Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3886
Gene name
LocationContig_25:80393..82442
Strand-
Gene length (bp)2049
Transcript length (bp)1971
Coding sequence length (bp)1971
Protein length (aa) 657

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08637 NCA2 ATP synthase regulation protein NCA2 1.2E-94 368 651

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O74963|NCA2_SCHPO Nuclear control of ATPase protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nca2 PE=3 SV=1 73 647 6.0E-50
sp|Q12374|NCA2_YEAST Nuclear control of ATPase protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NCA2 PE=1 SV=1 331 655 5.0E-40
sp|Q753J1|NCA2_ASHGO Nuclear control of ATPase protein 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=NCA2 PE=3 SV=1 348 655 3.0E-38
sp|Q55GJ3|NCA2_DICDI Nuclear control of ATPase protein 2 OS=Dictyostelium discoideum GN=nca2 PE=3 SV=1 339 558 1.0E-18

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 531 553 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3886
MSLISDFIQQLDVYVDSIPVVDNNDSSSDELEHSRPDDASAERVDELIRIAKALSTSSSRPLLPACRIRSLLLQS
GLCTDYRLLTNVNQDLDRTRPVGSEVRFEWIMLIKASLQVYGLTMSMMIDHSQVFKDDFCYWDQLATSYKSCCLF
ALQTFPWRFWRRCSDAFAVSSLGRRFSVWTLPRLTHDIFGTLRSLRRFVYNCIQPRIPIFIHNRVLSSPAICRLE
AYEQRSQSKKLGGFSSISLGMLISDCFQFNDKKVGACRTLRELATVVMRSLAALQAIIGEAYNPEMTLDDFESLL
INREVCEIEIALNDRHPLDITGNCGSRLLHFIDVTIPDMERKMNRHRDSCGKPPHIIRWWLPMLIGVVSSTTAMH
MLANRHEEVTQYMVECGRTVRGFWSNWVVEPGRQVLKTIRHDETSDIAIMSRDSLKADRESLERMVVDFAHDNPK
FVSELGAGVSEADIAQLRQNVARGDVTPVLRAYERDLRRPFTGVVRGGLVRSLLIQVQKTKVDLEVAMTGIDSLL
KSQELVFGLVGLTPGIFISAGVARYIYGLFGGRAWLRREKRVDETRRVLHAMDCILTESYQDRDARVLSYEDHGR
LVYEAYRLRALAGRVLPADAARDLFIDLHDLARPNTIKVQARVLNRIRWTYGKWLT*
Coding >OphauB2|3886
ATGTCACTAATTTCGGATTTCATACAGCAACTCGATGTTTATGTCGATAGTATCCCAGTCGTCGATAATAACGAC
TCGAGTAGCGATGAGCTTGAGCACAGCCGCCCCGATGACGCTTCGGCAGAAAGAGTTGATGAATTGATAAGAATT
GCCAAGGCCCTCAGTACATCTTCGTCTCGACCTCTTCTACCGGCTTGTCGCATCCGCTCTTTGCTCCTCCAGTCT
GGGCTCTGCACTGATTACCGGTTATTGACCAACGTCAACCAAGATCTTGACAGAACGCGACCCGTGGGGTCCGAA
GTCAGGTTCGAATGGATCATGTTGATCAAGGCGTCGTTACAAGTCTATGGCCTCACCATGAGCATGATGATTGAC
CACAGCCAAGTCTTTAAAGACGACTTTTGCTACTGGGACCAATTGGCCACTTCCTACAAGAGCTGCTGTCTTTTT
GCCTTGCAGACTTTTCCCTGGCGCTTCTGGCGACGATGCAGCGATGCTTTTGCAGTAAGCTCATTGGGGCGTAGG
TTCTCGGTCTGGACCTTGCCCCGCTTGACACACGACATCTTTGGCACTCTGCGTAGCCTCCGTCGCTTTGTATAC
AATTGCATTCAACCCCGAATTCCCATTTTTATTCACAACAGGGTGCTCTCTTCGCCCGCTATTTGCCGGCTCGAG
GCGTACGAACAACGCTCTCAAAGCAAGAAACTGGGCGGCTTTTCCAGCATTTCTCTGGGCATGCTCATCAGTGAC
TGTTTTCAGTTCAATGACAAAAAGGTTGGGGCATGCCGCACTCTGAGAGAGTTGGCTACCGTTGTCATGCGTAGC
CTAGCTGCGCTGCAAGCCATTATTGGCGAAGCATATAATCCAGAAATGACTCTGGACGATTTCGAGTCTCTGCTC
ATCAACCGGGAGGTGTGTGAAATTGAAATCGCTCTCAACGACCGTCATCCTTTGGACATTACTGGCAACTGTGGG
AGCCGTCTACTGCATTTCATCGATGTAACTATACCCGACATGGAGAGGAAGATGAATAGGCACCGAGACTCGTGC
GGCAAGCCACCGCATATTATTCGTTGGTGGTTGCCCATGCTAATTGGCGTCGTTTCCTCCACTACGGCAATGCAC
ATGCTGGCCAATCGTCATGAAGAAGTTACCCAATACATGGTGGAATGTGGCCGCACGGTGCGGGGGTTCTGGTCC
AACTGGGTGGTTGAGCCTGGACGACAAGTCTTGAAGACGATTCGGCACGATGAGACGAGCGACATTGCCATTATG
AGCCGAGATAGTCTCAAGGCGGATCGCGAGAGCCTGGAGCGCATGGTTGTTGATTTTGCCCACGACAACCCCAAG
TTTGTCTCGGAGCTTGGCGCCGGAGTCTCGGAAGCAGACATTGCCCAGCTACGGCAAAACGTGGCCAGAGGTGAC
GTGACTCCGGTTCTACGAGCCTATGAGCGCGACTTGCGGCGCCCCTTTACCGGCGTGGTGCGCGGCGGCTTGGTG
CGCTCGCTGCTCATTCAGGTGCAAAAGACAAAGGTGGACCTTGAAGTTGCCATGACGGGCATCGACTCCCTCCTC
AAGAGCCAAGAACTCGTCTTTGGCCTCGTGGGTCTAACGCCCGGCATTTTCATTTCGGCGGGCGTGGCGCGCTAC
ATTTACGGCCTCTTTGGCGGCCGCGCCTGGCTGCGCCGCGAAAAGCGCGTCGACGAGACTCGTCGCGTCTTGCAC
GCCATGGACTGCATACTGACGGAGTCGTACCAGGACCGTGACGCGCGCGTCTTGTCGTACGAGGACCATGGCAGG
TTGGTGTATGAGGCGTACCGGCTGCGTGCGCTGGCGGGGCGTGTCTTGCCTGCGGATGCGGCACGGGACTTGTTT
ATCGACTTGCATGATTTGGCAAGGCCTAATACAATCAAGGTGCAGGCAAGAGTGCTGAACAGGATTCGGTGGACA
TATGGGAAGTGGTTGACGTGA
Transcript >OphauB2|3886
ATGTCACTAATTTCGGATTTCATACAGCAACTCGATGTTTATGTCGATAGTATCCCAGTCGTCGATAATAACGAC
TCGAGTAGCGATGAGCTTGAGCACAGCCGCCCCGATGACGCTTCGGCAGAAAGAGTTGATGAATTGATAAGAATT
GCCAAGGCCCTCAGTACATCTTCGTCTCGACCTCTTCTACCGGCTTGTCGCATCCGCTCTTTGCTCCTCCAGTCT
GGGCTCTGCACTGATTACCGGTTATTGACCAACGTCAACCAAGATCTTGACAGAACGCGACCCGTGGGGTCCGAA
GTCAGGTTCGAATGGATCATGTTGATCAAGGCGTCGTTACAAGTCTATGGCCTCACCATGAGCATGATGATTGAC
CACAGCCAAGTCTTTAAAGACGACTTTTGCTACTGGGACCAATTGGCCACTTCCTACAAGAGCTGCTGTCTTTTT
GCCTTGCAGACTTTTCCCTGGCGCTTCTGGCGACGATGCAGCGATGCTTTTGCAGTAAGCTCATTGGGGCGTAGG
TTCTCGGTCTGGACCTTGCCCCGCTTGACACACGACATCTTTGGCACTCTGCGTAGCCTCCGTCGCTTTGTATAC
AATTGCATTCAACCCCGAATTCCCATTTTTATTCACAACAGGGTGCTCTCTTCGCCCGCTATTTGCCGGCTCGAG
GCGTACGAACAACGCTCTCAAAGCAAGAAACTGGGCGGCTTTTCCAGCATTTCTCTGGGCATGCTCATCAGTGAC
TGTTTTCAGTTCAATGACAAAAAGGTTGGGGCATGCCGCACTCTGAGAGAGTTGGCTACCGTTGTCATGCGTAGC
CTAGCTGCGCTGCAAGCCATTATTGGCGAAGCATATAATCCAGAAATGACTCTGGACGATTTCGAGTCTCTGCTC
ATCAACCGGGAGGTGTGTGAAATTGAAATCGCTCTCAACGACCGTCATCCTTTGGACATTACTGGCAACTGTGGG
AGCCGTCTACTGCATTTCATCGATGTAACTATACCCGACATGGAGAGGAAGATGAATAGGCACCGAGACTCGTGC
GGCAAGCCACCGCATATTATTCGTTGGTGGTTGCCCATGCTAATTGGCGTCGTTTCCTCCACTACGGCAATGCAC
ATGCTGGCCAATCGTCATGAAGAAGTTACCCAATACATGGTGGAATGTGGCCGCACGGTGCGGGGGTTCTGGTCC
AACTGGGTGGTTGAGCCTGGACGACAAGTCTTGAAGACGATTCGGCACGATGAGACGAGCGACATTGCCATTATG
AGCCGAGATAGTCTCAAGGCGGATCGCGAGAGCCTGGAGCGCATGGTTGTTGATTTTGCCCACGACAACCCCAAG
TTTGTCTCGGAGCTTGGCGCCGGAGTCTCGGAAGCAGACATTGCCCAGCTACGGCAAAACGTGGCCAGAGGTGAC
GTGACTCCGGTTCTACGAGCCTATGAGCGCGACTTGCGGCGCCCCTTTACCGGCGTGGTGCGCGGCGGCTTGGTG
CGCTCGCTGCTCATTCAGGTGCAAAAGACAAAGGTGGACCTTGAAGTTGCCATGACGGGCATCGACTCCCTCCTC
AAGAGCCAAGAACTCGTCTTTGGCCTCGTGGGTCTAACGCCCGGCATTTTCATTTCGGCGGGCGTGGCGCGCTAC
ATTTACGGCCTCTTTGGCGGCCGCGCCTGGCTGCGCCGCGAAAAGCGCGTCGACGAGACTCGTCGCGTCTTGCAC
GCCATGGACTGCATACTGACGGAGTCGTACCAGGACCGTGACGCGCGCGTCTTGTCGTACGAGGACCATGGCAGG
TTGGTGTATGAGGCGTACCGGCTGCGTGCGCTGGCGGGGCGTGTCTTGCCTGCGGATGCGGCACGGGACTTGTTT
ATCGACTTGCATGATTTGGCAAGGCCTAATACAATCAAGGTGCAGGCAAGAGTGCTGAACAGGATTCGGTGGACA
TATGGGAAGTGGTTGACGTGA
Gene >OphauB2|3886
ATGTCACTAATTTCGGAGTAAGGCAACTAGTGTTTCTTGTCTCTTGTATGCCATTCGCCTGAGTTTCTCTACTAA
CGACCCCCCCCCTCGGACAGTTTCATACAGCAACTCGATGTTTATGTCGATAGTATCCCAGTCGTCGATAATAAC
GACTCGAGTAGCGATGAGCTTGAGCACAGCCGCCCCGATGACGCTTCGGCAGAAAGAGTTGATGAATTGATAAGA
ATTGCCAAGGCCCTCAGTACATCTTCGTCTCGACCTCTTCTACCGGCTTGTCGCATCCGCTCTTTGCTCCTCCAG
TCTGGGCTCTGCACTGATTACCGGTTATTGACCAACGTCAACCAAGATCTTGACAGAACGCGACCCGTGGGGTCC
GAAGTCAGGTTCGAATGGATCATGTTGATCAAGGCGTCGTTACAAGTCTATGGCCTCACCATGAGCATGATGATT
GACCACAGCCAAGTCTTTAAAGACGACTTTTGCTACTGGGACCAATTGGCCACTTCCTACAAGAGCTGCTGTCTT
TTTGCCTTGCAGACTTTTCCCTGGCGCTTCTGGCGACGATGCAGCGATGCTTTTGCAGTAAGCTCATTGGGGCGT
AGGTTCTCGGTCTGGACCTTGCCCCGCTTGACACACGACATCTTTGGCACTCTGCGTAGCCTCCGTCGCTTTGTA
TACAATTGCATTCAACCCCGAATTCCCATTTTTATTCACAACAGGGTGCTCTCTTCGCCCGCTATTTGCCGGCTC
GAGGCGTACGAACAACGCTCTCAAAGCAAGAAACTGGGCGGCTTTTCCAGCATTTCTCTGGGCATGCTCATCAGT
GACTGTTTTCAGTTCAATGACAAAAAGGTTGGGGCATGCCGCACTCTGAGAGAGTTGGCTACCGTTGTCATGCGT
AGCCTAGCTGCGCTGCAAGCCATTATTGGCGAAGCATATAATCCAGAAATGACTCTGGACGATTTCGAGTCTCTG
CTCATCAACCGGGAGGTGTGTGAAATTGAAATCGCTCTCAACGACCGTCATCCTTTGGACATTACTGGCAACTGT
GGGAGCCGTCTACTGCATTTCATCGATGTAACTATACCCGACATGGAGAGGAAGATGAATAGGCACCGAGACTCG
TGCGGCAAGCCACCGCATATTATTCGTTGGTGGTTGCCCATGCTAATTGGCGTCGTTTCCTCCACTACGGCAATG
CACATGCTGGCCAATCGTCATGAAGAAGTTACCCAATACATGGTGGAATGTGGCCGCACGGTGCGGGGGTTCTGG
TCCAACTGGGTGGTTGAGCCTGGACGACAAGTCTTGAAGACGATTCGGCACGATGAGACGAGCGACATTGCCATT
ATGAGCCGAGATAGTCTCAAGGCGGATCGCGAGAGCCTGGAGCGCATGGTTGTTGATTTTGCCCACGACAACCCC
AAGTTTGTCTCGGAGCTTGGCGCCGGAGTCTCGGAAGCAGACATTGCCCAGCTACGGCAAAACGTGGCCAGAGGT
GACGTGACTCCGGTTCTACGAGCCTATGAGCGCGACTTGCGGCGCCCCTTTACCGGCGTGGTGCGCGGCGGCTTG
GTGCGCTCGCTGCTCATTCAGGTGCAAAAGACAAAGGTGGACCTTGAAGTTGCCATGACGGGCATCGACTCCCTC
CTCAAGAGCCAAGAACTCGTCTTTGGCCTCGTGGGTCTAACGCCCGGCATTTTCATTTCGGCGGGCGTGGCGCGC
TACATTTACGGCCTCTTTGGCGGCCGCGCCTGGCTGCGCCGCGAAAAGCGCGTCGACGAGACTCGTCGCGTCTTG
CACGCCATGGACTGCATACTGACGGAGTCGTACCAGGACCGTGACGCGCGCGTCTTGTCGTACGAGGACCATGGC
AGGTTGGTGTATGAGGCGTACCGGCTGCGTGCGCTGGCGGGGCGTGTCTTGCCTGCGGATGCGGCACGGGACTTG
TTTATCGACTTGCATGATTTGGCAAGGCCTAATACAATCAAGGTGCAGGCAAGAGTGCTGAACAGGATTCGGTGG
ACATATGGGAAGTGGTTGACGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail