Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3896
Gene name
LocationContig_25:100720..101616
Strand-
Gene length (bp)896
Transcript length (bp)594
Coding sequence length (bp)594
Protein length (aa) 198

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13774 Longin Regulated-SNARE-like domain 3.4E-14 44 120
PF00957 Synaptobrevin Synaptobrevin 4.3E-14 135 191

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O60073|YKT6_SCHPO Synaptobrevin homolog ykt6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ykt6 PE=3 SV=1 1 196 4.0E-85
sp|Q757A4|YKT6_ASHGO Synaptobrevin homolog YKT6 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=YKT6 PE=3 SV=1 1 197 4.0E-81
sp|Q6C537|YKT6_YARLI Synaptobrevin homolog YKT6 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YKT6 PE=3 SV=1 1 197 1.0E-80
sp|P36015|YKT6_YEAST Synaptobrevin homolog YKT6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YKT6 PE=1 SV=1 1 197 3.0E-79
sp|Q6FW27|YKT6_CANGA Synaptobrevin homolog YKT6 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=YKT6 PE=3 SV=1 1 197 2.0E-78
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O60073|YKT6_SCHPO Synaptobrevin homolog ykt6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ykt6 PE=3 SV=1 1 196 4.0E-85
sp|Q757A4|YKT6_ASHGO Synaptobrevin homolog YKT6 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=YKT6 PE=3 SV=1 1 197 4.0E-81
sp|Q6C537|YKT6_YARLI Synaptobrevin homolog YKT6 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YKT6 PE=3 SV=1 1 197 1.0E-80
sp|P36015|YKT6_YEAST Synaptobrevin homolog YKT6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YKT6 PE=1 SV=1 1 197 3.0E-79
sp|Q6FW27|YKT6_CANGA Synaptobrevin homolog YKT6 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=YKT6 PE=3 SV=1 1 197 2.0E-78
sp|Q6CSA2|YKT6_KLULA Synaptobrevin homolog YKT6 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=YKT6 PE=3 SV=1 1 197 1.0E-75
sp|Q6BSL0|YKT6_DEBHA Synaptobrevin homolog YKT6 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=YKT6 PE=3 SV=1 1 197 2.0E-75
sp|O15498|YKT6_HUMAN Synaptobrevin homolog YKT6 OS=Homo sapiens GN=YKT6 PE=1 SV=1 38 197 2.0E-55
sp|Q9CQW1|YKT6_MOUSE Synaptobrevin homolog YKT6 OS=Mus musculus GN=Ykt6 PE=1 SV=1 1 197 1.0E-54
sp|Q32N70|YKT6B_XENLA Synaptobrevin homolog YKT6-B OS=Xenopus laevis GN=ykt6-b PE=2 SV=1 1 197 6.0E-54
sp|Q5EGY4|YKT6_RAT Synaptobrevin homolog YKT6 OS=Rattus norvegicus GN=Ykt6 PE=1 SV=1 38 197 3.0E-53
sp|Q7ZUN8|YKT6_DANRE Synaptobrevin homolog YKT6 OS=Danio rerio GN=ykt6 PE=2 SV=1 1 197 6.0E-53
sp|Q3T000|YKT6_BOVIN Synaptobrevin homolog YKT6 OS=Bos taurus GN=YKT6 PE=2 SV=1 38 197 7.0E-53
sp|Q6DDU7|YKT6A_XENLA Synaptobrevin homolog YKT6-A OS=Xenopus laevis GN=ykt6-a PE=2 SV=1 1 197 8.0E-53
sp|Q6P816|YKT6_XENTR Synaptobrevin homolog YKT6 OS=Xenopus tropicalis GN=ykt6 PE=2 SV=1 38 197 4.0E-52
sp|Q9LVM9|YKT62_ARATH VAMP-like protein YKT62 OS=Arabidopsis thaliana GN=YKT62 PE=2 SV=1 24 197 2.0E-49
sp|Q9ZRD6|YKT61_ARATH VAMP-like protein YKT61 OS=Arabidopsis thaliana GN=YKT61 PE=2 SV=1 24 197 5.0E-49
sp|Q54ES8|YKT6_DICDI Putative synaptobrevin homolog YKT6 OS=Dictyostelium discoideum GN=ykt6 PE=1 SV=1 1 194 1.0E-37
sp|Q9Y7L0|SEC22_SCHPO Protein transport protein sec22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec22 PE=3 SV=2 44 191 4.0E-12
sp|Q4KM74|SC22B_RAT Vesicle-trafficking protein SEC22b OS=Rattus norvegicus GN=Sec22b PE=1 SV=3 56 191 2.0E-09
sp|Q5RAI9|SC22B_PONAB Vesicle-trafficking protein SEC22b OS=Pongo abelii GN=SEC22B PE=2 SV=3 56 191 2.0E-09
sp|O08547|SC22B_MOUSE Vesicle-trafficking protein SEC22b OS=Mus musculus GN=Sec22b PE=1 SV=3 56 191 2.0E-09
sp|O75396|SC22B_HUMAN Vesicle-trafficking protein SEC22b OS=Homo sapiens GN=SEC22B PE=1 SV=4 56 191 2.0E-09
sp|O08595|SC22B_CRIGR Vesicle-trafficking protein SEC22b OS=Cricetulus griseus GN=Sec22b PE=1 SV=3 65 191 3.0E-09
sp|Q5ZJW4|SC22B_CHICK Vesicle-trafficking protein SEC22b OS=Gallus gallus GN=SEC22B PE=2 SV=1 56 191 4.0E-09
sp|Q6P7L4|SC22B_XENTR Vesicle-trafficking protein SEC22b OS=Xenopus tropicalis GN=sec22b PE=2 SV=1 56 191 5.0E-09
sp|Q7SXP0|S22BB_DANRE Vesicle-trafficking protein SEC22b-B OS=Danio rerio GN=sec22bb PE=2 SV=1 56 192 8.0E-09
sp|Q6C880|SEC22_YARLI Protein transport protein SEC22 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SEC22 PE=3 SV=1 56 191 8.0E-09
sp|Q94AU2|SEC22_ARATH 25.3 kDa vesicle transport protein OS=Arabidopsis thaliana GN=SEC22 PE=2 SV=1 45 196 2.0E-08
sp|Q86AQ7|VAM7B_DICDI Vesicle-associated membrane protein 7B OS=Dictyostelium discoideum GN=vamp7B PE=3 SV=1 26 189 6.0E-07
sp|Q7ZV15|S22BA_DANRE Vesicle-trafficking protein SEC22b-A OS=Danio rerio GN=sec22ba PE=2 SV=1 56 192 1.0E-06
sp|Q6FWT0|SEC22_CANGA Protein transport protein SEC22 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SEC22 PE=3 SV=1 45 191 8.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3646
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5436
Ophiocordyceps australis map64 (Brazil) OphauB2|3896 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|04110
Ophiocordyceps camponoti-rufipedis Ophun1|5489
Ophiocordyceps kimflemingae Ophio5|8407
Ophiocordyceps subramaniannii Hirsu2|7040

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3896
MKLHYIGIIRNEAKPAHEICAEKELSSYSRFTRNNYGEFMTLFAKTVAERTKPGQRQDVEEQDYTFHAYGRSEGV
CGIIISDHQYPALVAHQLLSKCVDEFLSQHPRSSWATGSPQLAMPELKDYLAKYQDPQQADSILKIQKELDETKI
VLHKTIESVLQRGEKIDDLVAKSDGLSSQSKMFYQQAKKQNSCCVLM*
Coding >OphauB2|3896
ATGAAGCTGCACTACATTGGTATTATTCGCAACGAGGCCAAGCCCGCACACGAGATATGTGCCGAAAAGGAACTG
AGCTCATATTCGCGCTTCACCCGCAACAACTATGGCGAGTTCATGACGCTCTTCGCAAAGACGGTTGCCGAGCGC
ACCAAGCCGGGCCAACGACAAGACGTTGAAGAGCAAGACTATACCTTTCACGCCTATGGCCGCTCAGAGGGCGTC
TGCGGCATCATCATTTCAGACCACCAATACCCCGCACTCGTCGCCCACCAACTCCTCAGCAAGTGTGTCGACGAG
TTCCTCTCCCAGCACCCCCGCTCCTCATGGGCCACGGGCTCGCCCCAGCTCGCCATGCCCGAGCTCAAGGACTAC
CTCGCAAAGTACCAGGACCCCCAACAGGCAGACAGCATACTCAAGATTCAAAAAGAACTCGACGAGACAAAAATC
GTTCTTCACAAGACTATTGAGAGTGTCCTTCAGCGCGGCGAGAAGATTGACGATCTCGTCGCAAAGAGCGATGGC
CTTAGCAGCCAGAGCAAGATGTTTTACCAGCAAGCCAAGAAGCAAAATTCCTGCTGTGTCTTGATGTGA
Transcript >OphauB2|3896
ATGAAGCTGCACTACATTGGTATTATTCGCAACGAGGCCAAGCCCGCACACGAGATATGTGCCGAAAAGGAACTG
AGCTCATATTCGCGCTTCACCCGCAACAACTATGGCGAGTTCATGACGCTCTTCGCAAAGACGGTTGCCGAGCGC
ACCAAGCCGGGCCAACGACAAGACGTTGAAGAGCAAGACTATACCTTTCACGCCTATGGCCGCTCAGAGGGCGTC
TGCGGCATCATCATTTCAGACCACCAATACCCCGCACTCGTCGCCCACCAACTCCTCAGCAAGTGTGTCGACGAG
TTCCTCTCCCAGCACCCCCGCTCCTCATGGGCCACGGGCTCGCCCCAGCTCGCCATGCCCGAGCTCAAGGACTAC
CTCGCAAAGTACCAGGACCCCCAACAGGCAGACAGCATACTCAAGATTCAAAAAGAACTCGACGAGACAAAAATC
GTTCTTCACAAGACTATTGAGAGTGTCCTTCAGCGCGGCGAGAAGATTGACGATCTCGTCGCAAAGAGCGATGGC
CTTAGCAGCCAGAGCAAGATGTTTTACCAGCAAGCCAAGAAGCAAAATTCCTGCTGTGTCTTGATGTGA
Gene >OphauB2|3896
ATGAAGCTGCACTACATTGGTGTACGCCCGTCGCCCTCGGCATTTGCAATAAGAATCCTTGACTAACCTTGCTAC
AGATTATTCGCAACGAGGCCAAGCCCGCACACGAGATATGTGCCGAAAAGGAACTGAGCTCATATTCGCGCTTCA
CCCGCAACAAGTCGGTCCCCTTTGCTCTTCCCCCGCCTTGTTTTGATGAAGCACATCTAACATGTCCATCTCTCT
CACCCTCAGCTATGGCGAGTTCATGACGCTCTTCGCAAAGACGGTTGCCGAGCGCACCAAGCCGGGCCAACGACA
AGACGTTGAAGAGCAAGGTACGCCCGCTGCTCCACCCAAAATACAACTCGCAGCAATATATACACTGCAAAAGCA
TCTCCTCTCAATACCCTAACAAACTCGAAACAAATACAGACTATACCTTTCACGCCTATGGCCGCTCAGAGGGCG
TCTGCGGCATCATCATTTCAGACCACCAATACCCCGCACTCGTCGCCCACCAACTCCTCAGCAAGTGTGTCGACG
AGTTCCTCTCCCAGCACCCCCGCTCCTCATGGGCCACGGGCTCGCCCCAGCTCGCCATGCCCGAGCTCAAGGACT
ACCTCGCAAAGTACCAGGACCCCCAACAGGCAGACAGCATACTCAAGATTCAAAAAGAACTCGACGAGACAAAAA
TCGTTCTTCACAAGACTATTGAGAGTGTCCTTCAGCGCGGCGAGAAGATTGACGATCTCGTCGCAAAGAGCGATG
GCCTTAGCAGCCAGAGCAAGATGTTTTACCGTATATTCCCCCTCTCTCCCCCTTTGCCGCCCTCATGTTTTTCCA
ACTACACTTTACTGACTGGTTGACCTGCAGAGCAAGCCAAGAAGCAAAATTCCTGCTGTGTCTTGATGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail