Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3897
Gene name
LocationContig_25:102102..107629
Strand+
Gene length (bp)5527
Transcript length (bp)5391
Coding sequence length (bp)5391
Protein length (aa) 1797

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02889 Sec63 Sec63 Brl domain 5.4E-80 796 1099
PF02889 Sec63 Sec63 Brl domain 1.7E-23 1637 1795
PF00270 DEAD DEAD/DEAH box helicase 2.4E-26 285 471
PF00270 DEAD DEAD/DEAH box helicase 4.0E-22 1145 1309
PF04851 ResIII Type III restriction enzyme, res subunit 1.1E-08 288 468
PF04851 ResIII Type III restriction enzyme, res subunit 1.2E-09 1156 1294
PF00271 Helicase_C Helicase conserved C-terminal domain 1.6E-06 1422 1508

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O60072|MUG81_SCHPO Putative helicase mug81 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug81 PE=1 SV=1 99 1795 0.0E+00
sp|P53327|SLH1_YEAST Antiviral helicase SLH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLH1 PE=1 SV=2 134 1795 0.0E+00
sp|E9PZJ8|ASCC3_MOUSE Activating signal cointegrator 1 complex subunit 3 OS=Mus musculus GN=Ascc3 PE=1 SV=1 209 1795 0.0E+00
sp|Q8N3C0|ASCC3_HUMAN Activating signal cointegrator 1 complex subunit 3 OS=Homo sapiens GN=ASCC3 PE=1 SV=3 153 1795 0.0E+00
sp|E1BNG3|ASCC3_BOVIN Activating signal cointegrator 1 complex subunit 3 OS=Bos taurus GN=ascc3 PE=3 SV=1 153 1795 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O60072|MUG81_SCHPO Putative helicase mug81 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug81 PE=1 SV=1 99 1795 0.0E+00
sp|P53327|SLH1_YEAST Antiviral helicase SLH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLH1 PE=1 SV=2 134 1795 0.0E+00
sp|E9PZJ8|ASCC3_MOUSE Activating signal cointegrator 1 complex subunit 3 OS=Mus musculus GN=Ascc3 PE=1 SV=1 209 1795 0.0E+00
sp|Q8N3C0|ASCC3_HUMAN Activating signal cointegrator 1 complex subunit 3 OS=Homo sapiens GN=ASCC3 PE=1 SV=3 153 1795 0.0E+00
sp|E1BNG3|ASCC3_BOVIN Activating signal cointegrator 1 complex subunit 3 OS=Bos taurus GN=ascc3 PE=3 SV=1 153 1795 0.0E+00
sp|F1NTD6|ASCC3_CHICK Activating signal cointegrator 1 complex subunit 3 OS=Gallus gallus GN=ascc3 PE=3 SV=2 209 1795 0.0E+00
sp|F1LPQ2|ASCC3_RAT Activating signal cointegrator 1 complex subunit 3 OS=Rattus norvegicus GN=Ascc3 PE=3 SV=1 209 1795 0.0E+00
sp|Q9FNQ1|DEXHE_ARATH DExH-box ATP-dependent RNA helicase DExH14 OS=Arabidopsis thaliana GN=At5g61140 PE=2 SV=1 69 1795 0.0E+00
sp|E7F8F4|ASCC3_DANRE Activating signal cointegrator 1 complex subunit 3 OS=Danio rerio GN=ascc3 PE=3 SV=2 232 1661 0.0E+00
sp|Q54G57|HELC1_DICDI Activating signal cointegrator 1 complex subunit 3 OS=Dictyostelium discoideum GN=ascc3 PE=3 SV=1 78 1795 0.0E+00
sp|O75643|U520_HUMAN U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens GN=SNRNP200 PE=1 SV=2 121 1796 0.0E+00
sp|Q6P4T2|U520_MOUSE U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Mus musculus GN=Snrnp200 PE=1 SV=1 121 1796 0.0E+00
sp|F1LNJ2|U520_RAT U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Rattus norvegicus GN=Snrnp200 PE=1 SV=1 121 1796 0.0E+00
sp|Q9VUV9|U520_DROME Putative U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Drosophila melanogaster GN=l(3)72Ab PE=2 SV=4 99 1796 0.0E+00
sp|Q9SYP1|DEXHC_ARATH DExH-box ATP-dependent RNA helicase DExH12 OS=Arabidopsis thaliana GN=EMB1507 PE=2 SV=1 216 1796 0.0E+00
sp|O48534|DEXHD_ARATH DExH-box ATP-dependent RNA helicase DExH13 OS=Arabidopsis thaliana GN=At2g42270 PE=2 SV=1 216 1796 0.0E+00
sp|Q9U2G0|U520_CAEEL Putative U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Caenorhabditis elegans GN=Y46G5A.4 PE=3 SV=1 53 1796 0.0E+00
sp|Q55CI8|HELCL_DICDI Activating signal cointegrator 1 complex subunit 3-like OS=Dictyostelium discoideum GN=ascc3l PE=3 SV=1 216 1796 0.0E+00
sp|Q9UT24|BRR2_SCHPO Pre-mRNA-splicing factor brr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=brr2 PE=1 SV=1 216 1796 0.0E+00
sp|P32639|BRR2_YEAST Pre-mRNA-splicing helicase BRR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BRR2 PE=1 SV=2 135 1796 0.0E+00
sp|Q8N3C0|ASCC3_HUMAN Activating signal cointegrator 1 complex subunit 3 OS=Homo sapiens GN=ASCC3 PE=1 SV=3 279 1001 4.0E-100
sp|E9PZJ8|ASCC3_MOUSE Activating signal cointegrator 1 complex subunit 3 OS=Mus musculus GN=Ascc3 PE=1 SV=1 279 971 1.0E-97
sp|F1NTD6|ASCC3_CHICK Activating signal cointegrator 1 complex subunit 3 OS=Gallus gallus GN=ascc3 PE=3 SV=2 280 938 2.0E-97
sp|E1BNG3|ASCC3_BOVIN Activating signal cointegrator 1 complex subunit 3 OS=Bos taurus GN=ascc3 PE=3 SV=1 279 938 3.0E-96
sp|F1LPQ2|ASCC3_RAT Activating signal cointegrator 1 complex subunit 3 OS=Rattus norvegicus GN=Ascc3 PE=3 SV=1 279 971 1.0E-93
sp|Q9FNQ1|DEXHE_ARATH DExH-box ATP-dependent RNA helicase DExH14 OS=Arabidopsis thaliana GN=At5g61140 PE=2 SV=1 280 938 3.0E-91
sp|D3Z4R1|HFM1_MOUSE Probable ATP-dependent DNA helicase HFM1 OS=Mus musculus GN=Hfm1 PE=3 SV=2 1085 1658 3.0E-89
sp|A2RUV5|HFM1_XENTR Probable ATP-dependent DNA helicase HFM1 OS=Xenopus tropicalis GN=hfm1 PE=2 SV=1 274 1002 6.0E-88
sp|A2PYH4|HFM1_HUMAN Probable ATP-dependent DNA helicase HFM1 OS=Homo sapiens GN=HFM1 PE=1 SV=2 203 1004 1.0E-87
sp|E7F8F4|ASCC3_DANRE Activating signal cointegrator 1 complex subunit 3 OS=Danio rerio GN=ascc3 PE=3 SV=2 280 834 6.0E-86
sp|Q54G57|HELC1_DICDI Activating signal cointegrator 1 complex subunit 3 OS=Dictyostelium discoideum GN=ascc3 PE=3 SV=1 280 944 2.0E-85
sp|E7F8F4|ASCC3_DANRE Activating signal cointegrator 1 complex subunit 3 OS=Danio rerio GN=ascc3 PE=3 SV=2 1105 1698 2.0E-84
sp|A2RUV5|HFM1_XENTR Probable ATP-dependent DNA helicase HFM1 OS=Xenopus tropicalis GN=hfm1 PE=2 SV=1 1140 1700 2.0E-84
sp|D3Z4R1|HFM1_MOUSE Probable ATP-dependent DNA helicase HFM1 OS=Mus musculus GN=Hfm1 PE=3 SV=2 217 1012 6.0E-84
sp|A2PYH4|HFM1_HUMAN Probable ATP-dependent DNA helicase HFM1 OS=Homo sapiens GN=HFM1 PE=1 SV=2 1098 1698 6.0E-83
sp|Q5D892|MER3_ARATH DExH-box ATP-dependent RNA helicase DExH17 OS=Arabidopsis thaliana GN=MER3 PE=2 SV=1 263 938 6.0E-82
sp|P53327|SLH1_YEAST Antiviral helicase SLH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLH1 PE=1 SV=2 280 944 1.0E-81
sp|B6DMK2|MER3_ORYSJ ATP-dependent DNA helicase MER3 homolog OS=Oryza sativa subsp. japonica GN=MER3 PE=2 SV=1 255 940 1.0E-81
sp|P51979|HFM1_YEAST ATP-dependent DNA helicase MER3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HFM1 PE=1 SV=3 1096 1700 3.0E-79
sp|B6DMK2|MER3_ORYSJ ATP-dependent DNA helicase MER3 homolog OS=Oryza sativa subsp. japonica GN=MER3 PE=2 SV=1 1130 1700 4.0E-78
sp|Q5D892|MER3_ARATH DExH-box ATP-dependent RNA helicase DExH17 OS=Arabidopsis thaliana GN=MER3 PE=2 SV=1 1140 1706 2.0E-77
sp|Q9SYP1|DEXHC_ARATH DExH-box ATP-dependent RNA helicase DExH12 OS=Arabidopsis thaliana GN=EMB1507 PE=2 SV=1 277 999 3.0E-77
sp|O75643|U520_HUMAN U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens GN=SNRNP200 PE=1 SV=2 283 1014 1.0E-71
sp|F1LNJ2|U520_RAT U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Rattus norvegicus GN=Snrnp200 PE=1 SV=1 283 1014 1.0E-71
sp|Q6P4T2|U520_MOUSE U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Mus musculus GN=Snrnp200 PE=1 SV=1 283 1014 2.0E-71
sp|P51979|HFM1_YEAST ATP-dependent DNA helicase MER3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HFM1 PE=1 SV=3 276 849 4.0E-70
sp|O48534|DEXHD_ARATH DExH-box ATP-dependent RNA helicase DExH13 OS=Arabidopsis thaliana GN=At2g42270 PE=2 SV=1 277 1009 7.0E-70
sp|Q974S1|HELS_SULTO ATP-dependent DNA helicase Hel308 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=hel308 PE=1 SV=1 1143 1589 1.0E-46
sp|D0KN27|HELS_SULS9 ATP-dependent DNA helicase Hel308 OS=Sulfolobus solfataricus (strain 98/2) GN=hel308 PE=1 SV=1 1117 1554 2.0E-43
sp|P0DMI1|HELS_ARCFU ATP-dependent DNA helicase Hel308 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=hel308 PE=1 SV=1 1119 1649 3.0E-43
sp|Q97AI2|HELS_THEVO ATP-dependent DNA helicase Hel308 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=hel308 PE=3 SV=1 1160 1649 3.0E-43
sp|Q9V0A9|HELS_PYRAB ATP-dependent DNA helicase Hel308 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=hel308 PE=3 SV=1 1127 1654 1.0E-42
sp|Q9HJX7|HELS_THEAC ATP-dependent DNA helicase Hel308 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=hel308 PE=3 SV=1 1160 1657 1.0E-42
sp|Q97AI2|HELS_THEVO ATP-dependent DNA helicase Hel308 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=hel308 PE=3 SV=1 295 807 3.0E-42
sp|Q97VY9|HELS_SULSO ATP-dependent DNA helicase Hel308 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=hel308 PE=3 SV=1 1143 1554 3.0E-42
sp|F0NDL2|HELS_SULIR ATP-dependent DNA helicase Hel308 OS=Sulfolobus islandicus (strain REY15A) GN=hel308 PE=3 SV=1 1143 1554 3.0E-42
sp|O59025|HELS_PYRHO ATP-dependent DNA helicase Hel308 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=hel308 PE=3 SV=1 1160 1654 5.0E-42
sp|A7IB61|HELS_METB6 ATP-dependent DNA helicase Hel308 OS=Methanoregula boonei (strain 6A8) GN=hel308 PE=3 SV=1 1160 1668 2.0E-40
sp|Q9HMV6|HELS_HALSA ATP-dependent DNA helicase Hel308 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=hel308 PE=3 SV=1 1122 1665 3.0E-39
sp|B0R7Q2|HELS_HALS3 ATP-dependent DNA helicase Hel308 OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=hel308 PE=3 SV=1 1122 1665 3.0E-39
sp|O73946|HELS_PYRFU ATP-dependent DNA helicase Hel308 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=hel308 PE=1 SV=1 1143 1589 4.0E-39
sp|Q4JC00|HELS_SULAC ATP-dependent DNA helicase Hel308 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=hel308 PE=3 SV=1 1115 1586 5.0E-38
sp|Q8PZR7|HELS_METMA ATP-dependent DNA helicase Hel308 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=hel308 PE=3 SV=1 1128 1649 9.0E-38
sp|Q12WZ6|HELS_METBU ATP-dependent DNA helicase Hel308 OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=hel308 PE=3 SV=1 1124 1649 1.0E-37
sp|Q9HMV6|HELS_HALSA ATP-dependent DNA helicase Hel308 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=hel308 PE=3 SV=1 264 726 1.0E-36
sp|B0R7Q2|HELS_HALS3 ATP-dependent DNA helicase Hel308 OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=hel308 PE=3 SV=1 264 726 1.0E-36
sp|Q5UYM9|HELS_HALMA ATP-dependent DNA helicase Hel308 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=hel308 PE=3 SV=1 1127 1669 1.0E-36
sp|P0DMI1|HELS_ARCFU ATP-dependent DNA helicase Hel308 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=hel308 PE=1 SV=1 297 904 2.0E-36
sp|Q9YFQ8|HELS_AERPE ATP-dependent DNA helicase Hel308 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=hel308 PE=3 SV=2 277 709 2.0E-36
sp|Q974S1|HELS_SULTO ATP-dependent DNA helicase Hel308 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=hel308 PE=1 SV=1 266 710 3.0E-36
sp|Q9HJX7|HELS_THEAC ATP-dependent DNA helicase Hel308 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=hel308 PE=3 SV=1 296 807 3.0E-36
sp|Q8TL39|HELS_METAC ATP-dependent DNA helicase Hel308 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=hel308 PE=3 SV=1 1128 1649 6.0E-36
sp|Q9YFQ8|HELS_AERPE ATP-dependent DNA helicase Hel308 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=hel308 PE=3 SV=2 1160 1709 1.0E-35
sp|D0KN27|HELS_SULS9 ATP-dependent DNA helicase Hel308 OS=Sulfolobus solfataricus (strain 98/2) GN=hel308 PE=1 SV=1 278 710 4.0E-35
sp|Q9V0A9|HELS_PYRAB ATP-dependent DNA helicase Hel308 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=hel308 PE=3 SV=1 298 700 2.0E-34
sp|Q4JC00|HELS_SULAC ATP-dependent DNA helicase Hel308 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=hel308 PE=3 SV=1 278 710 2.0E-34
sp|A8MB76|HELS_CALMQ ATP-dependent DNA helicase Hel308 OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=hel308 PE=3 SV=1 278 851 3.0E-34
sp|Q5UYM9|HELS_HALMA ATP-dependent DNA helicase Hel308 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=hel308 PE=3 SV=1 279 710 4.0E-34
sp|Q465R3|HELS_METBF ATP-dependent DNA helicase Hel308 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=hel308 PE=3 SV=1 1160 1649 4.0E-34
sp|F0NDL2|HELS_SULIR ATP-dependent DNA helicase Hel308 OS=Sulfolobus islandicus (strain REY15A) GN=hel308 PE=3 SV=1 278 710 5.0E-34
sp|Q97VY9|HELS_SULSO ATP-dependent DNA helicase Hel308 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=hel308 PE=3 SV=1 278 710 1.0E-33
sp|A6UN73|HELS_METVS ATP-dependent DNA helicase Hel308 OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=hel308 PE=3 SV=1 298 708 1.0E-33
sp|O59025|HELS_PYRHO ATP-dependent DNA helicase Hel308 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=hel308 PE=3 SV=1 297 700 3.0E-33
sp|Q0W6L1|HELS_METAR ATP-dependent DNA helicase Hel308 OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=hel308 PE=3 SV=1 1160 1697 3.0E-33
sp|O73946|HELS_PYRFU ATP-dependent DNA helicase Hel308 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=hel308 PE=1 SV=1 299 753 5.0E-33
sp|O26901|HELS_METTH ATP-dependent DNA helicase Hel308 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=hel308 PE=1 SV=1 1138 1583 5.0E-33
sp|A8MB76|HELS_CALMQ ATP-dependent DNA helicase Hel308 OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=hel308 PE=3 SV=1 1145 1662 8.0E-33
sp|Q3IU46|HELS_NATPD ATP-dependent DNA helicase Hel308 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=hel308 PE=3 SV=1 278 708 5.0E-32
sp|A6UN73|HELS_METVS ATP-dependent DNA helicase Hel308 OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=hel308 PE=3 SV=1 1145 1575 9.0E-32
sp|A3MSA1|HELS_PYRCJ ATP-dependent DNA helicase Hel308 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=hel308 PE=3 SV=1 1117 1574 1.0E-31
sp|A7IB61|HELS_METB6 ATP-dependent DNA helicase Hel308 OS=Methanoregula boonei (strain 6A8) GN=hel308 PE=3 SV=1 279 854 4.0E-31
sp|Q8CGS6|DPOLQ_MOUSE DNA polymerase theta OS=Mus musculus GN=Polq PE=1 SV=2 1160 1575 6.0E-31
sp|Q3IU46|HELS_NATPD ATP-dependent DNA helicase Hel308 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=hel308 PE=3 SV=1 1166 1657 2.0E-30
sp|O18475|DPOLQ_DROME DNA polymerase theta OS=Drosophila melanogaster GN=mus308 PE=1 SV=1 1159 1570 1.0E-29
sp|Q12WZ6|HELS_METBU ATP-dependent DNA helicase Hel308 OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=hel308 PE=3 SV=1 279 679 2.0E-29
sp|O75417|DPOLQ_HUMAN DNA polymerase theta OS=Homo sapiens GN=POLQ PE=1 SV=2 1160 1575 2.0E-29
sp|Q465R3|HELS_METBF ATP-dependent DNA helicase Hel308 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=hel308 PE=3 SV=1 300 679 5.0E-29
sp|Q2VPA6|HELQ_MOUSE Helicase POLQ-like OS=Mus musculus GN=Helq PE=1 SV=2 1160 1595 5.0E-29
sp|O26901|HELS_METTH ATP-dependent DNA helicase Hel308 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=hel308 PE=1 SV=1 281 770 7.0E-29
sp|Q8PZR7|HELS_METMA ATP-dependent DNA helicase Hel308 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=hel308 PE=3 SV=1 299 679 1.0E-26
sp|Q8TDG4|HELQ_HUMAN Helicase POLQ-like OS=Homo sapiens GN=HELQ PE=1 SV=2 1160 1526 1.0E-26
sp|Q0W6L1|HELS_METAR ATP-dependent DNA helicase Hel308 OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=hel308 PE=3 SV=1 299 700 2.0E-26
sp|Q8TL39|HELS_METAC ATP-dependent DNA helicase Hel308 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=hel308 PE=3 SV=1 299 679 4.0E-26
sp|O13799|YE02_SCHPO Uncharacterized helicase C17H9.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17H9.02 PE=1 SV=1 299 687 6.0E-26
sp|Q5JGV6|HELS_THEKO ATP-dependent DNA helicase Hel308 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=hel308 PE=3 SV=1 1117 1465 3.0E-25
sp|A3MSA1|HELS_PYRCJ ATP-dependent DNA helicase Hel308 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=hel308 PE=3 SV=1 298 694 2.0E-24
sp|Q8CGS6|DPOLQ_MOUSE DNA polymerase theta OS=Mus musculus GN=Polq PE=1 SV=2 299 744 5.0E-23
sp|Q588V7|TEB_ARATH Helicase and polymerase-containing protein TEBICHI OS=Arabidopsis thaliana GN=TEB PE=2 SV=1 1160 1575 5.0E-23
sp|O75417|DPOLQ_HUMAN DNA polymerase theta OS=Homo sapiens GN=POLQ PE=1 SV=2 299 829 2.0E-22
sp|A0FLQ6|DPOLQ_CAEEL DNA polymerase theta OS=Caenorhabditis elegans GN=polq-1 PE=1 SV=2 1160 1527 2.0E-22
sp|Q9CZU3|SK2L2_MOUSE Superkiller viralicidic activity 2-like 2 OS=Mus musculus GN=Skiv2l2 PE=1 SV=1 297 687 4.0E-22
sp|P42285|SK2L2_HUMAN Superkiller viralicidic activity 2-like 2 OS=Homo sapiens GN=SKIV2L2 PE=1 SV=3 297 687 5.0E-22
sp|Q9XIF2|MTR4_ARATH DExH-box ATP-dependent RNA helicase DExH9 OS=Arabidopsis thaliana GN=MTR4 PE=2 SV=1 297 687 1.0E-21
sp|Q9XIF2|MTR4_ARATH DExH-box ATP-dependent RNA helicase DExH9 OS=Arabidopsis thaliana GN=MTR4 PE=2 SV=1 1160 1517 3.0E-21
sp|Q9ZVW2|HEN2_ARATH DExH-box ATP-dependent RNA helicase DExH10 OS=Arabidopsis thaliana GN=HEN2 PE=1 SV=2 1125 1523 3.0E-21
sp|Q914M3|Y007_SIFVH Putative helicase 7 OS=Sulfolobus islandicus filamentous virus (isolate Iceland/Hveragerdi) GN=SIFV0007 PE=3 SV=1 283 695 7.0E-21
sp|Q5JGV6|HELS_THEKO ATP-dependent DNA helicase Hel308 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=hel308 PE=3 SV=1 299 629 1.0E-20
sp|Q588V7|TEB_ARATH Helicase and polymerase-containing protein TEBICHI OS=Arabidopsis thaliana GN=TEB PE=2 SV=1 300 702 1.0E-20
sp|Q9ZBD8|HELY_MYCLE Probable helicase HelY OS=Mycobacterium leprae (strain TN) GN=helY PE=3 SV=1 1160 1520 1.0E-20
sp|Q23223|MTR4_CAEEL mRNA transport homolog 4 OS=Caenorhabditis elegans GN=mtr-4 PE=3 SV=1 297 734 2.0E-20
sp|A0FLQ6|DPOLQ_CAEEL DNA polymerase theta OS=Caenorhabditis elegans GN=polq-1 PE=1 SV=2 299 672 4.0E-20
sp|Q15477|SKIV2_HUMAN Helicase SKI2W OS=Homo sapiens GN=SKIV2L PE=1 SV=3 1150 1522 4.0E-20
sp|P47047|MTR4_YEAST ATP-dependent RNA helicase DOB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MTR4 PE=1 SV=1 299 680 5.0E-20
sp|Q9CZU3|SK2L2_MOUSE Superkiller viralicidic activity 2-like 2 OS=Mus musculus GN=Skiv2l2 PE=1 SV=1 1160 1516 7.0E-20
sp|Q2VPA6|HELQ_MOUSE Helicase POLQ-like OS=Mus musculus GN=Helq PE=1 SV=2 277 744 8.0E-20
sp|Q8TDG4|HELQ_HUMAN Helicase POLQ-like OS=Homo sapiens GN=HELQ PE=1 SV=2 277 708 9.0E-20
sp|Q9ZVW2|HEN2_ARATH DExH-box ATP-dependent RNA helicase DExH10 OS=Arabidopsis thaliana GN=HEN2 PE=1 SV=2 299 702 1.0E-19
sp|O14232|MTR4_SCHPO ATP-dependent RNA helicase mtr4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mtr4 PE=1 SV=1 299 683 1.0E-19
sp|O13799|YE02_SCHPO Uncharacterized helicase C17H9.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17H9.02 PE=1 SV=1 1160 1517 2.0E-19
sp|P42285|SK2L2_HUMAN Superkiller viralicidic activity 2-like 2 OS=Homo sapiens GN=SKIV2L2 PE=1 SV=3 1160 1516 2.0E-19
sp|Q58524|HELS_METJA ATP-dependent DNA helicase Hel308 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=hel308 PE=3 SV=1 297 634 5.0E-19
sp|O59801|SKI2_SCHPO Putative ATP-dependent RNA helicase C550.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC550.03c PE=3 SV=1 1154 1527 5.0E-19
sp|O14232|MTR4_SCHPO ATP-dependent RNA helicase mtr4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mtr4 PE=1 SV=1 1160 1527 9.0E-19
sp|P9WMR1|HELY_MYCTU Probable helicase HelY OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=helY PE=1 SV=1 1160 1520 1.0E-18
sp|P9WMR0|HELY_MYCTO Probable helicase HelY OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=helY PE=3 SV=1 1160 1520 1.0E-18
sp|Q15477|SKIV2_HUMAN Helicase SKI2W OS=Homo sapiens GN=SKIV2L PE=1 SV=3 348 684 3.0E-18
sp|Q58524|HELS_METJA ATP-dependent DNA helicase Hel308 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=hel308 PE=3 SV=1 1145 1470 4.0E-18
sp|O18475|DPOLQ_DROME DNA polymerase theta OS=Drosophila melanogaster GN=mus308 PE=1 SV=1 300 705 1.0E-17
sp|Q23223|MTR4_CAEEL mRNA transport homolog 4 OS=Caenorhabditis elegans GN=mtr-4 PE=3 SV=1 1103 1524 1.0E-16
sp|Q58796|Y1401_METJA Probable ATP-dependent helicase MJ1401 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1401 PE=3 SV=1 1145 1526 1.0E-16
sp|Q914M3|Y007_SIFVH Putative helicase 7 OS=Sulfolobus islandicus filamentous virus (isolate Iceland/Hveragerdi) GN=SIFV0007 PE=3 SV=1 1143 1579 7.0E-16
sp|Q9ZBD8|HELY_MYCLE Probable helicase HelY OS=Mycobacterium leprae (strain TN) GN=helY PE=3 SV=1 266 683 3.0E-14
sp|Q58796|Y1401_METJA Probable ATP-dependent helicase MJ1401 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1401 PE=3 SV=1 278 679 3.0E-14
sp|Q57742|HELX_METJA Uncharacterized ATP-dependent helicase MJ0294 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0294 PE=3 SV=1 299 642 9.0E-13
sp|P30015|LHR_ECOLI Probable ATP-dependent helicase lhr OS=Escherichia coli (strain K12) GN=lhr PE=3 SV=2 1146 1578 1.0E-12
sp|O59801|SKI2_SCHPO Putative ATP-dependent RNA helicase C550.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC550.03c PE=3 SV=1 535 715 3.0E-12
sp|P35207|SKI2_YEAST Antiviral helicase SKI2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKI2 PE=1 SV=2 1373 1524 1.0E-10
sp|F4JAA5|SKI2_ARATH DExH-box ATP-dependent RNA helicase DExH11 OS=Arabidopsis thaliana GN=SKI2 PE=1 SV=1 1424 1527 3.0E-10
sp|P30015|LHR_ECOLI Probable ATP-dependent helicase lhr OS=Escherichia coli (strain K12) GN=lhr PE=3 SV=2 277 671 4.0E-10
sp|F4JAA5|SKI2_ARATH DExH-box ATP-dependent RNA helicase DExH11 OS=Arabidopsis thaliana GN=SKI2 PE=1 SV=1 588 697 4.0E-10
sp|P95949|HELX_SULSO Uncharacterized ATP-dependent helicase SSO0112 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=SSO0112 PE=3 SV=1 296 671 4.0E-10
sp|B9DFG3|ISE2_ARATH DExH-box ATP-dependent RNA helicase DExH15 chloroplastic OS=Arabidopsis thaliana GN=ISE2 PE=1 SV=2 1159 1354 5.0E-10
sp|Q8IY21|DDX60_HUMAN Probable ATP-dependent RNA helicase DDX60 OS=Homo sapiens GN=DDX60 PE=1 SV=3 553 672 1.0E-09
sp|Q57742|HELX_METJA Uncharacterized ATP-dependent helicase MJ0294 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0294 PE=3 SV=1 1132 1319 2.0E-09
sp|P35207|SKI2_YEAST Antiviral helicase SKI2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKI2 PE=1 SV=2 535 683 1.0E-08
sp|Q5H9U9|DDX6L_HUMAN Probable ATP-dependent RNA helicase DDX60-like OS=Homo sapiens GN=DDX60L PE=2 SV=2 582 672 2.0E-08
sp|B9DFG3|ISE2_ARATH DExH-box ATP-dependent RNA helicase DExH15 chloroplastic OS=Arabidopsis thaliana GN=ISE2 PE=1 SV=2 1373 1515 3.0E-08
sp|B9DFG3|ISE2_ARATH DExH-box ATP-dependent RNA helicase DExH15 chloroplastic OS=Arabidopsis thaliana GN=ISE2 PE=1 SV=2 592 686 8.0E-08
sp|P9WMR1|HELY_MYCTU Probable helicase HelY OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=helY PE=1 SV=1 294 502 1.0E-07
sp|P9WMR1|HELY_MYCTU Probable helicase HelY OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=helY PE=1 SV=1 587 672 1.0E-07
sp|P9WMR0|HELY_MYCTO Probable helicase HelY OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=helY PE=3 SV=1 294 502 1.0E-07
sp|P9WMR0|HELY_MYCTO Probable helicase HelY OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=helY PE=3 SV=1 587 672 1.0E-07
sp|Q8IY21|DDX60_HUMAN Probable ATP-dependent RNA helicase DDX60 OS=Homo sapiens GN=DDX60 PE=1 SV=3 1165 1319 1.0E-07
sp|Q9P7T8|YIW2_SCHPO Uncharacterized helicase C694.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC694.02 PE=3 SV=1 1426 1515 1.0E-07
sp|Q54XN7|Y8827_DICDI Uncharacterized helicase DDB_G0278827 OS=Dictyostelium discoideum GN=DDB_G0278827 PE=3 SV=1 1418 1515 1.0E-07
sp|P47047|MTR4_YEAST ATP-dependent RNA helicase DOB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MTR4 PE=1 SV=1 1160 1345 2.0E-07
sp|O27830|HELX_METTH Uncharacterized ATP-dependent helicase MTH_1802 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=MTH_1802 PE=3 SV=1 1156 1324 2.0E-07
sp|P47047|MTR4_YEAST ATP-dependent RNA helicase DOB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MTR4 PE=1 SV=1 1428 1517 3.0E-07
sp|Q9P7T8|YIW2_SCHPO Uncharacterized helicase C694.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC694.02 PE=3 SV=1 574 679 3.0E-07
sp|Q09475|YP93_CAEEL Uncharacterized helicase C28H8.3 OS=Caenorhabditis elegans GN=C28H8.3 PE=3 SV=2 566 679 3.0E-07
sp|Q09475|YP93_CAEEL Uncharacterized helicase C28H8.3 OS=Caenorhabditis elegans GN=C28H8.3 PE=3 SV=2 1431 1515 4.0E-07
sp|P95949|HELX_SULSO Uncharacterized ATP-dependent helicase SSO0112 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=SSO0112 PE=3 SV=1 1160 1507 5.0E-07
sp|Q8IY21|DDX60_HUMAN Probable ATP-dependent RNA helicase DDX60 OS=Homo sapiens GN=DDX60 PE=1 SV=3 1406 1520 5.0E-07
sp|O59801|SKI2_SCHPO Putative ATP-dependent RNA helicase C550.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC550.03c PE=3 SV=1 348 505 1.0E-06
sp|A6RIS1|MPH1_BOTFB ATP-dependent DNA helicase MPH1 OS=Botryotinia fuckeliana (strain B05.10) GN=mph1 PE=3 SV=2 1135 1276 6.0E-06
sp|Q2HG76|MPH1_CHAGB ATP-dependent DNA helicase MPH1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=MPH1 PE=3 SV=1 1088 1323 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:0005524 ATP binding Yes
GO:0016787 hydrolase activity Yes
GO:0003677 DNA binding Yes
GO:0017076 purine nucleotide binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0032553 ribonucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0043168 anion binding No
GO:0097159 organic cyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0030554 adenyl nucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup192
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4223
Ophiocordyceps australis 1348a (Ghana) OphauG2|5437
Ophiocordyceps australis map64 (Brazil) OphauB2|1852
Ophiocordyceps australis map64 (Brazil) OphauB2|3897 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|04109
Ophiocordyceps camponoti-floridani Ophcf2|04554
Ophiocordyceps camponoti-rufipedis Ophun1|4478
Ophiocordyceps camponoti-rufipedis Ophun1|5490
Ophiocordyceps kimflemingae Ophio5|8406
Ophiocordyceps kimflemingae Ophio5|858
Ophiocordyceps subramaniannii Hirsu2|6747
Ophiocordyceps subramaniannii Hirsu2|7043

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3897
MASNDLAVAEEQWRMQFAAMQKALAELNLTSSEPSANLYDEYDEDDDDTITSSSPRGEGYDVWDFISDDDDDNGL
DDSCSSSGSGVVDADASLGHGTDWFSARCSALANKNGLAPDVLQTQVVGVLTSGASDDELQAQLADLIGFDDLDF
VIQVLSRKDQIAAAASASPGPANGQPRLLNKAQRQEALYRQDAQHKNAALLPSYSKEPQYPHVYRAYTAGNSLSA
TGKKYGLPAGSERLQFEKYEEYFIPAGKKGTLGAKEKLVRIADLDGLCRRTFKGYKSLNRMQSLVYPVAYKSSEN
MLICAPTGAGKTDAAMLTILHTIGQYTVPKPGEEVGAVDFAVNVQEFKIVYVAPMKALAAEVTEKLGKRLAWLGI
KCREYTGDMQLTKSEIVQTQIIVTTPEKWDVVTRKGTGDTELVQKVRLLIIDEVHMLHDERGAVLESLVARTQRQ
VESTQSLIRIIGLSATLPNYVDVADFLRVNRYAGLFYFDASFRPVPLEQHFIGVKGKTGSKQCKENLDTVAFEKV
KQMLEREHQVMVFVHSRKDTMASAKMLDQKAMEQMCSSLFDPSGHPKYEQAARDMKTSRSKEIRQLLAKGLGIHH
AGMARADRNLMERLFGEGVIKVLCCTATLAWGVNLPAAAVVIKGTQVYSAQEGKFVDLGILDVLQIFGRAGRPQF
EDTGIGMICTSQDRLQHYLRAVTEQQPIESRFSAKLVDNVNAEIALGTVTSIADAVQWIGYSYLFVRMQRSPTTY
GIEWAEIRDDPELVQRRRQLAEQAARTLQQCQMIVWNERSDELRSKDIGRIASQYYILHTSIQIFNSMMRPQATE
ADVFKMLSMSGEFDNVQSRDNEAKELMRLRHDVVPCDVAGGIDTPQCKTNLLLQAYVSRQQLDDFALSNDMNYVA
QQSGRICRALFMLALNRRWGHQCLVLLTLCKSIERRIWPFEHPLHQFELAKPILNQLDAREGLTVEAMRDMEPAE
IGALVHNHGAGIKIAKLLHHFPTVHVEADMAPLNRDVLRIKLHLSADFGWRDQIHGASESFWIWVENSDTGDIYH
YEFWILSRRKLHDAHELNFCIPLADPLPTQIYVRAVSDRWLGAETVTAVSFQHLIRPDTESVYTELLKLQPLPIG
ALQNAQLEEVYAPRFGFFNPMQTQIFHTLYHTPANVLLGSPTGSGKTVAAELAMWWAFRERPGSKVVYIAPMKAL
VRERVKDWGERLARPLGLRLVELTGDQTPDRRSIEEADIMVTTPEKWDGISRAWQSRGYVRQVSLVIIDEIHLLA
GDRGPILEIIVSRMNFIASTTKQAVRLVGMSTAVANASDLANWLGVKHGLFNFRHSVRPVPLELYIDGFPETRGF
CPLMQSMNRPTFVAIKKHSPSKPVIVFVASRRQTRLTAKDLINFCAIEDNPRRFVAMDEDELQLHLVRAKDDALK
EALSFGIGLHHAGLVESDRQLAEELFVANKIQILVATSTLAWGVNLPAHLVVVKGTQFYDAKTEAYKDMDLTDVL
QMLGRAGRPQFDTSGVARIFTQDAKKDFYKHFLHTGFPVESLLHTVLANHLCAEIAAQTIATKQDALDYLTWTFF
FRRLLKNPCYYGLELTAEEHGSAAAAQQAANDYMVELVDEAVRELVLSGCVEEWCPGELGATPLGQVVSFYYLDH
KTVRSLVARARTHKRREDDEVVVAFGDVVASVCLAAEYDELPVRHNEEAINAALADALPLPTSLMSCNSASTRTT
MTKEKEEEEEDATTTTTTTTDLPLWDAHVKAFLLLQAHFSRVELPISDYVGDQTSVLDQAVRIVQAAIDVV*
Coding >OphauB2|3897
ATGGCGTCGAATGACTTGGCTGTTGCAGAGGAGCAATGGAGGATGCAGTTTGCTGCCATGCAAAAAGCACTGGCA
GAGCTAAATCTAACGTCCTCGGAGCCATCAGCCAACCTCTACGATGAATACGATGAGGACGACGACGACACGATT
ACCTCTTCTTCTCCCCGAGGCGAAGGATACGACGTCTGGGACTTTATATCCGACGACGACGACGACAATGGCCTG
GACGACTCGTGCAGCAGCAGCGGGTCTGGAGTTGTCGACGCAGACGCATCTCTGGGCCATGGCACAGACTGGTTT
TCAGCCAGGTGCTCTGCCCTGGCAAACAAGAATGGCCTTGCACCAGACGTGCTGCAGACACAAGTCGTTGGTGTC
TTGACCTCGGGGGCCTCGGACGATGAGCTACAAGCCCAACTTGCAGACTTGATTGGCTTTGACGACCTCGACTTT
GTCATTCAAGTCTTGTCGCGCAAGGATCAAATCGCTGCTGCCGCGTCTGCTTCTCCTGGGCCAGCAAATGGCCAG
CCCCGGCTCTTGAACAAGGCCCAGCGCCAAGAGGCTCTGTACCGACAAGATGCACAGCACAAGAATGCGGCACTC
TTGCCAAGCTACTCCAAGGAGCCGCAGTACCCCCACGTCTATCGAGCATACACTGCAGGCAACTCGCTAAGCGCT
ACGGGCAAAAAGTACGGCCTGCCAGCCGGCAGCGAGCGGCTGCAATTTGAAAAGTATGAAGAGTATTTTATTCCT
GCCGGGAAAAAGGGCACGCTTGGAGCCAAGGAGAAGCTGGTGCGCATTGCAGACCTGGATGGGCTCTGCAGAAGG
ACTTTCAAGGGCTACAAGTCGCTCAATCGGATGCAGAGCCTCGTGTATCCCGTGGCGTACAAGTCGAGCGAAAAC
ATGCTCATTTGTGCACCCACTGGTGCGGGTAAAACAGATGCGGCAATGCTCACCATTTTGCACACGATTGGACAG
TACACTGTGCCGAAGCCTGGGGAGGAGGTTGGGGCCGTCGACTTTGCAGTCAATGTGCAAGAGTTCAAAATCGTC
TACGTTGCGCCCATGAAGGCCCTGGCGGCCGAAGTGACGGAGAAGCTGGGCAAGCGGCTGGCGTGGCTGGGCATC
AAGTGCCGCGAGTACACGGGAGACATGCAGCTGACCAAGTCGGAGATTGTGCAGACGCAAATCATTGTGACGACG
CCCGAGAAGTGGGACGTGGTGACGAGAAAGGGCACGGGCGACACGGAGCTGGTGCAAAAGGTGCGGCTGCTCATT
ATTGACGAGGTGCACATGCTTCACGACGAGCGAGGCGCGGTGCTGGAGTCGCTGGTGGCGCGCACCCAGAGACAG
GTGGAAAGCACGCAGTCGCTCATTCGCATCATTGGGCTGAGCGCGACGCTGCCAAACTATGTGGATGTGGCCGAC
TTTCTCCGGGTCAACCGGTACGCGGGCCTCTTTTACTTTGATGCGTCGTTTCGCCCTGTGCCTCTGGAGCAGCAC
TTTATCGGCGTCAAGGGCAAGACGGGGTCCAAGCAGTGCAAGGAGAATTTAGACACGGTGGCGTTTGAAAAGGTC
AAGCAGATGCTGGAGCGAGAGCACCAAGTCATGGTTTTTGTGCACTCGCGCAAAGATACCATGGCCAGCGCCAAG
ATGCTGGACCAAAAGGCCATGGAGCAAATGTGCTCGAGTCTCTTTGATCCGAGCGGCCATCCCAAGTACGAGCAA
GCGGCACGCGACATGAAGACGTCGCGGTCCAAGGAGATTCGGCAGCTGCTGGCCAAGGGCCTGGGCATACACCAT
GCAGGCATGGCCCGGGCAGACCGCAATCTGATGGAGCGGCTCTTTGGCGAGGGCGTCATCAAGGTGCTTTGCTGC
ACGGCGACGCTGGCGTGGGGCGTCAACCTGCCGGCGGCGGCGGTTGTCATCAAGGGGACGCAGGTGTACAGCGCG
CAAGAGGGCAAGTTTGTCGACCTGGGCATCCTCGACGTGCTGCAAATCTTTGGGCGTGCCGGACGACCGCAGTTT
GAGGACACGGGCATTGGCATGATTTGCACGAGCCAGGACCGGCTGCAGCACTACCTAAGAGCGGTGACGGAGCAG
CAGCCGATTGAGTCGAGGTTCTCGGCCAAGCTGGTGGACAATGTCAATGCGGAGATTGCGCTGGGCACCGTGACG
TCGATTGCGGACGCGGTGCAGTGGATTGGCTACTCGTATCTCTTTGTGCGCATGCAGCGGAGCCCGACAACATAT
GGCATCGAGTGGGCCGAGATTCGCGACGACCCCGAGCTGGTGCAGCGGCGACGGCAGCTGGCAGAGCAGGCGGCG
CGGACGCTGCAGCAGTGCCAGATGATTGTGTGGAACGAGAGGAGCGACGAGCTGCGCAGCAAGGACATTGGGCGC
ATCGCCAGCCAGTACTACATTTTGCACACGAGCATCCAAATCTTCAACAGCATGATGCGGCCGCAGGCGACCGAG
GCAGACGTGTTCAAGATGCTGAGCATGAGCGGCGAGTTTGACAATGTGCAGTCGCGCGACAATGAGGCCAAGGAG
CTGATGCGTCTGCGGCACGACGTGGTGCCGTGCGACGTGGCGGGCGGCATCGACACGCCGCAGTGCAAGACGAAC
CTGCTGCTCCAGGCGTACGTGTCGCGGCAGCAGCTCGACGACTTTGCCCTCAGCAACGACATGAATTATGTGGCG
CAGCAGTCGGGGCGCATCTGCCGGGCGCTCTTTATGCTGGCTCTCAACCGGCGATGGGGCCACCAGTGCCTGGTC
TTGTTGACACTGTGCAAGTCGATTGAGCGGCGCATCTGGCCCTTTGAGCACCCGCTGCACCAGTTTGAGCTGGCC
AAGCCCATTCTCAACCAGCTGGATGCGCGCGAGGGCCTGACGGTGGAGGCGATGCGCGACATGGAGCCGGCCGAG
ATTGGTGCGCTGGTGCACAACCACGGGGCGGGCATCAAGATTGCCAAGCTGCTGCACCACTTTCCCACGGTGCAC
GTCGAGGCCGACATGGCGCCGCTTAATCGCGACGTGCTGCGCATCAAGCTGCATCTGAGCGCCGACTTTGGCTGG
CGCGACCAGATTCACGGCGCCTCCGAGTCGTTTTGGATCTGGGTGGAAAACTCGGACACGGGCGACATTTACCAT
TACGAGTTTTGGATCCTCAGCCGCCGCAAGCTGCACGACGCGCACGAGCTCAACTTTTGCATCCCGCTGGCCGAT
CCGCTGCCCACGCAAATCTATGTGCGGGCCGTGTCGGACCGGTGGCTGGGGGCGGAGACGGTGACGGCGGTATCC
TTTCAGCACCTGATTCGGCCCGACACGGAGAGCGTCTACACGGAGCTGCTCAAGCTGCAGCCGCTGCCCATTGGG
GCGCTGCAGAATGCCCAGCTGGAAGAGGTGTATGCGCCGCGCTTTGGCTTCTTCAACCCCATGCAGACGCAAATC
TTCCACACGCTCTACCACACGCCGGCCAATGTGCTGCTGGGGTCGCCGACGGGCAGCGGCAAGACGGTGGCGGCG
GAGCTGGCCATGTGGTGGGCGTTTCGCGAGCGGCCCGGGTCCAAGGTGGTGTACATTGCGCCCATGAAGGCGCTG
GTGCGCGAGCGCGTCAAGGACTGGGGCGAGCGGCTGGCGCGGCCGCTGGGCCTGAGGCTGGTGGAGCTGACGGGC
GACCAGACGCCCGACAGGCGCAGCATTGAAGAGGCCGACATCATGGTGACGACGCCCGAGAAGTGGGACGGCATA
TCGCGGGCGTGGCAGTCGCGCGGCTACGTGCGCCAAGTCAGCCTCGTTATAATTGACGAGATTCACCTGCTGGCG
GGCGACCGCGGGCCCATTTTGGAAATCATTGTGTCGCGCATGAATTTCATTGCCTCGACAACGAAGCAGGCGGTG
CGGCTGGTGGGCATGTCGACGGCGGTCGCCAACGCGTCAGACCTGGCCAACTGGCTGGGCGTCAAGCACGGCCTC
TTTAACTTTCGGCACTCGGTGCGCCCCGTGCCGCTGGAGCTCTACATTGACGGCTTCCCCGAGACGCGCGGCTTC
TGCCCCCTGATGCAGTCGATGAACCGGCCCACCTTTGTCGCCATCAAGAAGCACAGCCCCAGCAAGCCCGTCATT
GTCTTTGTGGCGTCGCGCCGGCAGACGCGGCTGACGGCCAAGGACCTCATCAACTTTTGCGCCATTGAGGACAAT
CCGCGGCGCTTTGTCGCCATGGACGAGGACGAGCTGCAGCTGCACCTGGTGCGCGCCAAGGACGACGCGCTCAAG
GAGGCGCTGAGCTTTGGCATTGGCCTGCACCACGCCGGCCTGGTAGAGTCGGACCGCCAGCTGGCCGAGGAGCTC
TTTGTGGCCAACAAGATTCAGATCCTCGTGGCCACGAGCACGCTGGCCTGGGGCGTCAACCTGCCGGCGCACCTG
GTGGTGGTCAAGGGCACGCAGTTTTACGATGCCAAGACGGAGGCCTACAAGGACATGGACCTGACGGATGTGCTG
CAGATGCTTGGCCGCGCCGGCCGGCCGCAGTTTGACACGTCTGGCGTGGCGCGCATTTTTACCCAAGACGCCAAG
AAGGACTTTTACAAGCACTTTTTGCACACGGGCTTTCCCGTCGAGTCGCTGCTGCACACTGTGCTTGCCAACCAC
TTGTGCGCCGAGATTGCCGCGCAGACGATTGCCACCAAGCAAGACGCGCTCGACTACCTGACGTGGACCTTTTTC
TTTAGGCGGCTCCTCAAGAACCCCTGCTACTATGGGCTGGAGCTGACGGCCGAGGAGCACGGCAGCGCGGCGGCG
GCGCAGCAGGCGGCAAACGACTACATGGTTGAGCTGGTGGACGAGGCGGTGCGCGAGCTGGTGCTGTCGGGGTGT
GTCGAGGAGTGGTGCCCGGGCGAGCTTGGAGCGACGCCGCTGGGCCAAGTGGTTAGTTTTTACTACCTCGATCAC
AAGACGGTGCGCAGCCTGGTGGCGCGGGCGCGGACGCATAAGAGGAGGGAGGACGACGAGGTGGTGGTGGCGTTT
GGCGACGTGGTGGCGAGTGTGTGCTTGGCGGCCGAGTATGACGAGTTGCCGGTGCGGCATAACGAGGAGGCAATT
AATGCGGCGCTGGCGGATGCGCTGCCGCTGCCGACGAGTTTGATGTCTTGCAACTCTGCCTCGACAAGGACGACG
ATGACGAAGGAGAAGGAGGAGGAGGAGGAGGATGCCACGACGACGACGACGACGACGACAGACTTGCCGCTGTGG
GACGCACACGTCAAGGCCTTTTTGCTGCTGCAGGCACACTTTTCGCGCGTCGAGCTGCCCATTTCAGACTATGTG
GGCGACCAGACGAGCGTGCTGGACCAGGCGGTGCGGATTGTGCAGGCGGCCATTGACGTAGTGTAA
Transcript >OphauB2|3897
ATGGCGTCGAATGACTTGGCTGTTGCAGAGGAGCAATGGAGGATGCAGTTTGCTGCCATGCAAAAAGCACTGGCA
GAGCTAAATCTAACGTCCTCGGAGCCATCAGCCAACCTCTACGATGAATACGATGAGGACGACGACGACACGATT
ACCTCTTCTTCTCCCCGAGGCGAAGGATACGACGTCTGGGACTTTATATCCGACGACGACGACGACAATGGCCTG
GACGACTCGTGCAGCAGCAGCGGGTCTGGAGTTGTCGACGCAGACGCATCTCTGGGCCATGGCACAGACTGGTTT
TCAGCCAGGTGCTCTGCCCTGGCAAACAAGAATGGCCTTGCACCAGACGTGCTGCAGACACAAGTCGTTGGTGTC
TTGACCTCGGGGGCCTCGGACGATGAGCTACAAGCCCAACTTGCAGACTTGATTGGCTTTGACGACCTCGACTTT
GTCATTCAAGTCTTGTCGCGCAAGGATCAAATCGCTGCTGCCGCGTCTGCTTCTCCTGGGCCAGCAAATGGCCAG
CCCCGGCTCTTGAACAAGGCCCAGCGCCAAGAGGCTCTGTACCGACAAGATGCACAGCACAAGAATGCGGCACTC
TTGCCAAGCTACTCCAAGGAGCCGCAGTACCCCCACGTCTATCGAGCATACACTGCAGGCAACTCGCTAAGCGCT
ACGGGCAAAAAGTACGGCCTGCCAGCCGGCAGCGAGCGGCTGCAATTTGAAAAGTATGAAGAGTATTTTATTCCT
GCCGGGAAAAAGGGCACGCTTGGAGCCAAGGAGAAGCTGGTGCGCATTGCAGACCTGGATGGGCTCTGCAGAAGG
ACTTTCAAGGGCTACAAGTCGCTCAATCGGATGCAGAGCCTCGTGTATCCCGTGGCGTACAAGTCGAGCGAAAAC
ATGCTCATTTGTGCACCCACTGGTGCGGGTAAAACAGATGCGGCAATGCTCACCATTTTGCACACGATTGGACAG
TACACTGTGCCGAAGCCTGGGGAGGAGGTTGGGGCCGTCGACTTTGCAGTCAATGTGCAAGAGTTCAAAATCGTC
TACGTTGCGCCCATGAAGGCCCTGGCGGCCGAAGTGACGGAGAAGCTGGGCAAGCGGCTGGCGTGGCTGGGCATC
AAGTGCCGCGAGTACACGGGAGACATGCAGCTGACCAAGTCGGAGATTGTGCAGACGCAAATCATTGTGACGACG
CCCGAGAAGTGGGACGTGGTGACGAGAAAGGGCACGGGCGACACGGAGCTGGTGCAAAAGGTGCGGCTGCTCATT
ATTGACGAGGTGCACATGCTTCACGACGAGCGAGGCGCGGTGCTGGAGTCGCTGGTGGCGCGCACCCAGAGACAG
GTGGAAAGCACGCAGTCGCTCATTCGCATCATTGGGCTGAGCGCGACGCTGCCAAACTATGTGGATGTGGCCGAC
TTTCTCCGGGTCAACCGGTACGCGGGCCTCTTTTACTTTGATGCGTCGTTTCGCCCTGTGCCTCTGGAGCAGCAC
TTTATCGGCGTCAAGGGCAAGACGGGGTCCAAGCAGTGCAAGGAGAATTTAGACACGGTGGCGTTTGAAAAGGTC
AAGCAGATGCTGGAGCGAGAGCACCAAGTCATGGTTTTTGTGCACTCGCGCAAAGATACCATGGCCAGCGCCAAG
ATGCTGGACCAAAAGGCCATGGAGCAAATGTGCTCGAGTCTCTTTGATCCGAGCGGCCATCCCAAGTACGAGCAA
GCGGCACGCGACATGAAGACGTCGCGGTCCAAGGAGATTCGGCAGCTGCTGGCCAAGGGCCTGGGCATACACCAT
GCAGGCATGGCCCGGGCAGACCGCAATCTGATGGAGCGGCTCTTTGGCGAGGGCGTCATCAAGGTGCTTTGCTGC
ACGGCGACGCTGGCGTGGGGCGTCAACCTGCCGGCGGCGGCGGTTGTCATCAAGGGGACGCAGGTGTACAGCGCG
CAAGAGGGCAAGTTTGTCGACCTGGGCATCCTCGACGTGCTGCAAATCTTTGGGCGTGCCGGACGACCGCAGTTT
GAGGACACGGGCATTGGCATGATTTGCACGAGCCAGGACCGGCTGCAGCACTACCTAAGAGCGGTGACGGAGCAG
CAGCCGATTGAGTCGAGGTTCTCGGCCAAGCTGGTGGACAATGTCAATGCGGAGATTGCGCTGGGCACCGTGACG
TCGATTGCGGACGCGGTGCAGTGGATTGGCTACTCGTATCTCTTTGTGCGCATGCAGCGGAGCCCGACAACATAT
GGCATCGAGTGGGCCGAGATTCGCGACGACCCCGAGCTGGTGCAGCGGCGACGGCAGCTGGCAGAGCAGGCGGCG
CGGACGCTGCAGCAGTGCCAGATGATTGTGTGGAACGAGAGGAGCGACGAGCTGCGCAGCAAGGACATTGGGCGC
ATCGCCAGCCAGTACTACATTTTGCACACGAGCATCCAAATCTTCAACAGCATGATGCGGCCGCAGGCGACCGAG
GCAGACGTGTTCAAGATGCTGAGCATGAGCGGCGAGTTTGACAATGTGCAGTCGCGCGACAATGAGGCCAAGGAG
CTGATGCGTCTGCGGCACGACGTGGTGCCGTGCGACGTGGCGGGCGGCATCGACACGCCGCAGTGCAAGACGAAC
CTGCTGCTCCAGGCGTACGTGTCGCGGCAGCAGCTCGACGACTTTGCCCTCAGCAACGACATGAATTATGTGGCG
CAGCAGTCGGGGCGCATCTGCCGGGCGCTCTTTATGCTGGCTCTCAACCGGCGATGGGGCCACCAGTGCCTGGTC
TTGTTGACACTGTGCAAGTCGATTGAGCGGCGCATCTGGCCCTTTGAGCACCCGCTGCACCAGTTTGAGCTGGCC
AAGCCCATTCTCAACCAGCTGGATGCGCGCGAGGGCCTGACGGTGGAGGCGATGCGCGACATGGAGCCGGCCGAG
ATTGGTGCGCTGGTGCACAACCACGGGGCGGGCATCAAGATTGCCAAGCTGCTGCACCACTTTCCCACGGTGCAC
GTCGAGGCCGACATGGCGCCGCTTAATCGCGACGTGCTGCGCATCAAGCTGCATCTGAGCGCCGACTTTGGCTGG
CGCGACCAGATTCACGGCGCCTCCGAGTCGTTTTGGATCTGGGTGGAAAACTCGGACACGGGCGACATTTACCAT
TACGAGTTTTGGATCCTCAGCCGCCGCAAGCTGCACGACGCGCACGAGCTCAACTTTTGCATCCCGCTGGCCGAT
CCGCTGCCCACGCAAATCTATGTGCGGGCCGTGTCGGACCGGTGGCTGGGGGCGGAGACGGTGACGGCGGTATCC
TTTCAGCACCTGATTCGGCCCGACACGGAGAGCGTCTACACGGAGCTGCTCAAGCTGCAGCCGCTGCCCATTGGG
GCGCTGCAGAATGCCCAGCTGGAAGAGGTGTATGCGCCGCGCTTTGGCTTCTTCAACCCCATGCAGACGCAAATC
TTCCACACGCTCTACCACACGCCGGCCAATGTGCTGCTGGGGTCGCCGACGGGCAGCGGCAAGACGGTGGCGGCG
GAGCTGGCCATGTGGTGGGCGTTTCGCGAGCGGCCCGGGTCCAAGGTGGTGTACATTGCGCCCATGAAGGCGCTG
GTGCGCGAGCGCGTCAAGGACTGGGGCGAGCGGCTGGCGCGGCCGCTGGGCCTGAGGCTGGTGGAGCTGACGGGC
GACCAGACGCCCGACAGGCGCAGCATTGAAGAGGCCGACATCATGGTGACGACGCCCGAGAAGTGGGACGGCATA
TCGCGGGCGTGGCAGTCGCGCGGCTACGTGCGCCAAGTCAGCCTCGTTATAATTGACGAGATTCACCTGCTGGCG
GGCGACCGCGGGCCCATTTTGGAAATCATTGTGTCGCGCATGAATTTCATTGCCTCGACAACGAAGCAGGCGGTG
CGGCTGGTGGGCATGTCGACGGCGGTCGCCAACGCGTCAGACCTGGCCAACTGGCTGGGCGTCAAGCACGGCCTC
TTTAACTTTCGGCACTCGGTGCGCCCCGTGCCGCTGGAGCTCTACATTGACGGCTTCCCCGAGACGCGCGGCTTC
TGCCCCCTGATGCAGTCGATGAACCGGCCCACCTTTGTCGCCATCAAGAAGCACAGCCCCAGCAAGCCCGTCATT
GTCTTTGTGGCGTCGCGCCGGCAGACGCGGCTGACGGCCAAGGACCTCATCAACTTTTGCGCCATTGAGGACAAT
CCGCGGCGCTTTGTCGCCATGGACGAGGACGAGCTGCAGCTGCACCTGGTGCGCGCCAAGGACGACGCGCTCAAG
GAGGCGCTGAGCTTTGGCATTGGCCTGCACCACGCCGGCCTGGTAGAGTCGGACCGCCAGCTGGCCGAGGAGCTC
TTTGTGGCCAACAAGATTCAGATCCTCGTGGCCACGAGCACGCTGGCCTGGGGCGTCAACCTGCCGGCGCACCTG
GTGGTGGTCAAGGGCACGCAGTTTTACGATGCCAAGACGGAGGCCTACAAGGACATGGACCTGACGGATGTGCTG
CAGATGCTTGGCCGCGCCGGCCGGCCGCAGTTTGACACGTCTGGCGTGGCGCGCATTTTTACCCAAGACGCCAAG
AAGGACTTTTACAAGCACTTTTTGCACACGGGCTTTCCCGTCGAGTCGCTGCTGCACACTGTGCTTGCCAACCAC
TTGTGCGCCGAGATTGCCGCGCAGACGATTGCCACCAAGCAAGACGCGCTCGACTACCTGACGTGGACCTTTTTC
TTTAGGCGGCTCCTCAAGAACCCCTGCTACTATGGGCTGGAGCTGACGGCCGAGGAGCACGGCAGCGCGGCGGCG
GCGCAGCAGGCGGCAAACGACTACATGGTTGAGCTGGTGGACGAGGCGGTGCGCGAGCTGGTGCTGTCGGGGTGT
GTCGAGGAGTGGTGCCCGGGCGAGCTTGGAGCGACGCCGCTGGGCCAAGTGGTTAGTTTTTACTACCTCGATCAC
AAGACGGTGCGCAGCCTGGTGGCGCGGGCGCGGACGCATAAGAGGAGGGAGGACGACGAGGTGGTGGTGGCGTTT
GGCGACGTGGTGGCGAGTGTGTGCTTGGCGGCCGAGTATGACGAGTTGCCGGTGCGGCATAACGAGGAGGCAATT
AATGCGGCGCTGGCGGATGCGCTGCCGCTGCCGACGAGTTTGATGTCTTGCAACTCTGCCTCGACAAGGACGACG
ATGACGAAGGAGAAGGAGGAGGAGGAGGAGGATGCCACGACGACGACGACGACGACGACAGACTTGCCGCTGTGG
GACGCACACGTCAAGGCCTTTTTGCTGCTGCAGGCACACTTTTCGCGCGTCGAGCTGCCCATTTCAGACTATGTG
GGCGACCAGACGAGCGTGCTGGACCAGGCGGTGCGGATTGTGCAGGCGGCCATTGACGTAGTGTAA
Gene >OphauB2|3897
ATGGCGTCGAATGACTTGGCTGTTGCAGAGGAGCAATGGAGGATGCAGTTTGCTGCCATGCAAAAAGCACTGGCA
GAGCTAAATCTAACGTCCTCGGAGCCATCAGCCAACCTCTACGATGAATACGATGAGGACGACGACGACACGATT
ACCTCTTCTTCTCCCCGAGGCGAAGGATACGACGTCTGGGACTTTATATCCGACGACGACGACGACAATGGCCTG
GACGACTCGTGCAGCAGCAGCGGGTCTGGAGTTGTCGACGCAGACGCATCTCTGGGCCATGGCACAGACTGGTTT
TCAGCCAGGTGCTCTGCCCTGGCAAACAAGAATGGCCTTGCACCAGACGTGCTGCAGACACAAGTCGTTGGTGTC
TTGACCTCGGGGGCCTCGGACGATGAGCTACAAGCCCAACTTGCAGACTTGATTGGCTTTGACGACCTCGACTTT
GTCATTCAAGTCTTGTCGCGCAAGGATCAAATCGCTGCTGCCGCGTCTGCTTCTCCTGGGCCAGCAAATGGCCAG
CCCCGGCTCTTGAACAAGGCCCAGCGCCAAGAGGCTCTGTACCGACAAGATGCACAGCACAAGAATGCGGCACTC
TTGCCAAGCTACTCCAAGGAGCCGCAGTACCCCCACGTCTATCGAGCATACACTGCAGGCAACTCGCTAAGCGCT
ACGGGCAAAAAGTACGGCCTGCCAGCCGGCAGCGAGCGGCTGCAATTTGAAAAGTATGAAGAGTATTTTATTCCT
GCCGGGAAAAAGGGCACGCTTGGAGCCAAGGAGAAGCTGGTGCGCATTGCAGACCTGGATGGGCTCTGCAGAAGG
ACTTTCAAGGGCTACAAGTCGCTCAATCGGATGCAGAGCCTCGTGTATCCCGTGGCGTACAAGTCGAGCGAAAAC
ATGCTCATTTGTGCACCCACTGGTGCGGTGCGTTGATGCCCGTGCCATGGCCCTAGCACTCGGGCTGGTTCATGA
CAAGTGCTGATGCAAGAAAATGGCCTTGTACAGGGTAAAACAGATGCGGCAATGCTCACCATTTTGCACACGATT
GGACAGTACACTGTGCCGAAGCCTGGGGAGGAGGTTGGGGCCGTCGACTTTGCAGTCAATGTGCAAGAGTTCAAA
ATCGTCTACGTTGCGCCCATGAAGGCCCTGGCGGCCGAAGTGACGGAGAAGCTGGGCAAGCGGCTGGCGTGGCTG
GGCATCAAGTGCCGCGAGTACACGGGAGACATGCAGCTGACCAAGTCGGAGATTGTGCAGACGCAAATCATTGTG
ACGACGCCCGAGAAGTGGGACGTGGTGACGAGAAAGGGCACGGGCGACACGGAGCTGGTGCAAAAGGTGCGGCTG
CTCATTATTGACGAGGTGCACATGCTTCACGACGAGCGAGGCGCGGTGCTGGAGTCGCTGGTGGCGCGCACCCAG
AGACAGGTGGAAAGCACGCAGTCGCTCATTCGCATCATTGGGCTGAGCGCGACGCTGCCAAACTATGTGGATGTG
GCCGACTTTCTCCGGGTCAACCGGTACGCGGGCCTCTTTTACTTTGATGCGTCGTTTCGCCCTGTGCCTCTGGAG
CAGCACTTTATCGGCGTCAAGGGCAAGACGGGGTCCAAGCAGTGCAAGGAGAATTTAGACACGGTGGCGTTTGAA
AAGGTCAAGCAGATGCTGGAGCGAGAGCACCAAGTCATGGTTTTTGTGCACTCGCGCAAAGATACCATGGCCAGC
GCCAAGATGCTGGACCAAAAGGCCATGGAGCAAATGTGCTCGAGTCTCTTTGATCCGAGCGGCCATCCCAAGTAC
GAGCAAGCGGCACGCGACATGAAGACGTCGCGGTCCAAGGAGATTCGGCAGCTGCTGGCCAAGGGCCTGGGCATA
CACCATGCAGGCATGGCCCGGGCAGACCGCAATCTGATGGAGCGGCTCTTTGGCGAGGGCGTCATCAAGGTGCTT
TGCTGCACGGCGACGCTGGCGTGGGGCGTCAACCTGCCGGCGGCGGCGGTTGTCATCAAGGGGACGCAGGTGTAC
AGCGCGCAAGAGGGCAAGTTTGTCGACCTGGGCATCCTCGACGTGCTGCAAATCTTTGGGCGTGCCGGACGACCG
CAGTTTGAGGACACGGGCATTGGCATGATTTGCACGAGCCAGGACCGGCTGCAGCACTACCTAAGAGCGGTGACG
GAGCAGCAGCCGATTGAGTCGAGGTTCTCGGCCAAGCTGGTGGACAATGTCAATGCGGAGATTGCGCTGGGCACC
GTGACGTCGATTGCGGACGCGGTGCAGTGGATTGGCTACTCGTATCTCTTTGTGCGCATGCAGCGGAGCCCGACA
ACATATGGCATCGAGTGGGCCGAGATTCGCGACGACCCCGAGCTGGTGCAGCGGCGACGGCAGCTGGCAGAGCAG
GCGGCGCGGACGCTGCAGCAGTGCCAGATGATTGTGTGGAACGAGAGGAGCGACGAGCTGCGCAGCAAGGACATT
GGGCGCATCGCCAGCCAGTACTACATTTTGCACACGAGCATCCAAATCTTCAACAGCATGATGCGGCCGCAGGCG
ACCGAGGCAGACGTGTTCAAGATGCTGAGCATGAGCGGCGAGTTTGACAATGTGCAGTCGCGCGACAATGAGGCC
AAGGAGCTGATGCGTCTGCGGCACGACGTGGTGCCGTGCGACGTGGCGGGCGGCATCGACACGCCGCAGTGCAAG
ACGAACCTGCTGCTCCAGGCGTACGTGTCGCGGCAGCAGCTCGACGACTTTGCCCTCAGCAACGACATGAATTAT
GTGGCGCAGCAGTCGGGGCGCATCTGCCGGGCGCTCTTTATGCTGGCTCTCAACCGGCGATGGGGCCACCAGTGC
CTGGTCTTGTTGACACTGTGCAAGTCGATTGAGCGGCGCATCTGGCCCTTTGAGCACCCGCTGCACCAGTTTGAG
CTGGCCAAGCCCATTCTCAACCAGCTGGATGCGCGCGAGGGCCTGACGGTGGAGGCGATGCGCGACATGGAGCCG
GCCGAGATTGGTGCGCTGGTGCACAACCACGGGGCGGGCATCAAGATTGCCAAGCTGCTGCACCACTTTCCCACG
GTGCACGTCGAGGCCGACATGGCGCCGCTTAATCGCGACGTGCTGCGCATCAAGCTGCATCTGAGCGCCGACTTT
GGCTGGCGCGACCAGATTCACGGCGCCTCCGAGTCGTTTTGGATCTGGGTGGAAAACTCGGACACGGGCGACATT
TACCATTACGAGTTTTGGATCCTCAGCCGCCGCAAGCTGCACGACGCGCACGAGCTCAACTTTTGCATCCCGCTG
GCCGATCCGCTGCCCACGCAAATCTATGTGCGGGCCGTGTCGGACCGGTGGCTGGGGGCGGAGACGGTGACGGCG
GTATCCTTTCAGCACCTGATTCGGCCCGACACGGAGAGCGTCTACACGGAGCTGCTCAAGCTGCAGCCGCTGCCC
ATTGGGGCGCTGCAGAATGCCCAGCTGGAAGAGGTGTATGCGCCGCGCTTTGGCTTCTTCAACCCCATGCAGACG
CAAATCTTCCACACGCTCTACCACACGCCGGCCAATGTGCTGCTGGGGTCGCCGACGGGCAGCGGCAAGACGGTG
GCGGCGGAGCTGGCCATGTGGTGGGCGTTTCGCGAGCGGCCCGGGTCCAAGGTGGTGTACATTGCGCCCATGAAG
GCGCTGGTGCGCGAGCGCGTCAAGGACTGGGGCGAGCGGCTGGCGCGGCCGCTGGGCCTGAGGCTGGTGGAGCTG
ACGGGCGACCAGACGCCCGACAGGCGCAGCATTGAAGAGGCCGACATCATGGTGACGACGCCCGAGAAGTGGGAC
GGCATATCGCGGGCGTGGCAGTCGCGCGGCTACGTGCGCCAAGTCAGCCTCGTTATAATTGACGAGATTCACCTG
CTGGCGGGCGACCGCGGGCCCATTTTGGAAATCATTGTGTCGCGCATGAATTTCATTGCCTCGACAACGAAGCAG
GCGGTGCGGCTGGTGGGCATGTCGACGGCGGTCGCCAACGCGTCAGACCTGGCCAACTGGCTGGGCGTCAAGCAC
GGCCTCTTTAACTTTCGGCACTCGGTGCGCCCCGTGCCGCTGGAGCTCTACATTGACGGCTTCCCCGAGACGCGC
GGCTTCTGCCCCCTGATGCAGTCGATGAACCGGCCCACCTTTGTCGCCATCAAGAAGCACAGCCCCAGCAAGCCC
GTCATTGTCTTTGTGGCGTCGCGCCGGCAGACGCGGCTGACGGCCAAGGACCTCATCAACTTTTGCGCCATTGAG
GACAATCCGCGGCGCTTTGTCGCCATGGACGAGGACGAGCTGCAGCTGCACCTGGTGCGCGCCAAGGACGACGCG
CTCAAGGAGGCGCTGAGCTTTGGCATTGGCCTGCACCACGCCGGCCTGGTAGAGTCGGACCGCCAGCTGGCCGAG
GAGCTCTTTGTGGCCAACAAGATTCAGATCCTCGTGGCCACGAGCACGCTGGCCTGGGGCGTCAACCTGCCGGCG
CACCTGGTGGTGGTCAAGGGCACGCAGTTTTACGATGCCAAGACGGAGGCCTACAAGGACATGGACCTGACGGAT
GTGCTGCAGATGCTTGGCCGCGCCGGCCGGCCGCAGTTTGACACGTCTGGCGTGGCGCGCATTTTTACCCAAGAC
GCCAAGAAGGACTTTTACAAGCACTTTTTGCACACGGGCTTTCCCGTCGAGTCGCTGCTGCACACTGTGCTTGCC
AACCACTTGTGCGCCGAGATTGCCGCGCAGACGATTGCCACCAAGCAAGACGCGCTCGACTACCTGACGTGGACC
TTTTTCTTTAGGCGGCTCCTCAAGAACCCCTGCTACTATGGGCTGGAGCTGACGGCCGAGGAGCACGGCAGCGCG
GCGGCGGCGCAGCAGGCGGCAAACGACTACATGGTTGAGCTGGTGGACGAGGCGGTGCGCGAGCTGGTGCTGTCG
GGGTGTGTCGAGGAGTGGTGCCCGGGCGAGCTTGGAGCGACGCCGCTGGGCCAAGTGGTTAGTTTTTACTACCTC
GATCACAAGACGGTGCGCAGCCTGGTGGCGCGGGCGCGGACGCATAAGAGGAGGGAGGACGACGAGGTGGTGGTG
GCGTTTGGCGACGTGGTGGCGAGTGTGTGCTTGGCGGCCGAGTATGACGAGTTGCCGGTGCGGCATAACGAGGAG
GCAATTAATGCGGCGCTGGCGGATGCGCTGCCGCTGCCGACGAGTTTGATGTCTTGCAACTCTGCCTCGACAAGG
ACGACGATGACGAAGGAGAAGGAGGAGGAGGAGGAGGATGCCACGACGACGACGACGACGACGACAGACTTGCCG
CTGTGGGACGCACACGTCAAGGCCTTTTTGCTGCTGCAGGCACACTTTTCGCGCGTCGAGCTGCCCATTTCAGAC
TATGTGGGCGACCAGACGAGCGTGCTGGACCAGGCGGTGCGGATTGTGCAGGCGGCCATTGACGTGTTTGCCGAG
CTGGGCTTGAGCGAGGCGTGTGTGCAGGCGGTGCGGCTGCTGCAGAGTGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail