta OS=Caenorhabditis elegans GN=gsp-2 PE=2 SV=1 3 153 6.0E-40
sp|P63088|PP1G_RAT Serine/threonine-protein phosphatase PP1-gamma catalytic subunit OS=Rattus norvegicus GN=Ppp1cc PE=1 SV=1 1 153 7.0E-40
sp|P63087|PP1G_MOUSE Serine/threonine-protein phosphatase PP1-gamma catalytic subunit OS=Mus musculus GN=Ppp1cc PE=1 SV=1 1 153 7.0E-40
sp|P61287|PP1G_BOVIN Serine/threonine-protein phosphatase PP1-gamma catalytic subunit OS=Bos taurus GN=PPP1CC PE=2 SV=1 1 153 7.0E-40
sp|Q9M9W3|PP19_ARATH Serine/threonine-protein phosphatase PP1 isozyme 9 OS=Arabidopsis thaliana GN=TOPP9 PE=2 SV=1 17 153 7.0E-40
sp|Q6NVU2|PPIG_XENTR Serine/threonine-protein phosphatase PP1-gamma catalytic subunit OS=Xenopus tropicalis GN=ppp1cc PE=2 SV=1 1 153 8.0E-40
sp|P36874|PP1GA_XENLA Serine/threonine-protein phosphatase PP1-gamma catalytic subunit A OS=Xenopus laevis GN=ppp1cc-a PE=1 SV=2 1 153 8.0E-40
sp|Q7SZ10|PP1GB_XENLA Serine/threonine-protein phosphatase PP1-gamma catalytic subunit B OS=Xenopus laevis GN=ppp1cc-b PE=2 SV=1 1 153 8.0E-40
sp|Q8MJ46|PP1G_CANLF Serine/threonine-protein phosphatase PP1-gamma catalytic subunit OS=Canis lupus familiaris GN=PPP1CC PE=2 SV=1 1 153 1.0E-39
sp|P48461|PP11_DROME Serine/threonine-protein phosphatase alpha-1 isoform OS=Drosophila melanogaster GN=Pp1alpha-96A PE=1 SV=1 1 153 1.0E-39
sp|P62138|PP1A_RAT Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Rattus norvegicus GN=Ppp1ca PE=1 SV=1 3 153 1.0E-39
sp|P62139|PP1A_RABIT Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Oryctolagus cuniculus GN=PPP1CA PE=1 SV=1 3 153 1.0E-39
sp|P62136|PP1A_HUMAN Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Homo sapiens GN=PPP1CA PE=1 SV=1 3 153 1.0E-39
sp|Q3T0E7|PP1A_BOVIN Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Bos taurus GN=PPP1CA PE=2 SV=1 3 153 1.0E-39
sp|O82733|PP17_ARATH Serine/threonine-protein phosphatase PP1 isozyme 7 OS=Arabidopsis thaliana GN=TOPP7 PE=2 SV=3 4 153 1.0E-39
sp|P48482|PP12_ARATH Serine/threonine-protein phosphatase PP1 isozyme 2 OS=Arabidopsis thaliana GN=TOPP2 PE=1 SV=1 19 153 1.0E-39
sp|P12982|PP12_DROME Serine/threonine-protein phosphatase alpha-2 isoform OS=Drosophila melanogaster GN=Pp1-87B PE=1 SV=1 3 153 2.0E-39
sp|P22198|PP1_MAIZE Serine/threonine-protein phosphatase PP1 OS=Zea mays GN=PP1 PE=2 SV=1 1 153 5.0E-39
sp|O04857|PP12_TOBAC Serine/threonine-protein phosphatase PP1 isozyme 2 OS=Nicotiana tabacum GN=NPP2 PE=2 SV=1 1 153 6.0E-39
sp|P48488|PP1_MEDSV Serine/threonine-protein phosphatase PP1 OS=Medicago sativa subsp. varia GN=PP1 PE=2 SV=1 17 153 7.0E-39
sp|P48490|PP1_PHAVU Serine/threonine-protein phosphatase PP1 OS=Phaseolus vulgaris PE=2 SV=1 17 153 9.0E-39
sp|O15757|PP1_DICDI Serine/threonine-protein phosphatase PP1 OS=Dictyostelium discoideum GN=pppB PE=1 SV=1 3 153 1.0E-38
sp|Q05547|PP13_DROME Serine/threonine-protein phosphatase alpha-3 isoform OS=Drosophila melanogaster GN=Pp1-13C PE=1 SV=1 8 153 1.0E-38
sp|P48487|PP1_BRAOL Serine/threonine-protein phosphatase PP1 OS=Brassica oleracea GN=PP1 PE=2 SV=1 1 153 2.0E-38
sp|O04856|PP11_TOBAC Serine/threonine-protein phosphatase PP1 isozyme 1 OS=Nicotiana tabacum GN=NPP1 PE=2 SV=1 1 153 4.0E-38
sp|P26570|PPZ1_YEAST Serine/threonine-protein phosphatase PP-Z1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPZ1 PE=1 SV=5 22 155 4.0E-38
sp|P33329|PPZ2_YEAST Serine/threonine-protein phosphatase PP-Z2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPZ2 PE=1 SV=4 17 155 4.0E-38
sp|P48485|PP15_ARATH Serine/threonine-protein phosphatase PP1 isozyme 5 OS=Arabidopsis thaliana GN=TOPP5 PE=1 SV=1 19 153 6.0E-38
sp|P48481|PP12_ACEPE Serine/threonine-protein phosphatase PP1 isozyme 2 OS=Acetabularia peniculus PE=3 SV=1 1 153 8.0E-38
sp|P23880|PP12_SCHPO Serine/threonine-protein phosphatase PP1-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sds21 PE=3 SV=1 3 153 9.0E-38
sp|P48483|PP13_ARATH Serine/threonine-protein phosphatase PP1 isozyme 3 OS=Arabidopsis thaliana GN=TOPP3 PE=2 SV=1 17 153 2.0E-37
sp|P48486|PP16_ARATH Serine/threonine-protein phosphatase PP1 isozyme 6 OS=Arabidopsis thaliana GN=TOPP6 PE=1 SV=2 17 153 2.0E-36
sp|P23734|PP12_TRYBB Serine/threonine-protein phosphatase PP1(5.9) OS=Trypanosoma brucei brucei PE=3 SV=2 17 155 3.0E-36
sp|P78968|PPZ_SCHPO Serine/threonine-protein phosphatase PP-Z OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pzh1 PE=1 SV=1 19 172 5.0E-36
sp|O04858|PP13_TOBAC Serine/threonine-protein phosphatase PP1 isozyme 3 OS=Nicotiana tabacum GN=NPP3 PE=2 SV=1 6 153 6.0E-36
sp|P23733|PP11_TRYBB Serine/threonine-protein phosphatase PP1(4.8) OS=Trypanosoma brucei brucei PE=3 SV=2 17 155 1.0E-35
sp|Q27889|PP2B2_DROME Serine/threonine-protein phosphatase 2B catalytic subunit 2 OS=Drosophila melanogaster GN=Pp2B-14D PE=1 SV=2 17 153 2.0E-35
sp|P48456|PP2B1_DROME Serine/threonine-protein phosphatase 2B catalytic subunit 1 OS=Drosophila melanogaster GN=CanA1 PE=2 SV=2 17 153 3.0E-35
sp|O42773|PP2B1_CRYNH Serine/threonine-protein phosphatase 2B catalytic subunit A1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CNA1 PE=3 SV=1 25 153 3.0E-35
sp|Q12705|PP2B_SCHPO Serine/threonine-protein phosphatase 2B catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppb1 PE=3 SV=2 25 153 5.0E-35
sp|P14747|PP2B2_YEAST Serine/threonine-protein phosphatase 2B catalytic subunit A2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMP2 PE=1 SV=2 29 155 1.0E-34
sp|P63329|PP2BA_RAT Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform OS=Rattus norvegicus GN=Ppp3ca PE=1 SV=1 32 153 3.0E-34
sp|P63328|PP2BA_MOUSE Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform OS=Mus musculus GN=Ppp3ca PE=1 SV=1 32 153 3.0E-34
sp|Q7YSW8|PP2BA_DICDI Calcineurin subunit A OS=Dictyostelium discoideum GN=canA PE=1 SV=1 22 155 3.0E-34
sp|Q08209|PP2BA_HUMAN Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform OS=Homo sapiens GN=PPP3CA PE=1 SV=1 32 153 3.0E-34
sp|P48452|PP2BA_BOVIN Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform OS=Bos taurus GN=PPP3CA PE=1 SV=1 32 153 3.0E-34
sp|Q9VXF1|PP2B3_DROME Serine/threonine-protein phosphatase 2B catalytic subunit 3 OS=Drosophila melanogaster GN=CanA-14F PE=1 SV=4 17 153 3.0E-34
sp|Q4WUR1|PP2B_ASPFU Serine/threonine-protein phosphatase 2B catalytic subunit OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cnaA PE=3 SV=2 25 153 5.0E-34
sp|P20651|PP2BB_RAT Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform OS=Rattus norvegicus GN=Ppp3cb PE=1 SV=1 25 153 2.0E-33
sp|P16298|PP2BB_HUMAN Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform OS=Homo sapiens GN=PPP3CB PE=1 SV=2 25 153 2.0E-33
sp|P48453|PP2BB_MOUSE Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform OS=Mus musculus GN=Ppp3cb PE=1 SV=2 25 153 3.0E-33
sp|Q05681|PP2B_NEUCR Serine/threonine-protein phosphatase 2B catalytic subunit OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cna-1 PE=2 SV=2 31 153 3.0E-33
sp|P48457|PP2B_EMENI Serine/threonine-protein phosphatase 2B catalytic subunit OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cnaA PE=3 SV=3 31 153 5.0E-33
sp|P48454|PP2BC_HUMAN Serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform OS=Homo sapiens GN=PPP3CC PE=1 SV=3 32 153 2.0E-32
sp|P11612|PPY_DROME Serine/threonine-protein phosphatase PP-Y OS=Drosophila melanogaster GN=PpY-55A PE=2 SV=2 17 153 3.0E-32
sp|P48455|PP2BC_MOUSE Serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform OS=Mus musculus GN=Ppp3cc PE=1 SV=1 32 153 3.0E-32
sp|Q60EX6|BSL1_ORYSJ Serine/threonine-protein phosphatase BSL1 homolog OS=Oryza sativa subsp. japonica GN=BSL1 PE=2 SV=1 22 153 3.0E-31
sp|Q8L7U5|BSL1_ARATH Serine/threonine-protein phosphatase BSL1 OS=Arabidopsis thaliana GN=BSL1 PE=1 SV=2 22 153 9.0E-31
sp|P23287|PP2B1_YEAST Serine/threonine-protein phosphatase 2B catalytic subunit A1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CNA1 PE=1 SV=2 33 155 2.0E-30
sp|Q9LR78|BSU1_ARATH Serine/threonine-protein phosphatase BSU1 OS=Arabidopsis thaliana GN=BSU1 PE=1 SV=2 22 153 2.0E-29
sp|P23777|PP1_BRANA Serine/threonine-protein phosphatase PP1 (Fragment) OS=Brassica napus PE=2 SV=1 50 153 3.0E-29
sp|Q2QM47|BSL2_ORYSJ Serine/threonine-protein phosphatase BSL2 homolog OS=Oryza sativa subsp. japonica GN=BSL2 PE=2 SV=2 22 153 9.0E-29
sp|P48458|YT91_CAEEL Putative serine/threonine-protein phosphatase C06A1.3 OS=Caenorhabditis elegans GN=C06A1.3 PE=3 SV=1 9 139 2.0E-28
sp|Q9SHS7|BSL3_ARATH Serine/threonine-protein phosphatase BSL3 OS=Arabidopsis thaliana GN=BSL3 PE=1 SV=2 22 153 3.0E-28
sp|O74789|YOU5_SCHPO Putative serine/threonine-protein phosphatase C26H8.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC26H8.05c PE=1 SV=1 294 354 9.0E-28
sp|Q9SJF0|BSL2_ARATH Serine/threonine-protein phosphatase BSL2 OS=Arabidopsis thaliana GN=BSL2 PE=1 SV=2 22 153 9.0E-28
sp|P48459|YSD1_CAEEL Putative serine/threonine-protein phosphatase C23G10.1 OS=Caenorhabditis elegans GN=C23G10.1 PE=3 SV=2 5 155 9.0E-28
sp|Q9FN02|PPP7_ARATH Serine/threonine-protein phosphatase 7 OS=Arabidopsis thaliana GN=PP7 PE=1 SV=1 17 155 3.0E-26
sp|P32345|PP4C_YEAST Serine/threonine-protein phosphatase 4 catalytic subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPH3 PE=1 SV=2 295 354 5.0E-26
sp|P53043|PPT1_YEAST Serine/threonine-protein phosphatase T OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPT1 PE=1 SV=1 17 153 5.0E-26
sp|Q74ZR2|PP4C_ASHGO Serine/threonine-protein phosphatase 4 catalytic subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PPH3 PE=3 SV=2 295 354 6.0E-26
sp|P48460|YY06_CAEEL Putative serine/threonine-protein phosphatase C27B7.6 OS=Caenorhabditis elegans GN=C27B7.6 PE=3 SV=4 19 153 1.0E-25
sp|P48528|PPX2_ARATH Serine/threonine-protein phosphatase PP-X isozyme 2 OS=Arabidopsis thaliana GN=PPX2 PE=2 SV=2 298 354 8.0E-25
sp|P48529|PPX1_ARATH Serine/threonine-protein phosphatase PP-X isozyme 1 OS=Arabidopsis thaliana GN=PPX1 PE=2 SV=1 298 354 9.0E-25
sp|Q9Y0B7|PP4C_DICDI Serine/threonine-protein phosphatase 4 catalytic subunit OS=Dictyostelium discoideum GN=ppp4c PE=1 SV=1 294 354 1.0E-24
sp|Q6FM81|PP4C_CANGA Serine/threonine-protein phosphatase 4 catalytic subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PPH3 PE=3 SV=1 295 354 2.0E-24
sp|P53041|PPP5_HUMAN Serine/threonine-protein phosphatase 5 OS=Homo sapiens GN=PPP5C PE=1 SV=1 12 155 2.0E-24
sp|A0C1E4|PPX3_PARTE Serine/threonine-protein phosphatase PP-X homolog 3 OS=Paramecium tetraurelia GN=Ppx3 PE=3 SV=1 298 354 3.0E-24
sp|A0CCD2|PPX4_PARTE Serine/threonine-protein phosphatase PP-X homolog 4 OS=Paramecium tetraurelia GN=Ppx4 PE=3 SV=1 298 354 3.0E-24
sp|Q6P861|PP4C_XENTR Serine/threonine-protein phosphatase 4 catalytic subunit OS=Xenopus tropicalis GN=ppp4c PE=2 SV=1 295 354 3.0E-24
sp|Q6IP91|PP4C_XENLA Serine/threonine-protein phosphatase 4 catalytic subunit OS=Xenopus laevis GN=ppp4c PE=2 SV=1 295 354 3.0E-24
sp|Q5BJ92|PP4C_RAT Serine/threonine-protein phosphatase 4 catalytic subunit OS=Rattus norvegicus GN=Ppp4c PE=2 SV=1 295 354 3.0E-24
sp|Q5R6K8|PP4C_PONAB Serine/threonine-protein phosphatase 4 catalytic subunit OS=Pongo abelii GN=PPP4C PE=2 SV=1 295 354 3.0E-24
sp|P97470|PP4C_MOUSE Serine/threonine-protein phosphatase 4 catalytic subunit OS=Mus musculus GN=Ppp4c PE=1 SV=2 295 354 3.0E-24
sp|P60510|PP4C_HUMAN Serine/threonine-protein phosphatase 4 catalytic subunit OS=Homo sapiens GN=PPP4C PE=1 SV=1 295 354 3.0E-24
sp|A6H772|PP4C_BOVIN Serine/threonine-protein phosphatase 4 catalytic subunit OS=Bos taurus GN=PPP4C PE=1 SV=1 295 354 3.0E-24
sp|P11084|PP4C_RABIT Serine/threonine-protein phosphatase 4 catalytic subunit OS=Oryctolagus cuniculus GN=PPP4C PE=1 SV=2 295 354 3.0E-24
sp|A8WGP3|PP4CA_DANRE Serine/threonine-protein phosphatase 4 catalytic subunit A OS=Danio rerio GN=ppp4ca PE=2 SV=1 294 354 3.0E-24
sp|Q6CNT6|PP4C_KLULA Serine/threonine-protein phosphatase 4 catalytic subunit OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PPH3 PE=3 SV=1 294 354 3.0E-24
sp|Q60676|PPP5_MOUSE Serine/threonine-protein phosphatase 5 OS=Mus musculus GN=Ppp5c PE=1 SV=3 43 155 3.0E-24
sp|P53042|PPP5_RAT Serine/threonine-protein phosphatase 5 OS=Rattus norvegicus GN=Ppp5c PE=1 SV=1 43 155 3.0E-24
sp|A9JRC7|PP4CB_DANRE Serine/threonine-protein phosphatase 4 catalytic subunit B OS=Danio rerio GN=ppp4cb PE=2 SV=1 295 354 4.0E-24
sp|A0DJ90|PPX2_PARTE Serine/threonine-protein phosphatase PP-X homolog 2 OS=Paramecium tetraurelia GN=Ppx2 PE=3 SV=1 294 354 4.0E-24
sp|P48463|PP2AA_CHICK Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Gallus gallus GN=PPP2CA PE=2 SV=1 294 353 6.0E-24
sp|P11611|PP2AB_RABIT Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform OS=Oryctolagus cuniculus GN=PPP2CB PE=1 SV=1 294 353 6.0E-24
sp|P63331|PP2AA_RAT Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Rattus norvegicus GN=Ppp2ca PE=1 SV=1 294 353 6.0E-24
sp|P63330|PP2AA_MOUSE Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Mus musculus GN=Ppp2ca PE=1 SV=1 294 353 6.0E-24
sp|P67777|PP2AA_RABIT Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Oryctolagus cuniculus GN=PPP2CA PE=2 SV=1 294 353 6.0E-24
sp|P67776|PP2AA_PIG Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Sus scrofa GN=PPP2CA PE=2 SV=1 294 353 6.0E-24
sp|P67775|PP2AA_HUMAN Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Homo sapiens GN=PPP2CA PE=1 SV=1 294 353 6.0E-24
sp|P67774|PP2AA_BOVIN Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Bos taurus GN=PPP2CA PE=1 SV=1 294 353 6.0E-24
sp|P11493|PP2AB_PIG Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform (Fragment) OS=Sus scrofa GN=PPP2CB PE=2 SV=2 294 353 6.0E-24
sp|P62716|PP2AB_RAT Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform OS=Rattus norvegicus GN=Ppp2cb PE=2 SV=1 294 353 7.0E-24
sp|P62715|PP2AB_MOUSE Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform OS=Mus musculus GN=Ppp2cb PE=1 SV=1 294 353 7.0E-24
sp|P62714|PP2AB_HUMAN Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform OS=Homo sapiens GN=PPP2CB PE=1 SV=1 294 353 7.0E-24
sp|P49576|PPX1_PARTE Serine/threonine-protein phosphatase PP-X homolog 1 OS=Paramecium tetraurelia GN=Ppx1 PE=3 SV=2 294 354 8.0E-24
sp|Q0P594|PP2AB_BOVIN Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform OS=Bos taurus GN=PPP2CB PE=1 SV=1 294 353 8.0E-24
sp|P23696|PP2A_DROME Serine/threonine-protein phosphatase PP2A OS=Drosophila melanogaster GN=mts PE=2 SV=1 294 353 2.0E-23
sp|P23594|PP2A1_YEAST Serine/threonine-protein phosphatase PP2A-1 catalytic subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPH21 PE=1 SV=1 294 353 4.0E-23
sp|O14830|PPE2_HUMAN Serine/threonine-protein phosphatase with EF-hands 2 OS=Homo sapiens GN=PPEF2 PE=1 SV=2 5 255 4.0E-23
sp|A8XE00|PP4C1_CAEBR Serine/threonine-protein phosphatase 4 catalytic subunit 1 OS=Caenorhabditis briggsae GN=pph-4.1 PE=3 SV=1 295 354 7.0E-23
sp|P48580|PP2A1_NEUCR Serine/threonine-protein phosphatase PP2A catalytic subunit OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pph-1 PE=3 SV=3 298 353 7.0E-23
sp|P23595|PP2A2_YEAST Serine/threonine-protein phosphatase PP2A-2 catalytic subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPH22 PE=1 SV=1 294 353 7.0E-23
sp|O76932|PP4C_DROME Serine/threonine-protein phosphatase 4 catalytic subunit OS=Drosophila melanogaster GN=Pp4-19C PE=2 SV=1 295 354 8.0E-23
sp|Q9XW79|PP4C1_CAEEL Serine/threonine-protein phosphatase 4 catalytic subunit 1 OS=Caenorhabditis elegans GN=pph-4.1 PE=1 SV=1 295 354 9.0E-23
sp|O04860|PP2A5_TOBAC Serine/threonine-protein phosphatase PP2A-5 catalytic subunit OS=Nicotiana tabacum GN=NPP5 PE=2 SV=1 298 353 9.0E-23
sp|P23635|PP2A1_SCHPO Minor serine/threonine-protein phosphatase PP2A-1 catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppa1 PE=3 SV=1 298 353 9.0E-23
sp|Q9XGH7|PP2A_TOBAC Serine/threonine-protein phosphatase PP2A catalytic subunit OS=Nicotiana tabacum PE=2 SV=1 298 353 1.0E-22
sp|Q07098|PP2A2_ARATH Serine/threonine-protein phosphatase PP2A-2 catalytic subunit OS=Arabidopsis thaliana GN=PP2A2 PE=1 SV=1 298 353 1.0E-22
sp|Q0DBD3|PP2A1_ORYSJ Serine/threonine-protein phosphatase PP2A-1 catalytic subunit OS=Oryza sativa subsp. japonica GN=PP2A1 PE=2 SV=1 298 353 1.0E-22
sp|A2YEB4|PP2A1_ORYSI Serine/threonine-protein phosphatase PP2A-1 catalytic subunit OS=Oryza sativa subsp. indica GN=PP2A1 PE=2 SV=1 298 353 1.0E-22
sp|Q0E2S4|PP2A3_ORYSJ Serine/threonine-protein phosphatase PP2A-3 catalytic subunit OS=Oryza sativa subsp. japonica GN=PP2A3 PE=2 SV=1 298 353 1.0E-22
sp|A2X2G3|PP2A3_ORYSI Serine/threonine-protein phosphatase PP2A-3 catalytic subunit OS=Oryza sativa subsp. indica GN=PP2A3 PE=2 SV=2 298 353 1.0E-22
sp|Q07099|PP2A1_ARATH Serine/threonine-protein phosphatase PP2A-1 catalytic subunit OS=Arabidopsis thaliana GN=PP2A1 PE=1 SV=1 298 353 1.0E-22
sp|Q9HFQ2|PP2A1_EMENI Serine/threonine-protein phosphatase PP2A catalytic subunit OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pphA PE=3 SV=2 298 353 1.0E-22
sp|O04951|PP2A5_ARATH Serine/threonine-protein phosphatase PP2A-5 catalytic subunit OS=Arabidopsis thaliana GN=PP2A5 PE=1 SV=1 298 353 1.0E-22
sp|Q8SRZ0|PP1L_ENCCU Probable serine/threonine-protein phosphatase ECU05_0440 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU05_0440 PE=1 SV=1 1 153 1.0E-22
sp|Q9ZSE4|PP2A_HEVBR Serine/threonine-protein phosphatase PP2A catalytic subunit OS=Hevea brasiliensis GN=PP2A PE=2 SV=1 298 353 2.0E-22
sp|P48579|PP2A_HELAN Serine/threonine-protein phosphatase PP2A catalytic subunit OS=Helianthus annuus PE=2 SV=1 298 353 2.0E-22
sp|Q8X178|PP2A2_BLUGH Serine/threonine-protein phosphatase PP2A-2 catalytic subunit OS=Blumeria graminis f. sp. hordei GN=PP2A-2 PE=3 SV=1 298 353 2.0E-22
sp|P48577|PP2A_ACEPE Serine/threonine-protein phosphatase PP2A-1 catalytic subunit OS=Acetabularia peniculus PE=2 SV=1 291 353 2.0E-22
sp|Q59KY8|SIT4_CANAL Serine/threonine-protein phosphatase SIT4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SIT4 PE=1 SV=1 295 354 3.0E-22
sp|P0C5D7|PP2A4_ORYSI Putative serine/threonine-protein phosphatase PP2A-4 catalytic subunit OS=Oryza sativa subsp. indica GN=PP2A4 PE=3 SV=1 298 353 4.0E-22
sp|A3C4N5|PP2A4_ORYSJ Serine/threonine-protein phosphatase PP2A-4 catalytic subunit OS=Oryza sativa subsp. japonica GN=PP2A4 PE=2 SV=2 298 353 5.0E-22
sp|P23636|PP2A2_SCHPO Major serine/threonine-protein phosphatase PP2A-2 catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppa2 PE=3 SV=1 298 353 5.0E-22
sp|Q84XU2|PPP5_ARATH Serine/threonine-protein phosphatase 5 OS=Arabidopsis thaliana GN=PAPP5 PE=1 SV=1 21 155 5.0E-22
sp|O43049|PPT1_SCHPO Serine/threonine-protein phosphatase T OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppt1 PE=3 SV=2 12 192 5.0E-22
sp|Q07100|PP2A4_ARATH Serine/threonine-protein phosphatase PP2A-4 catalytic subunit OS=Arabidopsis thaliana GN=PP2A4 PE=2 SV=2 298 353 7.0E-22
sp|Q06009|PP2A_MEDSA Serine/threonine-protein phosphatase PP2A catalytic subunit OS=Medicago sativa GN=PP2A PE=2 SV=1 298 353 8.0E-22
sp|P48578|PP2A3_ARATH Serine/threonine-protein phosphatase PP2A-3 catalytic subunit OS=Arabidopsis thaliana GN=PP2A3 PE=2 SV=1 298 353 8.0E-22
sp|Q10BT5|PP2A2_ORYSJ Serine/threonine-protein phosphatase PP2A-2 catalytic subunit OS=Oryza sativa subsp. japonica GN=PP2A2 PE=2 SV=1 298 353 8.0E-22
sp|A2XN40|PP2A2_ORYSI Serine/threonine-protein phosphatase PP2A-2 catalytic subunit OS=Oryza sativa subsp. indica GN=PP2A2 PE=2 SV=2 298 353 8.0E-22
sp|Q9XTT8|PP4C2_CAEEL Serine/threonine-protein phosphatase 4 catalytic subunit 2 OS=Caenorhabditis elegans GN=pph-4.2 PE=2 SV=1 295 354 8.0E-22
sp|O35385|PPE2_MOUSE Serine/threonine-protein phosphatase with EF-hands 2 OS=Mus musculus GN=Ppef2 PE=2 SV=1 5 211 9.0E-22
sp|P36614|PPE1_SCHPO Serine/threonine-protein phosphatase ppe1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppe1 PE=1 SV=1 295 354 1.0E-21
sp|Q9LHE7|FYPP3_ARATH Phytochrome-associated serine/threonine-protein phosphatase 3 OS=Arabidopsis thaliana GN=FYPP3 PE=1 SV=1 295 354 1.0E-21
sp|Q8LSN3|FYPP_PEA Phytochrome-associated serine/threonine-protein phosphatase OS=Pisum sativum GN=FYPP PE=1 SV=1 295 354 1.0E-21
sp|Q9SX52|FYPP1_ARATH Phytochrome-associated serine/threonine-protein phosphatase 1 OS=Arabidopsis thaliana GN=FYPP1 PE=2 SV=1 295 354 1.0E-21
sp|O00743|PPP6_HUMAN Serine/threonine-protein phosphatase 6 catalytic subunit OS=Homo sapiens GN=PPP6C PE=1 SV=1 298 354 2.0E-21
sp|Q64620|PPP6_RAT Serine/threonine-protein phosphatase 6 catalytic subunit OS=Rattus norvegicus GN=Ppp6c PE=2 SV=2 298 354 2.0E-21
sp|Q9CQR6|PPP6_MOUSE Serine/threonine-protein phosphatase 6 catalytic subunit OS=Mus musculus GN=Ppp6c PE=1 SV=1 298 354 2.0E-21
sp|Q9XZE5|PP2AA_DICDI Serine/threonine-protein phosphatase 2A catalytic subunit A OS=Dictyostelium discoideum GN=pho2a PE=1 SV=1 298 353 3.0E-21
sp|Q9LNG5|PPP7L_ARATH Serine/threonine-protein phosphatase 7 long form homolog OS=Arabidopsis thaliana GN=At1g48120 PE=2 SV=1 17 206 6.0E-21
sp|P23778|PP2A_BRANA Serine/threonine-protein phosphatase PP2A catalytic subunit (Fragment) OS=Brassica napus PE=2 SV=2 298 353 8.0E-21
sp|P20604|PP11_YEAST Serine/threonine-protein phosphatase PP1-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIT4 PE=1 SV=1 295 354 2.0E-20
sp|Q9U9A3|PPP6_DICDI Serine/threonine-protein phosphatase 6 catalytic subunit OS=Dictyostelium discoideum GN=ppp6c PE=2 SV=2 295 354 3.0E-20
sp|Q84K11|PPP5_SOLLC Serine/threonine-protein phosphatase 5 OS=Solanum lycopersicum GN=PP5 PE=1 SV=1 21 153 3.0E-20
sp|Q27884|PPP6_DROME Serine/threonine-protein phosphatase 6 catalytic subunit OS=Drosophila melanogaster GN=PpV PE=2 SV=1 298 354 1.0E-19
sp|Q3SWT6|PPE1_RAT Serine/threonine-protein phosphatase with EF-hands 1 OS=Rattus norvegicus GN=Ppef1 PE=2 SV=1 1 153 4.0E-19
sp|O35655|PPE1_MOUSE Serine/threonine-protein phosphatase with EF-hands 1 OS=Mus musculus GN=Ppef1 PE=2 SV=2 17 153 6.0E-19
sp|Q6BFF6|PP2A3_PARTE Serine/threonine-protein phosphatase PP2A catalytic subunit 3 OS=Paramecium tetraurelia GN=Ppn3 PE=3 SV=1 298 353 1.0E-18
sp|A0CNL9|PP2A2_PARTE Serine/threonine-protein phosphatase PP2A catalytic subunit 2 OS=Paramecium tetraurelia GN=Ppn2 PE=3 SV=1 298 353 1.0E-18
sp|P48726|PP2A1_PARTE Serine/threonine-protein phosphatase PP2A catalytic subunit 1 OS=Paramecium tetraurelia GN=Ppn1 PE=3 SV=2 298 353 1.0E-18
sp|Q09496|PPH6_CAEEL Putative serine/threonine-protein phosphatase pph-6 OS=Caenorhabditis elegans GN=pph-6 PE=3 SV=2 297 354 3.0E-17
sp|O14829|PPE1_HUMAN Serine/threonine-protein phosphatase with EF-hands 1 OS=Homo sapiens GN=PPEF1 PE=1 SV=1 2 153 7.0E-17
sp|Q9LEV0|PPP7I_ARATH Serine/threonine-protein phosphatase 7 inactive homolog OS=Arabidopsis thaliana GN=At5g10900 PE=3 SV=1 17 153 3.0E-16
sp|Q10298|YD44_SCHPO Putative serine/threonine-protein phosphatase C22H10.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22H10.04 PE=3 SV=1 297 353 2.0E-15
sp|Q54RD6|PP2AB_DICDI Probable serine/threonine-protein phosphatase 2A catalytic subunit B OS=Dictyostelium discoideum GN=DDB_G0283187 PE=3 SV=1 297 353 3.0E-14
sp|P32838|PP2A4_YEAST Serine/threonine-protein phosphatase PP2A-like PPG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPG1 PE=1 SV=2 298 353 2.0E-13
sp|Q5A6B6|PPG1_CANAL Serine/threonine-protein phosphatase PP2A-like PPG1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PPG1 PE=1 SV=1 295 354 8.0E-13
sp|O04856|PP11_TOBAC Serine/threonine-protein phosphatase PP1 isozyme 1 OS=Nicotiana tabacum GN=NPP1 PE=2 SV=1 298 353 1.0E-12
sp|P48483|PP13_ARATH Serine/threonine-protein phosphatase PP1 isozyme 3 OS=Arabidopsis thaliana GN=TOPP3 PE=2 SV=1 298 353 2.0E-12
sp|P48484|PP14_ARATH Serine/threonine-protein phosphatase PP1 isozyme 4 OS=Arabidopsis thaliana GN=TOPP4 PE=1 SV=1 298 353 3.0E-12
sp|P48488|PP1_MEDSV Serine/threonine-protein phosphatase PP1 OS=Medicago sativa subsp. varia GN=PP1 PE=2 SV=1 298 353 3.0E-12
sp|P48480|PP11_ACEPE Serine/threonine-protein phosphatase PP1 isozyme 1 OS=Acetabularia peniculus PE=3 SV=1 298 353 6.0E-12
sp|P48485|PP15_ARATH Serine/threonine-protein phosphatase PP1 isozyme 5 OS=Arabidopsis thaliana GN=TOPP5 PE=1 SV=1 298 353 7.0E-12
sp|P48481|PP12_ACEPE Serine/threonine-protein phosphatase PP1 isozyme 2 OS=Acetabularia peniculus PE=3 SV=1 298 353 8.0E-12
sp|P23777|PP1_BRANA Serine/threonine-protein phosphatase PP1 (Fragment) OS=Brassica napus PE=2 SV=1 298 350 8.0E-12
sp|P48482|PP12_ARATH Serine/threonine-protein phosphatase PP1 isozyme 2 OS=Arabidopsis thaliana GN=TOPP2 PE=1 SV=1 298 353 9.0E-12
sp|P30366|PP11_ARATH Serine/threonine-protein phosphatase PP1 isozyme 1 OS=Arabidopsis thaliana GN=TOPP1 PE=2 SV=1 298 353 1.0E-11
sp|P48489|PP1_ORYSJ Serine/threonine-protein phosphatase PP1 OS=Oryza sativa subsp. japonica GN=Os03g0268000 PE=2 SV=2 298 353 1.0E-11
sp|O04857|PP12_TOBAC Serine/threonine-protein phosphatase PP1 isozyme 2 OS=Nicotiana tabacum GN=NPP2 PE=2 SV=1 298 353 1.0E-11
sp|P48490|PP1_PHAVU Serine/threonine-protein phosphatase PP1 OS=Phaseolus vulgaris PE=2 SV=1 298 351 1.0E-11
sp|P48486|PP16_ARATH Serine/threonine-protein phosphatase PP1 isozyme 6 OS=Arabidopsis thaliana GN=TOPP6 PE=1 SV=2 298 353 1.0E-11
sp|P62137|PP1A_MOUSE Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Mus musculus GN=Ppp1ca PE=1 SV=1 298 353 2.0E-11
sp|Q8WMS6|PP1A_CANLF Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Canis lupus familiaris GN=PPP1CA PE=2 SV=1 298 353 2.0E-11
sp|Q627N3|GLC7B_CAEBR Serine/threonine-protein phosphatase PP1-beta OS=Caenorhabditis briggsae GN=gsp-2 PE=3 SV=1 298 353 2.0E-11
sp|P48727|GLC7B_CAEEL Serine/threonine-protein phosphatase PP1-beta OS=Caenorhabditis elegans GN=gsp-2 PE=2 SV=1 298 353 2.0E-11
sp|Q8MJ46|PP1G_CANLF Serine/threonine-protein phosphatase PP1-gamma catalytic subunit OS=Canis lupus familiaris GN=PPP1CC PE=2 SV=1 298 353 2.0E-11
sp|P62138|PP1A_RAT Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Rattus norvegicus GN=Ppp1ca PE=1 SV=1 298 353 2.0E-11
sp|P62139|PP1A_RABIT Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Oryctolagus cuniculus GN=PPP1CA PE=1 SV=1 298 353 2.0E-11
sp|P62136|PP1A_HUMAN Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Homo sapiens GN=PPP1CA PE=1 SV=1 298 353 2.0E-11
sp|Q3T0E7|PP1A_BOVIN Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Bos taurus GN=PPP1CA PE=2 SV=1 298 353 2.0E-11
sp|P40421|RDGC_DROME Serine/threonine-protein phosphatase rdgC OS=Drosophila melanogaster GN=rdgC PE=2 SV=1 40 153 2.0E-11
sp|Q5I085|PP1B_XENTR Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Xenopus tropicalis GN=ppp1cb PE=2 SV=1 298 353 3.0E-11
sp|Q6GQL2|PP1B_XENLA Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Xenopus laevis GN=ppp1cb PE=2 SV=1 298 353 3.0E-11
sp|P48462|PP1B_DROME Serine/threonine-protein phosphatase beta isoform OS=Drosophila melanogaster GN=flw PE=1 SV=1 298 353 3.0E-11
sp|P62142|PP1B_RAT Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Rattus norvegicus GN=Ppp1cb PE=1 SV=3 298 353 3.0E-11
sp|P62143|PP1B_RABIT Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Oryctolagus cuniculus GN=PPP1CB PE=1 SV=3 298 353 3.0E-11
sp|Q5R740|PP1B_PONAB Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Pongo abelii GN=PPP1CB PE=2 SV=1 298 353 3.0E-11
sp|P61292|PP1B_PIG Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Sus scrofa GN=PPP1CB PE=1 SV=3 298 353 3.0E-11
sp|P62141|PP1B_MOUSE Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Mus musculus GN=Ppp1cb PE=1 SV=3 298 353 3.0E-11
sp|P62140|PP1B_HUMAN Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Homo sapiens GN=PPP1CB PE=1 SV=3 298 353 3.0E-11
sp|P62207|PP1B_CHICK Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Gallus gallus GN=PPP1CB PE=1 SV=3 298 353 3.0E-11
sp|Q8MJ47|PP1B_CANLF Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Canis lupus familiaris GN=PPP1CB PE=2 SV=4 298 353 3.0E-11
sp|Q3SWW9|PP1B_BOVIN Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Bos taurus GN=PPP1CB PE=2 SV=1 298 353 3.0E-11
sp|P36873|PP1G_HUMAN Serine/threonine-protein phosphatase PP1-gamma catalytic subunit OS=Homo sapiens GN=PPP1CC PE=1 SV=1 298 353 3.0E-11
sp|O82734|PP18_ARATH Serine/threonine-protein phosphatase PP1 isozyme 8 OS=Arabidopsis thaliana GN=TOPP8 PE=2 SV=3 298 350 3.0E-11
sp|P63088|PP1G_RAT Serine/threonine-protein phosphatase PP1-gamma catalytic subunit OS=Rattus norvegicus GN=Ppp1cc PE=1 SV=1 298 353 3.0E-11
sp|P63087|PP1G_MOUSE Serine/threonine-protein phosphatase PP1-gamma catalytic subunit OS=Mus musculus GN=Ppp1cc PE=1 SV=1 298 353 3.0E-11
sp|P61287|PP1G_BOVIN Serine/threonine-protein phosphatase PP1-gamma catalytic subunit OS=Bos taurus GN=PPP1CC PE=2 SV=1 298 353 3.0E-11
sp|Q6NVU2|PPIG_XENTR Serine/threonine-protein phosphatase PP1-gamma catalytic subunit OS=Xenopus tropicalis GN=ppp1cc PE=2 SV=1 298 353 3.0E-11
sp|P36874|PP1GA_XENLA Serine/threonine-protein phosphatase PP1-gamma catalytic subunit A OS=Xenopus laevis GN=ppp1cc-a PE=1 SV=2 298 353 3.0E-11
sp|Q7SZ10|PP1GB_XENLA Serine/threonine-protein phosphatase PP1-gamma catalytic subunit B OS=Xenopus laevis GN=ppp1cc-b PE=2 SV=1 298 353 3.0E-11
sp|P48487|PP1_BRAOL Serine/threonine-protein phosphatase PP1 OS=Brassica oleracea GN=PP1 PE=2 SV=1 298 353 3.0E-11
sp|Q05547|PP13_DROME Serine/threonine-protein phosphatase alpha-3 isoform OS=Drosophila melanogaster GN=Pp1-13C PE=1 SV=1 291 353 4.0E-11
sp|P48461|PP11_DROME Serine/threonine-protein phosphatase alpha-1 isoform OS=Drosophila melanogaster GN=Pp1alpha-96A PE=1 SV=1 298 353 5.0E-11
sp|Q27497|GLC7A_CAEEL Serine/threonine-protein phosphatase PP1-alpha OS=Caenorhabditis elegans GN=gsp-1 PE=3 SV=2 298 353 6.0E-11
sp|Q61JR3|GLC7A_CAEBR Serine/threonine-protein phosphatase PP1-alpha OS=Caenorhabditis briggsae GN=gsp-1 PE=3 SV=1 298 353 6.0E-11
sp|P12982|PP12_DROME Serine/threonine-protein phosphatase alpha-2 isoform OS=Drosophila melanogaster GN=Pp1-87B PE=1 SV=1 298 353 7.0E-11
sp|P32598|PP12_YEAST Serine/threonine-protein phosphatase PP1-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GLC7 PE=1 SV=1 298 353 9.0E-11
sp|Q7YSW8|PP2BA_DICDI Calcineurin subunit A OS=Dictyostelium discoideum GN=canA PE=1 SV=1 295 338 1.0E-10
sp|P22198|PP1_MAIZE Serine/threonine-protein phosphatase PP1 OS=Zea mays GN=PP1 PE=2 SV=1 298 353 2.0E-10
sp|P23880|PP12_SCHPO Serine/threonine-protein phosphatase PP1-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sds21 PE=3 SV=1 298 353 2.0E-10
sp|P63329|PP2BA_RAT Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform OS=Rattus norvegicus GN=Ppp3ca PE=1 SV=1 295 338 2.0E-10
sp|P63328|PP2BA_MOUSE Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform OS=Mus musculus GN=Ppp3ca PE=1 SV=1 295 338 2.0E-10
sp|Q08209|PP2BA_HUMAN Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform OS=Homo sapiens GN=PPP3CA PE=1 SV=1 295 338 2.0E-10
sp|P48452|PP2BA_BOVIN Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform OS=Bos taurus GN=PPP3CA PE=1 SV=1 295 338 2.0E-10
sp|P13681|PP11_SCHPO Serine/threonine-protein phosphatase PP1-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dis2 PE=1 SV=1 298 353 3.0E-10
sp|O82733|PP17_ARATH Serine/threonine-protein phosphatase PP1 isozyme 7 OS=Arabidopsis thaliana GN=TOPP7 PE=2 SV=3 298 353 3.0E-10
sp|P20651|PP2BB_RAT Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform OS=Rattus norvegicus GN=Ppp3cb PE=1 SV=1 295 340 3.0E-10
sp|P16298|PP2BB_HUMAN Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform OS=Homo sapiens GN=PPP3CB PE=1 SV=2 295 340 3.0E-10
sp|P48453|PP2BB_MOUSE Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform OS=Mus musculus GN=Ppp3cb PE=1 SV=2 295 340 3.0E-10
sp|P33329|PPZ2_YEAST Serine/threonine-protein phosphatase PP-Z2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPZ2 PE=1 SV=4 296 353 7.0E-10
sp|Q9UW86|PP1_NEUCR Serine/threonine-protein phosphatase PP1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pph-3 PE=2 SV=1 298 353 1.0E-09
sp|P20654|PP1_EMENI Serine/threonine-protein phosphatase PP1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bimG PE=2 SV=1 298 353 1.0E-09
sp|Q9M9W3|PP19_ARATH Serine/threonine-protein phosphatase PP1 isozyme 9 OS=Arabidopsis thaliana GN=TOPP9 PE=2 SV=1 298 350 2.0E-09
sp|O15757|PP1_DICDI Serine/threonine-protein phosphatase PP1 OS=Dictyostelium discoideum GN=pppB PE=1 SV=1 298 353 2.0E-09
sp|P26570|PPZ1_YEAST Serine/threonine-protein phosphatase PP-Z1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPZ1 PE=1 SV=5 296 353 2.0E-09
sp|O04858|PP13_TOBAC Serine/threonine-protein phosphatase PP1 isozyme 3 OS=Nicotiana tabacum GN=NPP3 PE=2 SV=1 298 353 2.0E-09
sp|P48456|PP2B1_DROME Serine/threonine-protein phosphatase 2B catalytic subunit 1 OS=Drosophila melanogaster GN=CanA1 PE=2 SV=2 295 338 3.0E-09
sp|Q05681|PP2B_NEUCR Serine/threonine-protein phosphatase 2B catalytic subunit OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cna-1 PE=2 SV=2 295 338 3.0E-09
sp|Q12705|PP2B_SCHPO Serine/threonine-protein phosphatase 2B catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppb1 PE=3 SV=2 295 338 4.0E-09
sp|P78968|PPZ_SCHPO Serine/threonine-protein phosphatase PP-Z OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pzh1 PE=1 SV=1 296 354 6.0E-09
sp|P14747|PP2B2_YEAST Serine/threonine-protein phosphatase 2B catalytic subunit A2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMP2 PE=1 SV=2 295 338 6.0E-09
sp|Q27889|PP2B2_DROME Serine/threonine-protein phosphatase 2B catalytic subunit 2 OS=Drosophila melanogaster GN=Pp2B-14D PE=1 SV=2 295 338 7.0E-09
sp|Q9VXF1|PP2B3_DROME Serine/threonine-protein phosphatase 2B catalytic subunit 3 OS=Drosophila melanogaster GN=CanA-14F PE=1 SV=4 295 338 7.0E-09
sp|P48454|PP2BC_HUMAN Serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform OS=Homo sapiens GN=PPP3CC PE=1 SV=3 295 340 7.0E-09
sp|P23734|PP12_TRYBB Serine/threonine-protein phosphatase PP1(5.9) OS=Trypanosoma brucei brucei PE=3 SV=2 292 353 1.0E-08
sp|P23733|PP11_TRYBB Serine/threonine-protein phosphatase PP1(4.8) OS=Trypanosoma brucei brucei PE=3 SV=2 292 353 1.0E-08
sp|P23287|PP2B1_YEAST Serine/threonine-protein phosphatase 2B catalytic subunit A1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CNA1 PE=1 SV=2 295 338 1.0E-08
sp|O42773|PP2B1_CRYNH Serine/threonine-protein phosphatase 2B catalytic subunit A1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CNA1 PE=3 SV=1 295 359 2.0E-08
sp|Q4WUR1|PP2B_ASPFU Serine/threonine-protein phosphatase 2B catalytic subunit OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cnaA PE=3 SV=2 295 338 2.0E-08
sp|P48457|PP2B_EMENI Serine/threonine-protein phosphatase 2B catalytic subunit OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cnaA PE=3 SV=3 295 359 2.0E-08
sp|P11612|PPY_DROME Serine/threonine-protein phosphatase PP-Y OS=Drosophila melanogaster GN=PpY-55A PE=2 SV=2 298 353 2.0E-08
sp|Q84XU2|PPP5_ARATH Serine/threonine-protein phosphatase 5 OS=Arabidopsis thaliana GN=PAPP5 PE=1 SV=1 295 352 3.0E-08
sp|P48455|PP2BC_MOUSE Serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform OS=Mus musculus GN=Ppp3cc PE=1 SV=1 295 338 7.0E-08
sp|P34430|YL39_CAEEL Uncharacterized protein F44B9.9 OS=Caenorhabditis elegans GN=F44B9.9 PE=4 SV=2 31 101 9.0E-08
sp|P48459|YSD1_CAEEL Putative serine/threonine-protein phosphatase C23G10.1 OS=Caenorhabditis elegans GN=C23G10.1 PE=3 SV=2 291 352 2.0E-07
sp|P53041|PPP5_HUMAN Serine/threonine-protein phosphatase 5 OS=Homo sapiens GN=PPP5C PE=1 SV=1 295 351 2.0E-07
sp|Q60676|PPP5_MOUSE Serine/threonine-protein phosphatase 5 OS=Mus musculus GN=Ppp5c PE=1 SV=3 295 351 2.0E-07
sp|P53042|PPP5_RAT Serine/threonine-protein phosphatase 5 OS=Rattus norvegicus GN=Ppp5c PE=1 SV=1 295 351 2.0E-07
sp|P34350|YK84_CAEEL Uncharacterized protein C30A5.4 OS=Caenorhabditis elegans GN=C30A5.4 PE=4 SV=1 298 353 3.0E-07
sp|P48458|YT91_CAEEL Putative serine/threonine-protein phosphatase C06A1.3 OS=Caenorhabditis elegans GN=C06A1.3 PE=3 SV=1 298 354 1.0E-06
sp|P32945|PPQ1_YEAST Serine/threonine-protein phosphatase PPQ OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPQ1 PE=1 SV=1 298 353 2.0E-06
sp|Q84K11|PPP5_SOLLC Serine/threonine-protein phosphatase 5 OS=Solanum lycopersicum GN=PP5 PE=1 SV=1 295 352 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3909
MSDLDQAIAQLRACRPIPEAHVRELCHKARELLIEEGNVVTVTAPVTICGDIHGQFHDLMELFRVGGDVPDTNYL
FMGDFVDRGFYSLESFLLLLCLKVRYPDRMTLIRGNHESRQITTVYGFYDECLRKYGSANVWRYCCDVFDYLALG
AIVLGASNRLSGCDAMDDETEIEVCDQNGAIMSRFSRQQRDQYQQQQQQQQQQQQQQQQQQQRKQRLQQRIQQRR
RRRQEVLQGAAGDEEDLEQTARREAEAELEPDADADAEPQPQSPNGMTDRTGPPGSSASGESSGSVGNANGAVLC
VHGGLSPLIDTVDKIRLLDRKQEVPHEGAMCDLLWSDPDDIDGWGLSPRGAGFLKCLMRPL*
Coding >OphauB2|3909
ATGAGCGATCTCGACCAGGCCATTGCGCAGCTGCGGGCCTGCCGTCCCATTCCCGAGGCCCATGTTCGAGAACTC
TGCCACAAGGCTCGCGAGCTTCTCATTGAGGAGGGCAATGTTGTCACGGTGACGGCGCCCGTCACGATATGTGGC
GATATCCACGGCCAGTTCCACGACCTCATGGAACTCTTTAGAGTGGGTGGCGACGTGCCCGACACAAATTACCTC
TTTATGGGCGACTTTGTCGACCGCGGCTTCTACTCGCTCGAGTCCTTTCTCCTGCTCCTCTGCCTCAAGGTGCGA
TACCCCGACCGCATGACGCTGATTCGCGGCAATCACGAGTCGCGGCAAATCACAACCGTCTACGGCTTCTACGAC
GAGTGTCTTCGCAAGTATGGCAGTGCCAATGTGTGGCGGTACTGCTGCGACGTCTTTGACTACCTTGCCCTGGGC
GCCATTGTGCTGGGCGCGTCGAACCGGCTGTCGGGCTGCGACGCCATGGACGACGAGACTGAGATTGAGGTGTGC
GACCAAAACGGCGCCATTATGAGCCGCTTTTCTCGGCAACAGCGCGACCAATACCAGCAGCAGCAACAGCAGCAG
CAGCAACAACAACAACAACAGCAGCAGCAGCAACAGCGCAAGCAAAGGCTACAGCAGCGCATACAGCAGCGAAGA
CGGCGGCGGCAAGAAGTACTTCAGGGAGCAGCGGGCGACGAAGAAGACTTGGAGCAAACAGCAAGACGCGAGGCA
GAGGCAGAGCTGGAGCCCGACGCCGACGCCGACGCGGAGCCGCAACCCCAAAGCCCCAACGGCATGACTGACCGC
ACAGGCCCGCCCGGCTCGTCTGCGTCTGGCGAGAGCAGCGGCAGCGTGGGCAACGCCAATGGCGCGGTGCTGTGC
GTGCACGGCGGGCTCAGCCCCCTGATTGACACGGTGGACAAGATTCGGCTACTGGACCGCAAGCAAGAAGTGCCA
CACGAGGGCGCCATGTGCGACCTGCTATGGTCCGACCCCGACGACATTGACGGCTGGGGCCTCTCGCCGCGCGGC
GCCGGCTTCTTGAAATGTTTAATGCGTCCATTGTAA
Transcript >OphauB2|3909
ATGAGCGATCTCGACCAGGCCATTGCGCAGCTGCGGGCCTGCCGTCCCATTCCCGAGGCCCATGTTCGAGAACTC
TGCCACAAGGCTCGCGAGCTTCTCATTGAGGAGGGCAATGTTGTCACGGTGACGGCGCCCGTCACGATATGTGGC
GATATCCACGGCCAGTTCCACGACCTCATGGAACTCTTTAGAGTGGGTGGCGACGTGCCCGACACAAATTACCTC
TTTATGGGCGACTTTGTCGACCGCGGCTTCTACTCGCTCGAGTCCTTTCTCCTGCTCCTCTGCCTCAAGGTGCGA
TACCCCGACCGCATGACGCTGATTCGCGGCAATCACGAGTCGCGGCAAATCACAACCGTCTACGGCTTCTACGAC
GAGTGTCTTCGCAAGTATGGCAGTGCCAATGTGTGGCGGTACTGCTGCGACGTCTTTGACTACCTTGCCCTGGGC
GCCATTGTGCTGGGCGCGTCGAACCGGCTGTCGGGCTGCGACGCCATGGACGACGAGACTGAGATTGAGGTGTGC
GACCAAAACGGCGCCATTATGAGCCGCTTTTCTCGGCAACAGCGCGACCAATACCAGCAGCAGCAACAGCAGCAG
CAGCAACAACAACAACAACAGCAGCAGCAGCAACAGCGCAAGCAAAGGCTACAGCAGCGCATACAGCAGCGAAGA
CGGCGGCGGCAAGAAGTACTTCAGGGAGCAGCGGGCGACGAAGAAGACTTGGAGCAAACAGCAAGACGCGAGGCA
GAGGCAGAGCTGGAGCCCGACGCCGACGCCGACGCGGAGCCGCAACCCCAAAGCCCCAACGGCATGACTGACCGC
ACAGGCCCGCCCGGCTCGTCTGCGTCTGGCGAGAGCAGCGGCAGCGTGGGCAACGCCAATGGCGCGGTGCTGTGC
GTGCACGGCGGGCTCAGCCCCCTGATTGACACGGTGGACAAGATTCGGCTACTGGACCGCAAGCAAGAAGTGCCA
CACGAGGGCGCCATGTGCGACCTGCTATGGTCCGACCCCGACGACATTGACGGCTGGGGCCTCTCGCCGCGCGGC
GCCGGCTTCTTGAAATGTTTAATGCGTCCATTGTAA
Gene >OphauB2|3909
ATGAGCGATCTCGACCAGTAAGTCGGCCGTCTCTGTCGCCGTGGCTGTGGGCTGACGCTTGCTGTGCCGCTCAGG
GCCATTGCGCAGCTGCGGGCCTGCCGTCCCATTCCCGAGGCCCATGTTCGAGAACTCTGCCACAAGGCTCGCGAG
CTTCTCATTGAGGAGGGCAATGTTGTCACGGTGACGGCGCCCGTCACGGTGTGTTTCTCTTTTTTTTTTTTTCTA
TTTTTGGGTTTGATTTTTAAGTTTTTTTTTTCTTGTAGCGTCGTGGCGGCTGGCGCGCTGACCAAGCAGTCAGAT
ATGTGGCGATATCCACGGCCAGTTCCACGACCTCATGGAACTCTTTAGAGTGGGTGGCGACGTGCCCGACACAAA
TTACCTCTTTATGGGTAGGGTTACCTCGCAAGCCCCCAGTCTGTGAGCGCTCCCAGGACTAATCATGGTTGGGCT
GCGCTAGGCGACTTTGTCGACCGCGGCTTCTACTCGCTCGAGTCCTTTCTCCTGCTCCTCTGCCTCAAGGTGCGA
TACCCCGACCGCATGACGCTGATTCGCGGCAATCACGAGTCGCGGCAAATCACAACCGTCTACGGCTTCTACGAC
GAGTGTCTTCGCAAGTATGGCAGTGCCAATGTGTGGCGGTACTGCTGCGACGTCTTTGACTACCTTGCCCTGGGC
GCCATTGTGCTGGGCGCGTCGAACCGGCTGTCGGGCTGCGACGCCATGGACGACGAGACTGAGATTGAGGTGTGC
GACCAAAACGGCGCCATTATGAGCCGCTTTTCTCGGCAACAGCGCGACCAATACCAGCAGCAGCAACAGCAGCAG
CAGCAACAACAACAACAACAGCAGCAGCAGCAACAGCGCAAGCAAAGGCTACAGCAGCGCATACAGCAGCGAAGA
CGGCGGCGGCAAGAAGTACTTCAGGGAGCAGCGGGCGACGAAGAAGACTTGGAGCAAACAGCAAGACGCGAGGCA
GAGGCAGAGCTGGAGCCCGACGCCGACGCCGACGCGGAGCCGCAACCCCAAAGCCCCAACGGCATGACTGACCGC
ACAGGCCCGCCCGGCTCGTCTGCGTCTGGCGAGAGCAGCGGCAGCGTGGGCAACGCCAATGGCGCGGTGCTGTGC
GTGCACGGCGGGCTCAGCCCCCTGATTGACACGGTGGACAAGATTCGGCTACTGGACCGCAAGCAAGAAGTGCCA
CACGAGGGCGCCATGTGCGACCTGCTATGGTCCGACCCCGACGACATTGACGGCTGGGGCCTCTCGCCGCGCGGC
GCCGGCTTCTTGTTTGGCGCCGACATTGTCAAAGTCTTTAGCCACCGCAACGACTTGAGCCTCATTGCCCGCGCC
CACCAGCTCGTCATGGAGGGCTTCAAGGAAATGTTTAATGCGTCCATTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail