Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3897
Gene name
LocationContig_25:102102..107629
Strand+
Gene length (bp)5527
Transcript length (bp)5391
Coding sequence length (bp)5391
Protein length (aa) 1797

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02889 Sec63 Sec63 Brl domain 5.4E-80 796 1099
PF02889 Sec63 Sec63 Brl domain 1.7E-23 1637 1795
PF00270 DEAD DEAD/DEAH box helicase 2.4E-26 285 471
PF00270 DEAD DEAD/DEAH box helicase 4.0E-22 1145 1309
PF04851 ResIII Type III restriction enzyme, res subunit 1.1E-08 288 468
PF04851 ResIII Type III restriction enzyme, res subunit 1.2E-09 1156 1294
PF00271 Helicase_C Helicase conserved C-terminal domain 1.6E-06 1422 1508

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O60072|MUG81_SCHPO Putative helicase mug81 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug81 PE=1 SV=1 99 1795 0.0E+00
sp|P53327|SLH1_YEAST Antiviral helicase SLH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLH1 PE=1 SV=2 134 1795 0.0E+00
sp|E9PZJ8|ASCC3_MOUSE Activating signal cointegrator 1 complex subunit 3 OS=Mus musculus GN=Ascc3 PE=1 SV=1 209 1795 0.0E+00
sp|Q8N3C0|ASCC3_HUMAN Activating signal cointegrator 1 complex subunit 3 OS=Homo sapiens GN=ASCC3 PE=1 SV=3 153 1795 0.0E+00
sp|E1BNG3|ASCC3_BOVIN Activating signal cointegrator 1 complex subunit 3 OS=Bos taurus GN=ascc3 PE=3 SV=1 153 1795 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O60072|MUG81_SCHPO Putative helicase mug81 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug81 PE=1 SV=1 99 1795 0.0E+00
sp|P53327|SLH1_YEAST Antiviral helicase SLH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLH1 PE=1 SV=2 134 1795 0.0E+00
sp|E9PZJ8|ASCC3_MOUSE Activating signal cointegrator 1 complex subunit 3 OS=Mus musculus GN=Ascc3 PE=1 SV=1 209 1795 0.0E+00
sp|Q8N3C0|ASCC3_HUMAN Activating signal cointegrator 1 complex subunit 3 OS=Homo sapiens GN=ASCC3 PE=1 SV=3 153 1795 0.0E+00
sp|E1BNG3|ASCC3_BOVIN Activating signal cointegrator 1 complex subunit 3 OS=Bos taurus GN=ascc3 PE=3 SV=1 153 1795 0.0E+00
sp|F1NTD6|ASCC3_CHICK Activating signal cointegrator 1 complex subunit 3 OS=Gallus gallus GN=ascc3 PE=3 SV=2 209 1795 0.0E+00
sp|F1LPQ2|ASCC3_RAT Activating signal cointegrator 1 complex subunit 3 OS=Rattus norvegicus GN=Ascc3 PE=3 SV=1 209 1795 0.0E+00
sp|Q9FNQ1|DEXHE_ARATH DExH-box ATP-dependent RNA helicase DExH14 OS=Arabidopsis thaliana GN=At5g61140 PE=2 SV=1 69 1795 0.0E+00
sp|E7F8F4|ASCC3_DANRE Activating signal cointegrator 1 complex subunit 3 OS=Danio rerio GN=ascc3 PE=3 SV=2 232 1661 0.0E+00
sp|Q54G57|HELC1_DICDI Activating signal cointegrator 1 complex subunit 3 OS=Dictyostelium discoideum GN=ascc3 PE=3 SV=1 78 1795 0.0E+00
sp|O75643|U520_HUMAN U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens GN=SNRNP200 PE=1 SV=2 121 1796 0.0E+00
sp|Q6P4T2|U520_MOUSE U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Mus musculus GN=Snrnp200 PE=1 SV=1 121 1796 0.0E+00
sp|F1LNJ2|U520_RAT U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Rattus norvegicus GN=Snrnp200 PE=1 SV=1 121 1796 0.0E+00
sp|Q9VUV9|U520_DROME Putative U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Drosophila melanogaster GN=l(3)72Ab PE=2 SV=4 99 1796 0.0E+00
sp|Q9SYP1|DEXHC_ARATH DExH-box ATP-dependent RNA helicase DExH12 OS=Arabidopsis thaliana GN=EMB1507 PE=2 SV=1 216 1796 0.0E+00
sp|O48534|DEXHD_ARATH DExH-box ATP-dependent RNA helicase DExH13 OS=Arabidopsis thaliana GN=At2g42270 PE=2 SV=1 216 1796 0.0E+00
sp|Q9U2G0|U520_CAEEL Putative U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Caenorhabditis elegans GN=Y46G5A.4 PE=3 SV=1 53 1796 0.0E+00
sp|Q55CI8|HELCL_DICDI Activating signal cointegrator 1 complex subunit 3-like OS=Dictyostelium discoideum GN=ascc3l PE=3 SV=1 216 1796 0.0E+00
sp|Q9UT24|BRR2_SCHPO Pre-mRNA-splicing factor brr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=brr2 PE=1 SV=1 216 1796 0.0E+00
sp|P32639|BRR2_YEAST Pre-mRNA-splicing helicase BRR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BRR2 PE=1 SV=2 135 1796 0.0E+00
sp|Q8N3C0|ASCC3_HUMAN Activating signal cointegrator 1 complex subunit 3 OS=Homo sapiens GN=ASCC3 PE=1 SV=3 279 1001 4.0E-100
sp|E9PZJ8|ASCC3_MOUSE Activating signal cointegrator 1 complex subunit 3 OS=Mus musculus GN=Ascc3 PE=1 SV=1 279 971 1.0E-97
sp|F1NTD6|ASCC3_CHICK Activating signal cointegrator 1 complex subunit 3 OS=Gallus gallus GN=ascc3 PE=3 SV=2 280 938 2.0E-97
sp|E1BNG3|ASCC3_BOVIN Activating signal cointegrator 1 complex subunit 3 OS=Bos taurus GN=ascc3 PE=3 SV=1 279 938 3.0E-96
sp|F1LPQ2|ASCC3_RAT Activating signal cointegrator 1 complex subunit 3 OS=Rattus norvegicus GN=Ascc3 PE=3 SV=1 279 971 1.0E-93
sp|Q9FNQ1|DEXHE_ARATH DExH-box ATP-dependent RNA helicase DExH14 OS=Arabidopsis thaliana GN=At5g61140 PE=2 SV=1 280 938 3.0E-91
sp|D3Z4R1|HFM1_MOUSE Probable ATP-dependent DNA helicase HFM1 OS=Mus musculus GN=Hfm1 PE=3 SV=2 1085 1658 3.0E-89
sp|A2RUV5|HFM1_XENTR Probable ATP-dependent DNA helicase HFM1 OS=Xenopus tropicalis GN=hfm1 PE=2 SV=1 274 1002 6.0E-88
sp|A2PYH4|HFM1_HUMAN Probable ATP-dependent DNA helicase HFM1 OS=Homo sapiens GN=HFM1 PE=1 SV=2 203 1004 1.0E-87
sp|E7F8F4|ASCC3_DANRE Activating signal cointegrator 1 complex subunit 3 OS=Danio rerio GN=ascc3 PE=3 SV=2 280 834 6.0E-86
sp|Q54G57|HELC1_DICDI Activating signal cointegrator 1 complex subunit 3 OS=Dictyostelium discoideum GN=ascc3 PE=3 SV=1 280 944 2.0E-85
sp|E7F8F4|ASCC3_DANRE Activating signal cointegrator 1 complex subunit 3 OS=Danio rerio GN=ascc3 PE=3 SV=2 1105 1698 2.0E-84
sp|A2RUV5|HFM1_XENTR Probable ATP-dependent DNA helicase HFM1 OS=Xenopus tropicalis GN=hfm1 PE=2 SV=1 1140 1700 2.0E-84
sp|D3Z4R1|HFM1_MOUSE Probable ATP-dependent DNA helicase HFM1 OS=Mus musculus GN=Hfm1 PE=3 SV=2 217 1012 6.0E-84
sp|A2PYH4|HFM1_HUMAN Probable ATP-dependent DNA helicase HFM1 OS=Homo sapiens GN=HFM1 PE=1 SV=2 1098 1698 6.0E-83
sp|Q5D892|MER3_ARATH DExH-box ATP-dependent RNA helicase DExH17 OS=Arabidopsis thaliana GN=MER3 PE=2 SV=1 263 938 6.0E-82
sp|P53327|SLH1_YEAST Antiviral helicase SLH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLH1 PE=1 SV=2 280 944 1.0E-81
sp|B6DMK2|MER3_ORYSJ ATP-dependent DNA helicase MER3 homolog OS=Oryza sativa subsp. japonica GN=MER3 PE=2 SV=1 255 940 1.0E-81
sp|P51979|HFM1_YEAST ATP-dependent DNA helicase MER3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HFM1 PE=1 SV=3 1096 1700 3.0E-79
sp|B6DMK2|MER3_ORYSJ ATP-dependent DNA helicase MER3 homolog OS=Oryza sativa subsp. japonica GN=MER3 PE=2 SV=1 1130 1700 4.0E-78
sp|Q5D892|MER3_ARATH DExH-box ATP-dependent RNA helicase DExH17 OS=Arabidopsis thaliana GN=MER3 PE=2 SV=1 1140 1706 2.0E-77
sp|Q9SYP1|DEXHC_ARATH DExH-box ATP-dependent RNA helicase DExH12 OS=Arabidopsis thaliana GN=EMB1507 PE=2 SV=1 277 999 3.0E-77
sp|O75643|U520_HUMAN U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens GN=SNRNP200 PE=1 SV=2 283 1014 1.0E-71
sp|F1LNJ2|U520_RAT U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Rattus norvegicus GN=Snrnp200 PE=1 SV=1 283 1014 1.0E-71
sp|Q6P4T2|U520_MOUSE U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Mus musculus GN=Snrnp200 PE=1 SV=1 283 1014 2.0E-71
sp|P51979|HFM1_YEAST ATP-dependent DNA helicase MER3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HFM1 PE=1 SV=3 276 849 4.0E-70
sp|O48534|DEXHD_ARATH DExH-box ATP-dependent RNA helicase DExH13 OS=Arabidopsis thaliana GN=At2g42270 PE=2 SV=1 277 1009 7.0E-70
sp|Q974S1|HELS_SULTO ATP-dependent DNA helicase Hel308 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=hel308 PE=1 SV=1 1143 1589 1.0E-46
sp|D0KN27|HELS_SULS9 ATP-dependent DNA helicase Hel308 OS=Sulfolobus solfataricus (strain 98/2) GN=hel308 PE=1 SV=1 1117 1554 2.0E-43
sp|P0DMI1|HELS_ARCFU ATP-dependent DNA helicase Hel308 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=hel308 PE=1 SV=1 1119 1649 3.0E-43
sp|Q97AI2|HELS_THEVO ATP-dependent DNA helicase Hel308 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=hel308 PE=3 SV=1 1160 1649 3.0E-43
sp|Q9V0A9|HELS_PYRAB ATP-dependent DNA helicase Hel308 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=hel308 PE=3 SV=1 1127 1654 1.0E-42
sp|Q9HJX7|HELS_THEAC ATP-dependent DNA helicase Hel308 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=hel308 PE=3 SV=1 1160 1657 1.0E-42
sp|Q97AI2|HELS_THEVO ATP-dependent DNA helicase Hel308 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=hel308 PE=3 SV=1 295 807 3.0E-42
sp|Q97VY9|HELS_SULSO ATP-dependent DNA helicase Hel308 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=hel308 PE=3 SV=1 1143 1554 3.0E-42
sp|F0NDL2|HELS_SULIR ATP-dependent DNA helicase Hel308 OS=Sulfolobus islandicus (strain REY15A) GN=hel308 PE=3 SV=1 1143 1554 3.0E-42
sp|O59025|HELS_PYRHO ATP-dependent DNA helicase Hel308 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=hel308 PE=3 SV=1 1160 1654 5.0E-42
sp|A7IB61|HELS_METB6 ATP-dependent DNA helicase Hel308 OS=Methanoregula boonei (strain 6A8) GN=hel308 PE=3 SV=1 1160 1668 2.0E-40
sp|Q9HMV6|HELS_HALSA ATP-dependent DNA helicase Hel308 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=hel308 PE=3 SV=1 1122 1665 3.0E-39
sp|B0R7Q2|HELS_HALS3 ATP-dependent DNA helicase Hel308 OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=hel308 PE=3 SV=1 1122 1665 3.0E-39
sp|O73946|HELS_PYRFU ATP-dependent DNA helicase Hel308 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=hel308 PE=1 SV=1 1143 1589 4.0E-39
sp|Q4JC00|HELS_SULAC ATP-dependent DNA helicase Hel308 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=hel308 PE=3 SV=1 1115 1586 5.0E-38
sp|Q8PZR7|HELS_METMA ATP-dependent DNA helicase Hel308 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=hel308 PE=3 SV=1 1128 1649 9.0E-38
sp|Q12WZ6|HELS_METBU ATP-dependent DNA helicase Hel308 OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=hel308 PE=3 SV=1 1124 1649 1.0E-37
sp|Q9HMV6|HELS_HALSA ATP-dependent DNA helicase Hel308 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=hel308 PE=3 SV=1 264 726 1.0E-36
sp|B0R7Q2|HELS_HALS3 ATP-dependent DNA helicase Hel308 OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=hel308 PE=3 SV=1 264 726 1.0E-36
sp|Q5UYM9|HELS_HALMA ATP-dependent DNA helicase Hel308 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=hel308 PE=3 SV=1 1127 1669 1.0E-36
sp|P0DMI1|HELS_ARCFU ATP-dependent DNA helicase Hel308 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=hel308 PE=1 SV=1 297 904 2.0E-36
sp|Q9YFQ8|HELS_AERPE ATP-dependent DNA helicase Hel308 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=hel308 PE=3 SV=2 277 709 2.0E-36
sp|Q974S1|HELS_SULTO ATP-dependent DNA helicase Hel308 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=hel308 PE=1 SV=1 266 710 3.0E-36
sp|Q9HJX7|HELS_THEAC ATP-dependent DNA helicase Hel308 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=hel308 PE=3 SV=1 296 807 3.0E-36
sp|Q8TL39|HELS_METAC ATP-dependent DNA helicase Hel308 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=hel308 PE=3 SV=1 1128 1649 6.0E-36
sp|Q9YFQ8|HELS_AERPE ATP-dependent DNA helicase Hel308 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=hel308 PE=3 SV=2 1160 1709 1.0E-35
sp|D0KN27|HELS_SULS9 ATP-dependent DNA helicase Hel308 OS=Sulfolobus solfataricus (strain 98/2) GN=hel308 PE=1 SV=1 278 710 4.0E-35
sp|Q9V0A9|HELS_PYRAB ATP-dependent DNA helicase Hel308 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=hel308 PE=3 SV=1 298 700 2.0E-34
sp|Q4JC00|HELS_SULAC ATP-dependent DNA helicase Hel308 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=hel308 PE=3 SV=1 278 710 2.0E-34
sp|A8MB76|HELS_CALMQ ATP-dependent DNA helicase Hel308 OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=hel308 PE=3 SV=1 278 851 3.0E-34
sp|Q5UYM9|HELS_HALMA ATP-dependent DNA helicase Hel308 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=hel308 PE=3 SV=1 279 710 4.0E-34
sp|Q465R3|HELS_METBF ATP-dependent DNA helicase Hel308 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=hel308 PE=3 SV=1 1160 1649 4.0E-34
sp|F0NDL2|HELS_SULIR ATP-dependent DNA helicase Hel308 OS=Sulfolobus islandicus (strain REY15A) GN=hel308 PE=3 SV=1 278 710 5.0E-34
sp|Q97VY9|HELS_SULSO ATP-dependent DNA helicase Hel308 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=hel308 PE=3 SV=1 278 710 1.0E-33
sp|A6UN73|HELS_METVS ATP-dependent DNA helicase Hel308 OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=hel308 PE=3 SV=1 298 708 1.0E-33
sp|O59025|HELS_PYRHO ATP-dependent DNA helicase Hel308 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=hel308 PE=3 SV=1 297 700 3.0E-33
sp|Q0W6L1|HELS_METAR ATP-dependent DNA helicase Hel308 OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=hel308 PE=3 SV=1 1160 1697 3.0E-33
sp|O73946|HELS_PYRFU ATP-dependent DNA helicase Hel308 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=hel308 PE=1 SV=1 299 753 5.0E-33
sp|O26901|HELS_METTH ATP-dependent DNA helicase Hel308 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=hel308 PE=1 SV=1 1138 1583 5.0E-33
sp|A8MB76|HELS_CALMQ ATP-dependent DNA helicase Hel308 OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=hel308 PE=3 SV=1 1145 1662 8.0E-33
sp|Q3IU46|HELS_NATPD ATP-dependent DNA helicase Hel308 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=hel308 PE=3 SV=1 278 708 5.0E-32
sp|A6UN73|HELS_METVS ATP-dependent DNA helicase Hel308 OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=hel308 PE=3 SV=1 1145 1575 9.0E-32
sp|A3MSA1|HELS_PYRCJ ATP-dependent DNA helicase Hel308 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=hel308 PE=3 SV=1 1117 1574 1.0E-31
sp|A7IB61|HELS_METB6 ATP-dependent DNA helicase Hel308 OS=Methanoregula boonei (strain 6A8) GN=hel308 PE=3 SV=1 279 854 4.0E-31
sp|Q8CGS6|DPOLQ_MOUSE DNA polymerase theta OS=Mus musculus GN=Polq PE=1 SV=2 1160 1575 6.0E-31
sp|Q3IU46|HELS_NATPD ATP-dependent DNA helicase Hel308 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=hel308 PE=3 SV=1 1166 1657 2.0E-30
sp|O18475|DPOLQ_DROME DNA polymerase theta OS=Drosophila melanogaster GN=mus308 PE=1 SV=1 1159 1570 1.0E-29
sp|Q12WZ6|HELS_METBU ATP-dependent DNA helicase Hel308 OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=hel308 PE=3 SV=1 279 679 2.0E-29
sp|O75417|DPOLQ_HUMAN DNA polymerase theta OS=Homo sapiens GN=POLQ PE=1 SV=2 1160 1575 2.0E-29
sp|Q465R3|HELS_METBF ATP-dependent DNA helicase Hel308 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=hel308 PE=3 SV=1 300 679 5.0E-29
sp|Q2VPA6|HELQ_MOUSE Helicase POLQ-like OS=Mus musculus GN=Helq PE=1 SV=2 1160 1595 5.0E-29
sp|O26901|HELS_METTH ATP-dependent DNA helicase Hel308 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=hel308 PE=1 SV=1 281 770 7.0E-29
sp|Q8PZR7|HELS_METMA ATP-dependent DNA helicase Hel308 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=hel308 PE=3 SV=1 299 679 1.0E-26
sp|Q8TDG4|HELQ_HUMAN Helicase POLQ-like OS=Homo sapiens GN=HELQ PE=1 SV=2 1160 1526 1.0E-26
sp|Q0W6L1|HELS_METAR ATP-dependent DNA helicase Hel308 OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=hel308 PE=3 SV=1 299 700 2.0E-26
sp|Q8TL39|HELS_METAC ATP-dependent DNA helicase Hel308 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=hel308 PE=3 SV=1 299 679 4.0E-26
sp|O13799|YE02_SCHPO Uncharacterized helicase C17H9.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17H9.02 PE=1 SV=1 299 687 6.0E-26
sp|Q5JGV6|HELS_THEKO ATP-dependent DNA helicase Hel308 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=hel308 PE=3 SV=1 1117 1465 3.0E-25
sp|A3MSA1|HELS_PYRCJ ATP-dependent DNA helicase Hel308 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=hel308 PE=3 SV=1 298 694 2.0E-24
sp|Q8CGS6|DPOLQ_MOUSE DNA polymerase theta OS=Mus musculus GN=Polq PE=1 SV=2 299 744 5.0E-23
sp|Q588V7|TEB_ARATH Helicase and polymerase-containing protein TEBICHI OS=Arabidopsis thaliana GN=TEB PE=2 SV=1 1160 1575 5.0E-23
sp|O75417|DPOLQ_HUMAN DNA polymerase theta OS=Homo sapiens GN=POLQ PE=1 SV=2 299 829 2.0E-22
sp|A0FLQ6|DPOLQ_CAEEL DNA polymerase theta OS=Caenorhabditis elegans GN=polq-1 PE=1 SV=2 1160 1527 2.0E-22
sp|Q9CZU3|SK2L2_MOUSE Superkiller viralicidic activity 2-like 2 OS=Mus musculus GN=Skiv2l2 PE=1 SV=1 297 687 4.0E-22
sp|P42285|SK2L2_HUMAN Superkiller viralicidic activity 2-like 2 OS=Homo sapiens GN=SKIV2L2 PE=1 SV=3 297 687 5.0E-22
sp|Q9XIF2|MTR4_ARATH DExH-box ATP-dependent RNA helicase DExH9 OS=Arabidopsis thaliana GN=MTR4 PE=2 SV=1 297 687 1.0E-21
sp|Q9XIF2|MTR4_ARATH DExH-box ATP-dependent RNA helicase DExH9 OS=Arabidopsis thaliana GN=MTR4 PE=2 SV=1 1160 1517 3.0E-21
sp|Q9ZVW2|HEN2_ARATH DExH-box ATP-dependent RNA helicase DExH10 OS=Arabidopsis thaliana GN=HEN2 PE=1 SV=2 1125 1523 3.0E-21
sp|Q914M3|Y007_SIFVH Putative helicase 7 OS=Sulfolobus islandicus filamentous virus (isolate Iceland/Hveragerdi) GN=SIFV0007 PE=3 SV=1 283 695 7.0E-21
sp|Q5JGV6|HELS_THEKO ATP-dependent DNA helicase Hel308 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=hel308 PE=3 SV=1 299 629 1.0E-20
sp|Q588V7|TEB_ARATH Helicase and polymerase-containing protein TEBICHI OS=Arabidopsis thaliana GN=TEB PE=2 SV=1 300 702 1.0E-20
sp|Q9ZBD8|HELY_MYCLE Probable helicase HelY OS=Mycobacterium leprae (strain TN) GN=helY PE=3 SV=1 1160 1520 1.0E-20
sp|Q23223|MTR4_CAEEL mRNA transport homolog 4 OS=Caenorhabditis elegans GN=mtr-4 PE=3 SV=1 297 734 2.0E-20
sp|A0FLQ6|DPOLQ_CAEEL DNA polymerase theta OS=Caenorhabditis elegans GN=polq-1 PE=1 SV=2 299 672 4.0E-20
sp|Q15477|SKIV2_HUMAN Helicase SKI2W OS=Homo sapiens GN=SKIV2L PE=1 SV=3 1150 1522 4.0E-20
sp|P47047|MTR4_YEAST ATP-dependent RNA helicase DOB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MTR4 PE=1 SV=1 299 680 5.0E-20
sp|Q9CZU3|SK2L2_MOUSE Superkiller viralicidic activity 2-like 2 OS=Mus musculus GN=Skiv2l2 PE=1 SV=1 1160 1516 7.0E-20
sp|Q2VPA6|HELQ_MOUSE Helicase POLQ-like OS=Mus musculus GN=Helq PE=1 SV=2 277 744 8.0E-20
sp|Q8TDG4|HELQ_HUMAN Helicase POLQ-like OS=Homo sapiens GN=HELQ PE=1 SV=2 277 708 9.0E-20
sp|Q9ZVW2|HEN2_ARATH DExH-box ATP-dependent RNA helicase DExH10 OS=Arabidopsis thaliana GN=HEN2 PE=1 SV=2 299 702 1.0E-19
sp|O14232|MTR4_SCHPO ATP-dependent RNA helicase mtr4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mtr4 PE=1 SV=1 299 683 1.0E-19
sp|O13799|YE02_SCHPO Uncharacterized helicase C17H9.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17H9.02 PE=1 SV=1 1160 1517 2.0E-19
sp|P42285|SK2L2_HUMAN Superkiller viralicidic activity 2-like 2 OS=Homo sapiens GN=SKIV2L2 PE=1 SV=3 1160 1516 2.0E-19
sp|Q58524|HELS_METJA ATP-dependent DNA helicase Hel308 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=hel308 PE=3 SV=1 297 634 5.0E-19
sp|O59801|SKI2_SCHPO Putative ATP-dependent RNA helicase C550.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC550.03c PE=3 SV=1 1154 1527 5.0E-19
sp|O14232|MTR4_SCHPO ATP-dependent RNA helicase mtr4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mtr4 PE=1 SV=1 1160 1527 9.0E-19
sp|P9WMR1|HELY_MYCTU Probable helicase HelY OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=helY PE=1 SV=1 1160 1520 1.0E-18
sp|P9WMR0|HELY_MYCTO Probable helicase HelY OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=helY PE=3 SV=1 1160 1520 1.0E-18
sp|Q15477|SKIV2_HUMAN Helicase SKI2W OS=Homo sapiens GN=SKIV2L PE=1 SV=3 348 684 3.0E-18
sp|Q58524|HELS_METJA ATP-dependent DNA helicase Hel308 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=hel308 PE=3 SV=1 1145 1470 4.0E-18
sp|O18475|DPOLQ_DROME DNA polymerase theta OS=Drosophila melanogaster GN=mus308 PE=1 SV=1 300 705 1.0E-17
sp|Q23223|MTR4_CAEEL mRNA transport homolog 4 OS=Caenorhabditis elegans GN=mtr-4 PE=3 SV=1 1103 1524 1.0E-16
sp|Q58796|Y1401_METJA Probable ATP-dependent helicase MJ1401 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1401 PE=3 SV=1 1145 1526 1.0E-16
sp|Q914M3|Y007_SIFVH Putative helicase 7 OS=Sulfolobus islandicus filamentous virus (isolate Iceland/Hveragerdi) GN=SIFV0007 PE=3 SV=1 1143 1579 7.0E-16
sp|Q9ZBD8|HELY_MYCLE Probable helicase HelY OS=Mycobacterium leprae (strain TN) GN=helY PE=3 SV=1 266 683 3.0E-14
sp|Q58796|Y1401_METJA Probable ATP-dependent helicase MJ1401 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1401 PE=3 SV=1 278 679 3.0E-14
sp|Q57742|HELX_METJA Uncharacterized ATP-dependent helicase MJ0294 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0294 PE=3 SV=1 299 642 9.0E-13
sp|P30015|LHR_ECOLI Probable ATP-dependent helicase lhr OS=Escherichia coli (strain K12) GN=lhr PE=3 SV=2 1146 1578 1.0E-12
sp|O59801|SKI2_SCHPO Putative ATP-dependent RNA helicase C550.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC550.03c PE=3 SV=1 535 715 3.0E-12
sp|P35207|SKI2_YEAST Antiviral helicase SKI2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKI2 PE=1 SV=2 1373 1524 1.0E-10
sp|F4JAA5|SKI2_ARATH DExH-box ATP-dependent RNA helicase DExH11 OS=Arabidopsis thaliana GN=SKI2 PE=1 SV=1 1424 1527 3.0E-10
sp|P30015|LHR_ECOLI Probable ATP-dependent helicase lhr OS=Escherichia coli (strain K12) GN=lhr PE=3 SV=2 277 671 4.0E-10
sp|F4JAA5|SKI2_ARATH DExH-box ATP-dependent RNA helicase DExH11 OS=Arabidopsis thaliana GN=SKI2 PE=1 SV=1 588 697 4.0E-10
sp|P95949|HELX_SULSO Uncharacterized ATP-dependent helicase SSO0112 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=SSO0112 PE=3 SV=1 296 671 4.0E-10
sp|B9DFG3|ISE2_ARATH DExH-box ATP-dependent RNA helicase DExH15 chloroplastic OS=Arabidopsis thaliana GN=ISE2 PE=1 SV=2 1159 1354 5.0E-10
sp|Q8IY21|DDX60_HUMAN Probable ATP-dependent RNA helicase DDX60 OS=Homo sapiens GN=DDX60 PE=1 SV=3 553 672 1.0E-09
sp|Q57742|HELX_METJA Uncharacterized ATP-dependent helicase MJ0294 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0294 PE=3 SV=1 1132 1319 2.0E-09
sp|P35207|SKI2_YEAST Antiviral helicase SKI2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKI2 PE=1 SV=2 535 683 1.0E-08
sp|Q5H9U9|DDX6L_HUMAN Probable ATP-dependent RNA helicase DDX60-like OS=Homo sapiens GN=DDX60L PE=2 SV=2 582 672 2.0E-08
sp|B9DFG3|ISE2_ARATH DExH-box ATP-dependent RNA helicase DExH15 chloroplastic OS=Arabidopsis thaliana GN=ISE2 PE=1 SV=2 1373 1515 3.0E-08
sp|B9DFG3|ISE2_ARATH DExH-box ATP-dependent RNA helicase DExH15 chloroplastic OS=Arabidopsis thaliana GN=ISE2 PE=1 SV=2 592 686 8.0E-08
sp|P9WMR1|HELY_MYCTU Probable helicase HelY OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=helY PE=1 SV=1 294 502 1.0E-07
sp|P9WMR1|HELY_MYCTU Probable helicase HelY OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=helY PE=1 SV=1 587 672 1.0E-07
sp|P9WMR0|HELY_MYCTO Probable helicase HelY OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=helY PE=3 SV=1 294 502 1.0E-07
sp|P9WMR0|HELY_MYCTO Probable helicase HelY OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=helY PE=3 SV=1 587 672 1.0E-07
sp|Q8IY21|DDX60_HUMAN Probable ATP-dependent RNA helicase DDX60 OS=Homo sapiens GN=DDX60 PE=1 SV=3 1165 1319 1.0E-07
sp|Q9P7T8|YIW2_SCHPO Uncharacterized helicase C694.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC694.02 PE=3 SV=1 1426 1515 1.0E-07
sp|Q54XN7|Y8827_DICDI Uncharacterized helicase DDB_G0278827 OS=Dictyostelium discoideum GN=DDB_G0278827 PE=3 SV=1 1418 1515 1.0E-07
sp|P47047|MTR4_YEAST ATP-dependent RNA helicase DOB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MTR4 PE=1 SV=1 1160 1345 2.0E-07
sp|O27830|HELX_METTH Uncharacterized ATP-dependent helicase MTH_1802 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=MTH_1802 PE=3 SV=1 1156 1324 2.0E-07
sp|P47047|MTR4_YEAST ATP-dependent RNA helicase DOB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MTR4 PE=1 SV=1 1428 1517 3.0E-07
sp|Q9P7T8|YIW2_SCHPO Uncharacterized helicase C694.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC694.02 PE=3 SV=1 574 679 3.0E-07
sp|Q09475|YP93_CAEEL Uncharacterized helicase C28H8.3 OS=Caenorhabditis elegans GN=C28H8.3 PE=3 SV=2 566 679 3.0E-07
sp|Q09475|YP93_CAEEL Uncharacterized helicase C28H8.3 OS=Caenorhabditis elegans GN=C28H8.3 PE=3 SV=2 1431 1515 4.0E-07
sp|P95949|HELX_SULSO Uncharacterized ATP-dependent helicase SSO0112 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=SSO0112 PE=3 SV=1 1160 1507 5.0E-07
sp|Q8IY21|DDX60_HUMAN Probable ATP-dependent RNA helicase DDX60 OS=Homo sapiens GN=DDX60 PE=1 SV=3 1406 1520 5.0E-07
sp|O59801|SKI2_SCHPO Putative ATP-dependent RNA helicase C550.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC550.03c PE=3 SV=1 348 505 1.0E-06
sp|A6RIS1|MPH1_BOTFB ATP-dependent DNA helicase MPH1 OS=Botryotinia fuckeliana (strain B05.10) GN=mph1 PE=3 SV=2 1135 1276 6.0E-06
sp|Q2HG76|MPH1_CHAGB ATP-dependent DNA helicase MPH1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=MPH1 PE=3 SV=1 1088 1323 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:0005524 ATP binding Yes
GO:0016787 hydrolase activity Yes
GO:0003677 DNA binding Yes
GO:0017076 purine nucleotide binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0032553 ribonucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0043168 anion binding No
GO:0097159 organic cyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0030554 adenyl nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3897
MASNDLAVAEEQWRMQFAAMQKALAELNLTSSEPSANLYDEYDEDDDDTITSSSPRGEGYDVWDFISDDDDDNGL
DDSCSSSGSGVVDADASLGHGTDWFSARCSALANKNGLAPDVLQTQVVGVLTSGASDDELQAQLADLIGFDDLDF
VIQVLSRKDQIAAAASASPGPANGQPRLLNKAQRQEALYRQDAQHKNAALLPSYSKEPQYPHVYRAYTAGNSLSA
TGKKYGLPAGSERLQFEKYEEYFIPAGKKGTLGAKEKLVRIADLDGLCRRTFKGYKSLNRMQSLVYPVAYKSSEN
MLICAPTGAGKTDAAMLTILHTIGQYTVPKPGEEVGAVDFAVNVQEFKIVYVAPMKALAAEVTEKLGKRLAWLGI
KCREYTGDMQLTKSEIVQTQIIVTTPEKWDVVTRKGTGDTELVQKVRLLIIDEVHMLHDERGAVLESLVARTQRQ
VESTQSLIRIIGLSATLPNYVDVADFLRVNRYAGLFYFDASFRPVPLEQHFIGVKGKTGSKQCKENLDTVAFEKV
KQMLEREHQVMVFVHSRKDTMASAKMLDQKAMEQMCSSLFDPSGHPKYEQAARDMKTSRSKEIRQLLAKGLGIHH
AGMARADRNLMERLFGEGVIKVLCCTATLAWGVNLPAAAVVIKGTQVYSAQEGKFVDLGILDVLQIFGRAGRPQF
EDTGIGMICTSQDRLQHYLRAVTEQQPIESRFSAKLVDNVNAEIALGTVTSIADAVQWIGYSYLFVRMQRSPTTY
GIEWAEIRDDPELVQRRRQLAEQAARTLQQCQMIVWNERSDELRSKDIGRIASQYYILHTSIQIFNSMMRPQATE
ADVFKMLSMSGEFDNVQSRDNEAKELMRLRHDVVPCDVAGGIDTPQCKTNLLLQAYVSRQQLDDFALSNDMNYVA
QQSGRICRALFMLALNRRWGHQCLVLLTLCKSIERRIWPFEHPLHQFELAKPILNQLDAREGLTVEAMRDMEPAE
IGALVHNHGAGIKIAKLLHHFPTVHVEADMAPLNRDVLRIKLHLSADFGWRDQIHGASESFWIWVENSDTGDIYH
YEFWILSRRKLHDAHELNFCIPLADPLPTQIYVRAVSDRWLGAETVTAVSFQHLIRPDTESVYTELLKLQPLPIG
ALQNAQLEEVYAPRFGFFNPMQTQIFHTLYHTPANVLLGSPTGSGKTVAAELAMWWAFRERPGSKVVYIAPMKAL
VRERVKDWGERLARPLGLRLVELTGDQTPDRRSIEEADIMVTTPEKWDGISRAWQSRGYVRQVSLVIIDEIHLLA
GDRGPILEIIVSRMNFIASTTKQAVRLVGMSTAVANASDLANWLGVKHGLFNFRHSVRPVPLELYIDGFPETRGF
CPLMQSMNRPTFVAIKKHSPSKPVIVFVASRRQTRLTAKDLINFCAIEDNPRRFVAMDEDELQLHLVRAKDDALK
EALSFGIGLHHAGLVESDRQLAEELFVANKIQILVATSTLAWGVNLPAHLVVVKGTQFYDAKTEAYKDMDLTDVL
QMLGRAGRPQFDTSGVARIFTQDAKKDFYKHFLHTGFPVESLLHTVLANHLCAEIAAQTIATKQDALDYLTWTFF
FRRLLKNPCYYGLELTAEEHGSAAAAQQAANDYMVELVDEAVRELVLSGCVEEWCPGELGATPLGQVVSFYYLDH
KTVRSLVARARTHKRREDDEVVVAFGDVVASVCLAAEYDELPVRHNEEAINAALADALPLPTSLMSCNSASTRTT
MTKEKEEEEEDATTTTTTTTDLPLWDAHVKAFLLLQAHFSRVELPISDYVGDQTSVLDQAVRIVQAAIDVV*
Coding >OphauB2|3897
ATGGCGTCGAATGACTTGGCTGTTGCAGAGGAGCAATGGAGGATGCAGTTTGCTGCCATGCAAAAAGCACTGGCA
GAGCTAAATCTAACGTCCTCGGAGCCATCAGCCAACCTCTACGATGAATACGATGAGGACGACGACGACACGATT
ACCTCTTCTTCTCCCCGAGGCGAAGGATACGACGTCTGGGACTTTATATCCGACGACGACGACGACAATGGCCTG
GACGACTCGTGCAGCAGCAGCGGGTCTGGAGTTGTCGACGCAGACGCATCTCTGGGCCATGGCACAGACTGGTTT
TCAGCCAGGTGCTCTGCCCTGGCAAACAAGAATGGCCTTGCACCAGACGTGCTGCAGACACAAGTCGTTGGTGTC
TTGACCTCGGGGGCCTCGGACGATGAGCTACAAGCCCAACTTGCAGACTTGATTGGCTTTGACGACCTCGACTTT
GTCATTCAAGTCTTGTCGCGCAAGGATCAAATCGCTGCTGCCGCGTCTGCTTCTCCTGGGCCAGCAAATGGCCAG
CCCCGGCTCTTGAACAAGGCCCAGCGCCAAGAGGCTCTGTACCGACAAGATGCACAGCACAAGAATGCGGCACTC
TTGCCAAGCTACTCCAAGGAGCCGCAGTACCCCCACGTCTATCGAGCATACACTGCAGGCAACTCGCTAAGCGCT
ACGGGCAAAAAGTACGGCCTGCCAGCCGGCAGCGAGCGGCTGCAATTTGAAAAGTATGAAGAGTATTTTATTCCT
GCCGGGAAAAAGGGCACGCTTGGAGCCAAGGAGAAGCTGGTGCGCATTGCAGACCTGGATGGGCTCTGCAGAAGG
ACTTTCAAGGGCTACAAGTCGCTCAATCGGATGCAGAGCCTCGTGTATCCCGTGGCGTACAAGTCGAGCGAAAAC
ATGCTCATTTGTGCACCCACTGGTGCGGGTAAAACAGATGCGGCAATGCTCACCATTTTGCACACGATTGGACAG
TACACTGTGCCGAAGCCTGGGGAGGAGGTTGGGGCCGTCGACTTTGCAGTCAATGTGCAAGAGTTCAAAATCGTC
TACGTTGCGCCCATGAAGGCCCTGGCGGCCGAAGTGACGGAGAAGCTGGGCAAGCGGCTGGCGTGGCTGGGCATC
AAGTGCCGCGAGTACACGGGAGACATGCAGCTGACCAAGTCGGAGATTGTGCAGACGCAAATCATTGTGACGACG
CCCGAGAAGTGGGACGTGGTGACGAGAAAGGGCACGGGCGACACGGAGCTGGTGCAAAAGGTGCGGCTGCTCATT
ATTGACGAGGTGCACATGCTTCACGACGAGCGAGGCGCGGTGCTGGAGTCGCTGGTGGCGCGCACCCAGAGACAG
GTGGAAAGCACGCAGTCGCTCATTCGCATCATTGGGCTGAGCGCGACGCTGCCAAACTATGTGGATGTGGCCGAC
TTTCTCCGGGTCAACCGGTACGCGGGCCTCTTTTACTTTGATGCGTCGTTTCGCCCTGTGCCTCTGGAGCAGCAC
TTTATCGGCGTCAAGGGCAAGACGGGGTCCAAGCAGTGCAAGGAGAATTTAGACACGGTGGCGTTTGAAAAGGTC
AAGCAGATGCTGGAGCGAGAGCACCAAGTCATGGTTTTTGTGCACTCGCGCAAAGATACCATGGCCAGCGCCAAG
ATGCTGGACCAAAAGGCCATGGAGCAAATGTGCTCGAGTCTCTTTGATCCGAGCGGCCATCCCAAGTACGAGCAA
GCGGCACGCGACATGAAGACGTCGCGGTCCAAGGAGATTCGGCAGCTGCTGGCCAAGGGCCTGGGCATACACCAT
GCAGGCATGGCCCGGGCAGACCGCAATCTGATGGAGCGGCTCTTTGGCGAGGGCGTCATCAAGGTGCTTTGCTGC
ACGGCGACGCTGGCGTGGGGCGTCAACCTGCCGGCGGCGGCGGTTGTCATCAAGGGGACGCAGGTGTACAGCGCG
CAAGAGGGCAAGTTTGTCGACCTGGGCATCCTCGACGTGCTGCAAATCTTTGGGCGTGCCGGACGACCGCAGTTT
GAGGACACGGGCATTGGCATGATTTGCACGAGCCAGGACCGGCTGCAGCACTACCTAAGAGCGGTGACGGAGCAG
CAGCCGATTGAGTCGAGGTTCTCGGCCAAGCTGGTGGACAATGTCAATGCGGAGATTGCGCTGGGCACCGTGACG
TCGATTGCGGACGCGGTGCAGTGGATTGGCTACTCGTATCTCTTTGTGCGCATGCAGCGGAGCCCGACAACATAT
GGCATCGAGTGGGCCGAGATTCGCGACGACCCCGAGCTGGTGCAGCGGCGACGGCAGCTGGCAGAGCAGGCGGCG
CGGACGCTGCAGCAGTGCCAGATGATTGTGTGGAACGAGAGGAGCGACGAGCTGCGCAGCAAGGACATTGGGCGC
ATCGCCAGCCAGTACTACATTTTGCACACGAGCATCCAAATCTTCAACAGCATGATGCGGCCGCAGGCGACCGAG
GCAGACGTGTTCAAGATGCTGAGCATGAGCGGCGAGTTTGACAATGTGCAGTCGCGCGACAATGAGGCCAAGGAG
CTGATGCGTCTGCGGCACGACGTGGTGCCGTGCGACGTGGCGGGCGGCATCGACACGCCGCAGTGCAAGACGAAC
CTGCTGCTCCAGGCGTACGTGTCGCGGCAGCAGCTCGACGACTTTGCCCTCAGCAACGACATGAATTATGTGGCG
CAGCAGTCGGGGCGCATCTGCCGGGCGCTCTTTATGCTGGCTCTCAACCGGCGATGGGGCCACCAGTGCCTGGTC
TTGTTGACACTGTGCAAGTCGATTGAGCGGCGCATCTGGCCCTTTGAGCACCCGCTGCACCAGTTTGAGCTGGCC
AAGCCCATTCTCAACCAGCTGGATGCGCGCGAGGGCCTGACGGTGGAGGCGATGCGCGACATGGAGCCGGCCGAG
ATTGGTGCGCTGGTGCACAACCACGGGGCGGGCATCAAGATTGCCAAGCTGCTGCACCACTTTCCCACGGTGCAC
GTCGAGGCCGACATGGCGCCGCTTAATCGCGACGTGCTGCGCATCAAGCTGCATCTGAGCGCCGACTTTGGCTGG
CGCGACCAGATTCACGGCGCCTCCGAGTCGTTTTGGATCTGGGTGGAAAACTCGGACACGGGCGACATTTACCAT
TACGAGTTTTGGATCCTCAGCCGCCGCAAGCTGCACGACGCGCACGAGCTCAACTTTTGCATCCCGCTGGCCGAT
CCGCTGCCCACGCAAATCTATGTGCGGGCCGTGTCGGACCGGTGGCTGGGGGCGGAGACGGTGACGGCGGTATCC
TTTCAGCACCTGATTCGGCCCGACACGGAGAGCGTCTACACGGAGCTGCTCAAGCTGCAGCCGCTGCCCATTGGG
GCGCTGCAGAATGCCCAGCTGGAAGAGGTGTATGCGCCGCGCTTTGGCTTCTTCAACCCCATGCAGACGCAAATC
TTCCACACGCTCTACCACACGCCGGCCAATGTGCTGCTGGGGTCGCCGACGGGCAGCGGCAAGACGGTGGCGGCG
GAGCTGGCCATGTGGTGGGCGTTTCGCGAGCGGCCCGGGTCCAAGGTGGTGTACATTGCGCCCATGAAGGCGCTG
GTGCGCGAGCGCGTCAAGGACTGGGGCGAGCGGCTGGCGCGGCCGCTGGGCCTGAGGCTGGTGGAGCTGACGGGC
GACCAGACGCCCGACAGGCGCAGCATTGAAGAGGCCGACATCATGGTGACGACGCCCGAGAAGTGGGACGGCATA
TCGCGGGCGTGGCAGTCGCGCGGCTACGTGCGCCAAGTCAGCCTCGTTATAATTGACGAGATTCACCTGCTGGCG
GGCGACCGCGGGCCCATTTTGGAAATCATTGTGTCGCGCATGAATTTCATTGCCTCGACAACGAAGCAGGCGGTG
CGGCTGGTGGGCATGTCGACGGCGGTCGCCAACGCGTCAGACCTGGCCAACTGGCTGGGCGTCAAGCACGGCCTC
TTTAACTTTCGGCACTCGGTGCGCCCCGTGCCGCTGGAGCTCTACATTGACGGCTTCCCCGAGACGCGCGGCTTC
TGCCCCCTGATGCAGTCGATGAACCGGCCCACCTTTGTCGCCATCAAGAAGCACAGCCCCAGCAAGCCCGTCATT
GTCTTTGTGGCGTCGCGCCGGCAGACGCGGCTGACGGCCAAGGACCTCATCAACTTTTGCGCCATTGAGGACAAT
CCGCGGCGCTTTGTCGCCATGGACGAGGACGAGCTGCAGCTGCACCTGGTGCGCGCCAAGGACGACGCGCTCAAG
GAGGCGCTGAGCTTTGGCATTGGCCTGCACCACGCCGGCCTGGTAGAGTCGGACCGCCAGCTGGCCGAGGAGCTC
TTTGTGGCCAACAAGATTCAGATCCTCGTGGCCACGAGCACGCTGGCCTGGGGCGTCAACCTGCCGGCGCACCTG
GTGGTGGTCAAGGGCACGCAGTTTTACGATGCCAAGACGGAGGCCTACAAGGACATGGACCTGACGGATGTGCTG
CAGATGCTTGGCCGCGCCGGCCGGCCGCAGTTTGACACGTCTGGCGTGGCGCGCATTTTTACCCAAGACGCCAAG
AAGGACTTTTACAAGCACTTTTTGCACACGGGCTTTCCCGTCGAGTCGCTGCTGCACACTGTGCTTGCCAACCAC
TTGTGCGCCGAGATTGCCGCGCAGACGATTGCCACCAAGCAAGACGCGCTCGACTACCTGACGTGGACCTTTTTC
TTTAGGCGGCTCCTCAAGAACCCCTGCTACTATGGGCTGGAGCTGACGGCCGAGGAGCACGGCAGCGCGGCGGCG
GCGCAGCAGGCGGCAAACGACTACATGGTTGAGCTGGTGGACGAGGCGGTGCGCGAGCTGGTGCTGTCGGGGTGT
GTCGAGGAGTGGTGCCCGGGCGAGCTTGGAGCGACGCCGCTGGGCCAAGTGGTTAGTTTTTACTACCTCGATCAC
AAGACGGTGCGCAGCCTGGTGGCGCGGGCGCGGACGCATAAGAGGAGGGAGGACGACGAGGTGGTGGTGGCGTTT
GGCGACGTGGTGGCGAGTGTGTGCTTGGCGGCCGAGTATGACGAGTTGCCGGTGCGGCATAACGAGGAGGCAATT
AATGCGGCGCTGGCGGATGCGCTGCCGCTGCCGACGAGTTTGATGTCTTGCAACTCTGCCTCGACAAGGACGACG
ATGACGAAGGAGAAGGAGGAGGAGGAGGAGGATGCCACGACGACGACGACGACGACGACAGACTTGCCGCTGTGG
GACGCACACGTCAAGGCCTTTTTGCTGCTGCAGGCACACTTTTCGCGCGTCGAGCTGCCCATTTCAGACTATGTG
GGCGACCAGACGAGCGTGCTGGACCAGGCGGTGCGGATTGTGCAGGCGGCCATTGACGTAGTGTAA
Transcript >OphauB2|3897
ATGGCGTCGAATGACTTGGCTGTTGCAGAGGAGCAATGGAGGATGCAGTTTGCTGCCATGCAAAAAGCACTGGCA
GAGCTAAATCTAACGTCCTCGGAGCCATCAGCCAACCTCTACGATGAATACGATGAGGACGACGACGACACGATT
ACCTCTTCTTCTCCCCGAGGCGAAGGATACGACGTCTGGGACTTTATATCCGACGACGACGACGACAATGGCCTG
GACGACTCGTGCAGCAGCAGCGGGTCTGGAGTTGTCGACGCAGACGCATCTCTGGGCCATGGCACAGACTGGTTT
TCAGCCAGGTGCTCTGCCCTGGCAAACAAGAATGGCCTTGCACCAGACGTGCTGCAGACACAAGTCGTTGGTGTC
TTGACCTCGGGGGCCTCGGACGATGAGCTACAAGCCCAACTTGCAGACTTGATTGGCTTTGACGACCTCGACTTT
GTCATTCAAGTCTTGTCGCGCAAGGATCAAATCGCTGCTGCCGCGTCTGCTTCTCCTGGGCCAGCAAATGGCCAG
CCCCGGCTCTTGAACAAGGCCCAGCGCCAAGAGGCTCTGTACCGACAAGATGCACAGCACAAGAATGCGGCACTC
TTGCCAAGCTACTCCAAGGAGCCGCAGTACCCCCACGTCTATCGAGCATACACTGCAGGCAACTCGCTAAGCGCT
ACGGGCAAAAAGTACGGCCTGCCAGCCGGCAGCGAGCGGCTGCAATTTGAAAAGTATGAAGAGTATTTTATTCCT
GCCGGGAAAAAGGGCACGCTTGGAGCCAAGGAGAAGCTGGTGCGCATTGCAGACCTGGATGGGCTCTGCAGAAGG
ACTTTCAAGGGCTACAAGTCGCTCAATCGGATGCAGAGCCTCGTGTATCCCGTGGCGTACAAGTCGAGCGAAAAC
ATGCTCATTTGTGCACCCACTGGTGCGGGTAAAACAGATGCGGCAATGCTCACCATTTTGCACACGATTGGACAG
TACACTGTGCCGAAGCCTGGGGAGGAGGTTGGGGCCGTCGACTTTGCAGTCAATGTGCAAGAGTTCAAAATCGTC
TACGTTGCGCCCATGAAGGCCCTGGCGGCCGAAGTGACGGAGAAGCTGGGCAAGCGGCTGGCGTGGCTGGGCATC
AAGTGCCGCGAGTACACGGGAGACATGCAGCTGACCAAGTCGGAGATTGTGCAGACGCAAATCATTGTGACGACG
CCCGAGAAGTGGGACGTGGTGACGAGAAAGGGCACGGGCGACACGGAGCTGGTGCAAAAGGTGCGGCTGCTCATT
ATTGACGAGGTGCACATGCTTCACGACGAGCGAGGCGCGGTGCTGGAGTCGCTGGTGGCGCGCACCCAGAGACAG
GTGGAAAGCACGCAGTCGCTCATTCGCATCATTGGGCTGAGCGCGACGCTGCCAAACTATGTGGATGTGGCCGAC
TTTCTCCGGGTCAACCGGTACGCGGGCCTCTTTTACTTTGATGCGTCGTTTCGCCCTGTGCCTCTGGAGCAGCAC
TTTATCGGCGTCAAGGGCAAGACGGGGTCCAAGCAGTGCAAGGAGAATTTAGACACGGTGGCGTTTGAAAAGGTC
AAGCAGATGCTGGAGCGAGAGCACCAAGTCATGGTTTTTGTGCACTCGCGCAAAGATACCATGGCCAGCGCCAAG
ATGCTGGACCAAAAGGCCATGGAGCAAATGTGCTCGAGTCTCTTTGATCCGAGCGGCCATCCCAAGTACGAGCAA
GCGGCACGCGACATGAAGACGTCGCGGTCCAAGGAGATTCGGCAGCTGCTGGCCAAGGGCCTGGGCATACACCAT
GCAGGCATGGCCCGGGCAGACCGCAATCTGATGGAGCGGCTCTTTGGCGAGGGCGTCATCAAGGTGCTTTGCTGC
ACGGCGACGCTGGCGTGGGGCGTCAACCTGCCGGCGGCGGCGGTTGTCATCAAGGGGACGCAGGTGTACAGCGCG
CAAGAGGGCAAGTTTGTCGACCTGGGCATCCTCGACGTGCTGCAAATCTTTGGGCGTGCCGGACGACCGCAGTTT
GAGGACACGGGCATTGGCATGATTTGCACGAGCCAGGACCGGCTGCAGCACTACCTAAGAGCGGTGACGGAGCAG
CAGCCGATTGAGTCGAGGTTCTCGGCCAAGCTGGTGGACAATGTCAATGCGGAGATTGCGCTGGGCACCGTGACG
TCGATTGCGGACGCGGTGCAGTGGATTGGCTACTCGTATCTCTTTGTGCGCATGCAGCGGAGCCCGACAACATAT
GGCATCGAGTGGGCCGAGATTCGCGACGACCCCGAGCTGGTGCAGCGGCGACGGCAGCTGGCAGAGCAGGCGGCG
CGGACGCTGCAGCAGTGCCAGATGATTGTGTGGAACGAGAGGAGCGACGAGCTGCGCAGCAAGGACATTGGGCGC
ATCGCCAGCCAGTACTACATTTTGCACACGAGCATCCAAATCTTCAACAGCATGATGCGGCCGCAGGCGACCGAG
GCAGACGTGTTCAAGATGCTGAGCATGAGCGGCGAGTTTGACAATGTGCAGTCGCGCGACAATGAGGCCAAGGAG
CTGATGCGTCTGCGGCACGACGTGGTGCCGTGCGACGTGGCGGGCGGCATCGACACGCCGCAGTGCAAGACGAAC
CTGCTGCTCCAGGCGTACGTGTCGCGGCAGCAGCTCGACGACTTTGCCCTCAGCAACGACATGAATTATGTGGCG
CAGCAGTCGGGGCGCATCTGCCGGGCGCTCTTTATGCTGGCTCTCAACCGGCGATGGGGCCACCAGTGCCTGGTC
TTGTTGACACTGTGCAAGTCGATTGAGCGGCGCATCTGGCCCTTTGAGCACCCGCTGCACCAGTTTGAGCTGGCC
AAGCCCATTCTCAACCAGCTGGATGCGCGCGAGGGCCTGACGGTGGAGGCGATGCGCGACATGGAGCCGGCCGAG
ATTGGTGCGCTGGTGCACAACCACGGGGCGGGCATCAAGATTGCCAAGCTGCTGCACCACTTTCCCACGGTGCAC
GTCGAGGCCGACATGGCGCCGCTTAATCGCGACGTGCTGCGCATCAAGCTGCATCTGAGCGCCGACTTTGGCTGG
CGCGACCAGATTCACGGCGCCTCCGAGTCGTTTTGGATCTGGGTGGAAAACTCGGACACGGGCGACATTTACCAT
TACGAGTTTTGGATCCTCAGCCGCCGCAAGCTGCACGACGCGCACGAGCTCAACTTTTGCATCCCGCTGGCCGAT
CCGCTGCCCACGCAAATCTATGTGCGGGCCGTGTCGGACCGGTGGCTGGGGGCGGAGACGGTGACGGCGGTATCC
TTTCAGCACCTGATTCGGCCCGACACGGAGAGCGTCTACACGGAGCTGCTCAAGCTGCAGCCGCTGCCCATTGGG
GCGCTGCAGAATGCCCAGCTGGAAGAGGTGTATGCGCCGCGCTTTGGCTTCTTCAACCCCATGCAGACGCAAATC
TTCCACACGCTCTACCACACGCCGGCCAATGTGCTGCTGGGGTCGCCGACGGGCAGCGGCAAGACGGTGGCGGCG
GAGCTGGCCATGTGGTGGGCGTTTCGCGAGCGGCCCGGGTCCAAGGTGGTGTACATTGCGCCCATGAAGGCGCTG
GTGCGCGAGCGCGTCAAGGACTGGGGCGAGCGGCTGGCGCGGCCGCTGGGCCTGAGGCTGGTGGAGCTGACGGGC
GACCAGACGCCCGACAGGCGCAGCATTGAAGAGGCCGACATCATGGTGACGACGCCCGAGAAGTGGGACGGCATA
TCGCGGGCGTGGCAGTCGCGCGGCTACGTGCGCCAAGTCAGCCTCGTTATAATTGACGAGATTCACCTGCTGGCG
GGCGACCGCGGGCCCATTTTGGAAATCATTGTGTCGCGCATGAATTTCATTGCCTCGACAACGAAGCAGGCGGTG
CGGCTGGTGGGCATGTCGACGGCGGTCGCCAACGCGTCAGACCTGGCCAACTGGCTGGGCGTCAAGCACGGCCTC
TTTAACTTTCGGCACTCGGTGCGCCCCGTGCCGCTGGAGCTCTACATTGACGGCTTCCCCGAGACGCGCGGCTTC
TGCCCCCTGATGCAGTCGATGAACCGGCCCACCTTTGTCGCCATCAAGAAGCACAGCCCCAGCAAGCCCGTCATT
GTCTTTGTGGCGTCGCGCCGGCAGACGCGGCTGACGGCCAAGGACCTCATCAACTTTTGCGCCATTGAGGACAAT
CCGCGGCGCTTTGTCGCCATGGACGAGGACGAGCTGCAGCTGCACCTGGTGCGCGCCAAGGACGACGCGCTCAAG
GAGGCGCTGAGCTTTGGCATTGGCCTGCACCACGCCGGCCTGGTAGAGTCGGACCGCCAGCTGGCCGAGGAGCTC
TTTGTGGCCAACAAGATTCAGATCCTCGTGGCCACGAGCACGCTGGCCTGGGGCGTCAACCTGCCGGCGCACCTG
GTGGTGGTCAAGGGCACGCAGTTTTACGATGCCAAGACGGAGGCCTACAAGGACATGGACCTGACGGATGTGCTG
CAGATGCTTGGCCGCGCCGGCCGGCCGCAGTTTGACACGTCTGGCGTGGCGCGCATTTTTACCCAAGACGCCAAG
AAGGACTTTTACAAGCACTTTTTGCACACGGGCTTTCCCGTCGAGTCGCTGCTGCACACTGTGCTTGCCAACCAC
TTGTGCGCCGAGATTGCCGCGCAGACGATTGCCACCAAGCAAGACGCGCTCGACTACCTGACGTGGACCTTTTTC
TTTAGGCGGCTCCTCAAGAACCCCTGCTACTATGGGCTGGAGCTGACGGCCGAGGAGCACGGCAGCGCGGCGGCG
GCGCAGCAGGCGGCAAACGACTACATGGTTGAGCTGGTGGACGAGGCGGTGCGCGAGCTGGTGCTGTCGGGGTGT
GTCGAGGAGTGGTGCCCGGGCGAGCTTGGAGCGACGCCGCTGGGCCAAGTGGTTAGTTTTTACTACCTCGATCAC
AAGACGGTGCGCAGCCTGGTGGCGCGGGCGCGGACGCATAAGAGGAGGGAGGACGACGAGGTGGTGGTGGCGTTT
GGCGACGTGGTGGCGAGTGTGTGCTTGGCGGCCGAGTATGACGAGTTGCCGGTGCGGCATAACGAGGAGGCAATT
AATGCGGCGCTGGCGGATGCGCTGCCGCTGCCGACGAGTTTGATGTCTTGCAACTCTGCCTCGACAAGGACGACG
ATGACGAAGGAGAAGGAGGAGGAGGAGGAGGATGCCACGACGACGACGACGACGACGACAGACTTGCCGCTGTGG
GACGCACACGTCAAGGCCTTTTTGCTGCTGCAGGCACACTTTTCGCGCGTCGAGCTGCCCATTTCAGACTATGTG
GGCGACCAGACGAGCGTGCTGGACCAGGCGGTGCGGATTGTGCAGGCGGCCATTGACGTAGTGTAA
Gene >OphauB2|3897
ATGGCGTCGAATGACTTGGCTGTTGCAGAGGAGCAATGGAGGATGCAGTTTGCTGCCATGCAAAAAGCACTGGCA
GAGCTAAATCTAACGTCCTCGGAGCCATCAGCCAACCTCTACGATGAATACGATGAGGACGACGACGACACGATT
ACCTCTTCTTCTCCCCGAGGCGAAGGATACGACGTCTGGGACTTTATATCCGACGACGACGACGACAATGGCCTG
GACGACTCGTGCAGCAGCAGCGGGTCTGGAGTTGTCGACGCAGACGCATCTCTGGGCCATGGCACAGACTGGTTT
TCAGCCAGGTGCTCTGCCCTGGCAAACAAGAATGGCCTTGCACCAGACGTGCTGCAGACACAAGTCGTTGGTGTC
TTGACCTCGGGGGCCTCGGACGATGAGCTACAAGCCCAACTTGCAGACTTGATTGGCTTTGACGACCTCGACTTT
GTCATTCAAGTCTTGTCGCGCAAGGATCAAATCGCTGCTGCCGCGTCTGCTTCTCCTGGGCCAGCAAATGGCCAG
CCCCGGCTCTTGAACAAGGCCCAGCGCCAAGAGGCTCTGTACCGACAAGATGCACAGCACAAGAATGCGGCACTC
TTGCCAAGCTACTCCAAGGAGCCGCAGTACCCCCACGTCTATCGAGCATACACTGCAGGCAACTCGCTAAGCGCT
ACGGGCAAAAAGTACGGCCTGCCAGCCGGCAGCGAGCGGCTGCAATTTGAAAAGTATGAAGAGTATTTTATTCCT
GCCGGGAAAAAGGGCACGCTTGGAGCCAAGGAGAAGCTGGTGCGCATTGCAGACCTGGATGGGCTCTGCAGAAGG
ACTTTCAAGGGCTACAAGTCGCTCAATCGGATGCAGAGCCTCGTGTATCCCGTGGCGTACAAGTCGAGCGAAAAC
ATGCTCATTTGTGCACCCACTGGTGCGGTGCGTTGATGCCCGTGCCATGGCCCTAGCACTCGGGCTGGTTCATGA
CAAGTGCTGATGCAAGAAAATGGCCTTGTACAGGGTAAAACAGATGCGGCAATGCTCACCATTTTGCACACGATT
GGACAGTACACTGTGCCGAAGCCTGGGGAGGAGGTTGGGGCCGTCGACTTTGCAGTCAATGTGCAAGAGTTCAAA
ATCGTCTACGTTGCGCCCATGAAGGCCCTGGCGGCCGAAGTGACGGAGAAGCTGGGCAAGCGGCTGGCGTGGCTG
GGCATCAAGTGCCGCGAGTACACGGGAGACATGCAGCTGACCAAGTCGGAGATTGTGCAGACGCAAATCATTGTG
ACGACGCCCGAGAAGTGGGACGTGGTGACGAGAAAGGGCACGGGCGACACGGAGCTGGTGCAAAAGGTGCGGCTG
CTCATTATTGACGAGGTGCACATGCTTCACGACGAGCGAGGCGCGGTGCTGGAGTCGCTGGTGGCGCGCACCCAG
AGACAGGTGGAAAGCACGCAGTCGCTCATTCGCATCATTGGGCTGAGCGCGACGCTGCCAAACTATGTGGATGTG
GCCGACTTTCTCCGGGTCAACCGGTACGCGGGCCTCTTTTACTTTGATGCGTCGTTTCGCCCTGTGCCTCTGGAG
CAGCACTTTATCGGCGTCAAGGGCAAGACGGGGTCCAAGCAGTGCAAGGAGAATTTAGACACGGTGGCGTTTGAA
AAGGTCAAGCAGATGCTGGAGCGAGAGCACCAAGTCATGGTTTTTGTGCACTCGCGCAAAGATACCATGGCCAGC
GCCAAGATGCTGGACCAAAAGGCCATGGAGCAAATGTGCTCGAGTCTCTTTGATCCGAGCGGCCATCCCAAGTAC
GAGCAAGCGGCACGCGACATGAAGACGTCGCGGTCCAAGGAGATTCGGCAGCTGCTGGCCAAGGGCCTGGGCATA
CACCATGCAGGCATGGCCCGGGCAGACCGCAATCTGATGGAGCGGCTCTTTGGCGAGGGCGTCATCAAGGTGCTT
TGCTGCACGGCGACGCTGGCGTGGGGCGTCAACCTGCCGGCGGCGGCGGTTGTCATCAAGGGGACGCAGGTGTAC
AGCGCGCAAGAGGGCAAGTTTGTCGACCTGGGCATCCTCGACGTGCTGCAAATCTTTGGGCGTGCCGGACGACCG
CAGTTTGAGGACACGGGCATTGGCATGATTTGCACGAGCCAGGACCGGCTGCAGCACTACCTAAGAGCGGTGACG
GAGCAGCAGCCGATTGAGTCGAGGTTCTCGGCCAAGCTGGTGGACAATGTCAATGCGGAGATTGCGCTGGGCACC
GTGACGTCGATTGCGGACGCGGTGCAGTGGATTGGCTACTCGTATCTCTTTGTGCGCATGCAGCGGAGCCCGACA
ACATATGGCATCGAGTGGGCCGAGATTCGCGACGACCCCGAGCTGGTGCAGCGGCGACGGCAGCTGGCAGAGCAG
GCGGCGCGGACGCTGCAGCAGTGCCAGATGATTGTGTGGAACGAGAGGAGCGACGAGCTGCGCAGCAAGGACATT
GGGCGCATCGCCAGCCAGTACTACATTTTGCACACGAGCATCCAAATCTTCAACAGCATGATGCGGCCGCAGGCG
ACCGAGGCAGACGTGTTCAAGATGCTGAGCATGAGCGGCGAGTTTGACAATGTGCAGTCGCGCGACAATGAGGCC
AAGGAGCTGATGCGTCTGCGGCACGACGTGGTGCCGTGCGACGTGGCGGGCGGCATCGACACGCCGCAGTGCAAG
ACGAACCTGCTGCTCCAGGCGTACGTGTCGCGGCAGCAGCTCGACGACTTTGCCCTCAGCAACGACATGAATTAT
GTGGCGCAGCAGTCGGGGCGCATCTGCCGGGCGCTCTTTATGCTGGCTCTCAACCGGCGATGGGGCCACCAGTGC
CTGGTCTTGTTGACACTGTGCAAGTCGATTGAGCGGCGCATCTGGCCCTTTGAGCACCCGCTGCACCAGTTTGAG
CTGGCCAAGCCCATTCTCAACCAGCTGGATGCGCGCGAGGGCCTGACGGTGGAGGCGATGCGCGACATGGAGCCG
GCCGAGATTGGTGCGCTGGTGCACAACCACGGGGCGGGCATCAAGATTGCCAAGCTGCTGCACCACTTTCCCACG
GTGCACGTCGAGGCCGACATGGCGCCGCTTAATCGCGACGTGCTGCGCATCAAGCTGCATCTGAGCGCCGACTTT
GGCTGGCGCGACCAGATTCACGGCGCCTCCGAGTCGTTTTGGATCTGGGTGGAAAACTCGGACACGGGCGACATT
TACCATTACGAGTTTTGGATCCTCAGCCGCCGCAAGCTGCACGACGCGCACGAGCTCAACTTTTGCATCCCGCTG
GCCGATCCGCTGCCCACGCAAATCTATGTGCGGGCCGTGTCGGACCGGTGGCTGGGGGCGGAGACGGTGACGGCG
GTATCCTTTCAGCACCTGATTCGGCCCGACACGGAGAGCGTCTACACGGAGCTGCTCAAGCTGCAGCCGCTGCCC
ATTGGGGCGCTGCAGAATGCCCAGCTGGAAGAGGTGTATGCGCCGCGCTTTGGCTTCTTCAACCCCATGCAGACG
CAAATCTTCCACACGCTCTACCACACGCCGGCCAATGTGCTGCTGGGGTCGCCGACGGGCAGCGGCAAGACGGTG
GCGGCGGAGCTGGCCATGTGGTGGGCGTTTCGCGAGCGGCCCGGGTCCAAGGTGGTGTACATTGCGCCCATGAAG
GCGCTGGTGCGCGAGCGCGTCAAGGACTGGGGCGAGCGGCTGGCGCGGCCGCTGGGCCTGAGGCTGGTGGAGCTG
ACGGGCGACCAGACGCCCGACAGGCGCAGCATTGAAGAGGCCGACATCATGGTGACGACGCCCGAGAAGTGGGAC
GGCATATCGCGGGCGTGGCAGTCGCGCGGCTACGTGCGCCAAGTCAGCCTCGTTATAATTGACGAGATTCACCTG
CTGGCGGGCGACCGCGGGCCCATTTTGGAAATCATTGTGTCGCGCATGAATTTCATTGCCTCGACAACGAAGCAG
GCGGTGCGGCTGGTGGGCATGTCGACGGCGGTCGCCAACGCGTCAGACCTGGCCAACTGGCTGGGCGTCAAGCAC
GGCCTCTTTAACTTTCGGCACTCGGTGCGCCCCGTGCCGCTGGAGCTCTACATTGACGGCTTCCCCGAGACGCGC
GGCTTCTGCCCCCTGATGCAGTCGATGAACCGGCCCACCTTTGTCGCCATCAAGAAGCACAGCCCCAGCAAGCCC
GTCATTGTCTTTGTGGCGTCGCGCCGGCAGACGCGGCTGACGGCCAAGGACCTCATCAACTTTTGCGCCATTGAG
GACAATCCGCGGCGCTTTGTCGCCATGGACGAGGACGAGCTGCAGCTGCACCTGGTGCGCGCCAAGGACGACGCG
CTCAAGGAGGCGCTGAGCTTTGGCATTGGCCTGCACCACGCCGGCCTGGTAGAGTCGGACCGCCAGCTGGCCGAG
GAGCTCTTTGTGGCCAACAAGATTCAGATCCTCGTGGCCACGAGCACGCTGGCCTGGGGCGTCAACCTGCCGGCG
CACCTGGTGGTGGTCAAGGGCACGCAGTTTTACGATGCCAAGACGGAGGCCTACAAGGACATGGACCTGACGGAT
GTGCTGCAGATGCTTGGCCGCGCCGGCCGGCCGCAGTTTGACACGTCTGGCGTGGCGCGCATTTTTACCCAAGAC
GCCAAGAAGGACTTTTACAAGCACTTTTTGCACACGGGCTTTCCCGTCGAGTCGCTGCTGCACACTGTGCTTGCC
AACCACTTGTGCGCCGAGATTGCCGCGCAGACGATTGCCACCAAGCAAGACGCGCTCGACTACCTGACGTGGACC
TTTTTCTTTAGGCGGCTCCTCAAGAACCCCTGCTACTATGGGCTGGAGCTGACGGCCGAGGAGCACGGCAGCGCG
GCGGCGGCGCAGCAGGCGGCAAACGACTACATGGTTGAGCTGGTGGACGAGGCGGTGCGCGAGCTGGTGCTGTCG
GGGTGTGTCGAGGAGTGGTGCCCGGGCGAGCTTGGAGCGACGCCGCTGGGCCAAGTGGTTAGTTTTTACTACCTC
GATCACAAGACGGTGCGCAGCCTGGTGGCGCGGGCGCGGACGCATAAGAGGAGGGAGGACGACGAGGTGGTGGTG
GCGTTTGGCGACGTGGTGGCGAGTGTGTGCTTGGCGGCCGAGTATGACGAGTTGCCGGTGCGGCATAACGAGGAG
GCAATTAATGCGGCGCTGGCGGATGCGCTGCCGCTGCCGACGAGTTTGATGTCTTGCAACTCTGCCTCGACAAGG
ACGACGATGACGAAGGAGAAGGAGGAGGAGGAGGAGGATGCCACGACGACGACGACGACGACGACAGACTTGCCG
CTGTGGGACGCACACGTCAAGGCCTTTTTGCTGCTGCAGGCACACTTTTCGCGCGTCGAGCTGCCCATTTCAGAC
TATGTGGGCGACCAGACGAGCGTGCTGGACCAGGCGGTGCGGATTGTGCAGGCGGCCATTGACGTGTTTGCCGAG
CTGGGCTTGAGCGAGGCGTGTGTGCAGGCGGTGCGGCTGCTGCAGAGTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail