Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3871
Gene name
LocationContig_25:37902..40327
Strand+
Gene length (bp)2425
Transcript length (bp)2325
Coding sequence length (bp)2325
Protein length (aa) 775

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11831 Myb_Cef pre-mRNA splicing factor component 4.0E-50 422 630
PF00249 Myb_DNA-binding Myb-like DNA-binding domain 4.5E-12 7 52
PF00249 Myb_DNA-binding Myb-like DNA-binding domain 2.6E-09 60 102
PF13921 Myb_DNA-bind_6 Myb-like DNA-binding domain 5.5E-14 9 69
PF13921 Myb_DNA-bind_6 Myb-like DNA-binding domain 1.4E-06 61 102

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q52G60|CEF1_MAGO7 Pre-mRNA-splicing factor CEF1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CEF1 PE=3 SV=1 1 771 0.0E+00
sp|Q7SAF6|CEF1_NEUCR Pre-mRNA-splicing factor cef-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cef-1 PE=3 SV=1 1 771 0.0E+00
sp|P39964|CEF1_SCHPO Pre-mRNA-splicing factor cdc5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc5 PE=1 SV=1 1 761 0.0E+00
sp|P0CO95|CEF1_CRYNB Pre-mRNA-splicing factor CEF1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CEF1 PE=3 SV=1 3 766 0.0E+00
sp|P0CO94|CEF1_CRYNJ Pre-mRNA-splicing factor CEF1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CEF1 PE=3 SV=1 3 766 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q52G60|CEF1_MAGO7 Pre-mRNA-splicing factor CEF1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CEF1 PE=3 SV=1 1 771 0.0E+00
sp|Q7SAF6|CEF1_NEUCR Pre-mRNA-splicing factor cef-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cef-1 PE=3 SV=1 1 771 0.0E+00
sp|P39964|CEF1_SCHPO Pre-mRNA-splicing factor cdc5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc5 PE=1 SV=1 1 761 0.0E+00
sp|P0CO95|CEF1_CRYNB Pre-mRNA-splicing factor CEF1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CEF1 PE=3 SV=1 3 766 0.0E+00
sp|P0CO94|CEF1_CRYNJ Pre-mRNA-splicing factor CEF1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CEF1 PE=3 SV=1 3 766 0.0E+00
sp|Q4P652|CEF1_USTMA Pre-mRNA-splicing factor CEF1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CEF1 PE=3 SV=1 3 762 0.0E+00
sp|Q4WHG0|CEF1_ASPFU Pre-mRNA-splicing factor cef1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cef1 PE=3 SV=1 1 771 0.0E+00
sp|C8VBH3|CEF1_EMENI Pre-mRNA-splicing factor cef1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cef1 PE=3 SV=1 1 771 0.0E+00
sp|A7SD85|CDC5L_NEMVE Cell division cycle 5-related protein OS=Nematostella vectensis GN=cdc5l PE=3 SV=1 1 774 4.0E-162
sp|Q99459|CDC5L_HUMAN Cell division cycle 5-like protein OS=Homo sapiens GN=CDC5L PE=1 SV=2 1 774 1.0E-160
sp|Q6A068|CDC5L_MOUSE Cell division cycle 5-like protein OS=Mus musculus GN=Cdc5l PE=1 SV=2 1 761 3.0E-160
sp|O08837|CDC5L_RAT Cell division cycle 5-like protein OS=Rattus norvegicus GN=Cdc5l PE=1 SV=2 1 761 2.0E-159
sp|Q2KJC1|CDC5L_BOVIN Cell division cycle 5-like protein OS=Bos taurus GN=CDC5L PE=2 SV=1 1 774 3.0E-159
sp|Q6C8F5|CEF1_YARLI Pre-mRNA-splicing factor CEF1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CEF1 PE=3 SV=1 1 765 2.0E-145
sp|P92948|CDC5L_ARATH Cell division cycle 5-like protein OS=Arabidopsis thaliana GN=CDC5 PE=1 SV=2 3 762 5.0E-138
sp|Q54WZ0|CDC5L_DICDI Cell division cycle 5-like protein OS=Dictyostelium discoideum GN=cdc5l PE=3 SV=1 1 554 1.0E-104
sp|Q5APG6|CEF1_CANAL Pre-mRNA-splicing factor CEF1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CEF1 PE=3 SV=1 4 316 8.0E-83
sp|Q6BLT3|CEF1_DEBHA Pre-mRNA-splicing factor CEF1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CEF1 PE=3 SV=2 1 319 3.0E-81
sp|Q6FUG1|CEF1_CANGA Pre-mRNA-splicing factor CEF1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CEF1 PE=3 SV=1 4 298 1.0E-73
sp|Q03654|CEF1_YEAST Pre-mRNA-splicing factor CEF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CEF1 PE=1 SV=1 1 253 8.0E-71
sp|Q6CU65|CEF1_KLULA Pre-mRNA-splicing factor CEF1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CEF1 PE=3 SV=1 1 298 1.0E-68
sp|Q756C3|CEF1_ASHGO Pre-mRNA-splicing factor CEF1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CEF1 PE=3 SV=1 1 238 8.0E-43
sp|P52551|MYBB_XENLA Myb-related protein B OS=Xenopus laevis GN=mybl2 PE=2 SV=2 9 103 3.0E-13
sp|P01103|MYB_CHICK Transcriptional activator Myb OS=Gallus gallus GN=MYB PE=1 SV=1 9 103 6.0E-12
sp|Q03237|MYBB_CHICK Myb-related protein B OS=Gallus gallus GN=MYBL2 PE=1 SV=1 9 111 6.0E-12
sp|Q08759|MYB_XENLA Transcriptional activator Myb OS=Xenopus laevis GN=myb PE=2 SV=1 9 103 7.0E-12
sp|P10244|MYBB_HUMAN Myb-related protein B OS=Homo sapiens GN=MYBL2 PE=1 SV=1 9 103 1.0E-11
sp|P48972|MYBB_MOUSE Myb-related protein B OS=Mus musculus GN=Mybl2 PE=1 SV=1 9 103 1.0E-11
sp|P06876|MYB_MOUSE Transcriptional activator Myb OS=Mus musculus GN=Myb PE=1 SV=2 9 103 2.0E-11
sp|P52550|MYBA_CHICK Myb-related protein A OS=Gallus gallus GN=MYBL1 PE=2 SV=1 9 103 2.0E-11
sp|P46200|MYB_BOVIN Transcriptional activator Myb OS=Bos taurus GN=MYB PE=2 SV=1 9 103 2.0E-11
sp|P10242|MYB_HUMAN Transcriptional activator Myb OS=Homo sapiens GN=MYB PE=1 SV=2 9 103 2.0E-11
sp|P51960|MYBA_MOUSE Myb-related protein A OS=Mus musculus GN=Mybl1 PE=1 SV=2 9 103 3.0E-11
sp|P10243|MYBA_HUMAN Myb-related protein A OS=Homo sapiens GN=MYBL1 PE=1 SV=2 9 103 3.0E-11
sp|Q9S7L2|MYB98_ARATH Transcription factor MYB98 OS=Arabidopsis thaliana GN=MYB98 PE=2 SV=1 3 92 3.0E-11
sp|Q9S7G7|MB3R1_ARATH Myb-related protein 3R-1 OS=Arabidopsis thaliana GN=MYB3R-1 PE=2 SV=1 7 110 5.0E-11
sp|Q54NA6|MYBL_DICDI Myb-like protein L OS=Dictyostelium discoideum GN=mybL PE=3 SV=1 2 101 1.0E-10
sp|P34127|MYBA_DICDI Myb-like protein A OS=Dictyostelium discoideum GN=mybA PE=3 SV=2 9 110 2.0E-10
sp|Q03237|MYBB_CHICK Myb-related protein B OS=Gallus gallus GN=MYBL2 PE=1 SV=1 2 92 3.0E-10
sp|P52551|MYBB_XENLA Myb-related protein B OS=Xenopus laevis GN=mybl2 PE=2 SV=2 2 102 4.0E-10
sp|P01104|MYB_AVIMB Transforming protein Myb OS=Avian myeloblastosis virus GN=V-MYB PE=1 SV=2 2 123 5.0E-10
sp|P48972|MYBB_MOUSE Myb-related protein B OS=Mus musculus GN=Mybl2 PE=1 SV=1 2 92 8.0E-10
sp|P10244|MYBB_HUMAN Myb-related protein B OS=Homo sapiens GN=MYBL2 PE=1 SV=1 2 92 9.0E-10
sp|P01103|MYB_CHICK Transcriptional activator Myb OS=Gallus gallus GN=MYB PE=1 SV=1 2 115 1.0E-09
sp|Q05935|MYBA_XENLA Myb-related protein A OS=Xenopus laevis GN=mybl1 PE=2 SV=1 2 92 3.0E-09
sp|Q05935|MYBA_XENLA Myb-related protein A OS=Xenopus laevis GN=mybl1 PE=2 SV=1 9 103 3.0E-09
sp|Q9FNV9|MY113_ARATH Transcription factor MYB113 OS=Arabidopsis thaliana GN=MYB113 PE=1 SV=1 4 136 4.0E-09
sp|Q08759|MYB_XENLA Transcriptional activator Myb OS=Xenopus laevis GN=myb PE=2 SV=1 2 109 5.0E-09
sp|P46200|MYB_BOVIN Transcriptional activator Myb OS=Bos taurus GN=MYB PE=2 SV=1 2 92 5.0E-09
sp|P06876|MYB_MOUSE Transcriptional activator Myb OS=Mus musculus GN=Myb PE=1 SV=2 2 92 6.0E-09
sp|P04197|MYB_DROME Myb protein OS=Drosophila melanogaster GN=Myb PE=1 SV=2 2 119 6.0E-09
sp|P10242|MYB_HUMAN Transcriptional activator Myb OS=Homo sapiens GN=MYB PE=1 SV=2 2 92 6.0E-09
sp|P51960|MYBA_MOUSE Myb-related protein A OS=Mus musculus GN=Mybl1 PE=1 SV=2 2 92 9.0E-09
sp|P10243|MYBA_HUMAN Myb-related protein A OS=Homo sapiens GN=MYBL1 PE=1 SV=2 2 92 9.0E-09
sp|Q9SEI0|WER_ARATH Transcription factor WER OS=Arabidopsis thaliana GN=WER PE=1 SV=1 5 93 1.0E-08
sp|Q54NA6|MYBL_DICDI Myb-like protein L OS=Dictyostelium discoideum GN=mybL PE=3 SV=1 9 103 2.0E-08
sp|P52550|MYBA_CHICK Myb-related protein A OS=Gallus gallus GN=MYBL1 PE=2 SV=1 2 92 2.0E-08
sp|Q9S7G7|MB3R1_ARATH Myb-related protein 3R-1 OS=Arabidopsis thaliana GN=MYB3R-1 PE=2 SV=1 2 92 2.0E-08
sp|B0G0Y5|MYBAA_DICDI Myb-like protein AA OS=Dictyostelium discoideum GN=mybAA PE=3 SV=1 7 90 3.0E-08
sp|Q947R4|GL1_ARALY Trichome differentiation protein GL1 OS=Arabidopsis lyrata GN=GL1 PE=3 SV=2 5 93 3.0E-08
sp|P27900|GL1_ARATH Trichome differentiation protein GL1 OS=Arabidopsis thaliana GN=GL1 PE=1 SV=2 5 93 3.0E-08
sp|P34127|MYBA_DICDI Myb-like protein A OS=Dictyostelium discoideum GN=mybA PE=3 SV=2 2 92 4.0E-08
sp|Q9FDW1|MYB44_ARATH Transcription factor MYB44 OS=Arabidopsis thaliana GN=MYB44 PE=2 SV=1 7 126 4.0E-08
sp|P20027|MYB3_HORVU Myb-related protein Hv33 OS=Hordeum vulgare GN=MYB2 PE=2 SV=3 2 93 5.0E-08
sp|M1ETK3|MYB1W_BETVU Transcription factor MYB1 OS=Beta vulgaris GN=MYB1 PE=2 SV=1 3 92 7.0E-08
sp|M1ETA5|MYB1R_BETVU Transcription factor MYB1 OS=Beta vulgaris GN=MYB1 PE=1 SV=1 3 92 7.0E-08
sp|Q7XBH4|MYB4_ORYSJ Myb-related protein Myb4 OS=Oryza sativa subsp. japonica GN=MYB4 PE=2 SV=2 4 102 8.0E-08
sp|Q96276|MYB23_ARATH Transcription factor MYB23 OS=Arabidopsis thaliana GN=MYB23 PE=1 SV=1 5 93 9.0E-08
sp|Q54NA6|MYBL_DICDI Myb-like protein L OS=Dictyostelium discoideum GN=mybL PE=3 SV=1 2 103 1.0E-07
sp|Q9LTF7|MYB82_ARATH Transcription factor MYB82 OS=Arabidopsis thaliana GN=MYB82 PE=1 SV=1 4 93 3.0E-07
sp|Q9FJA2|TT2_ARATH Transcription factor TT2 OS=Arabidopsis thaliana GN=TT2 PE=1 SV=1 7 93 3.0E-07
sp|Q54WZ0|CDC5L_DICDI Cell division cycle 5-like protein OS=Dictyostelium discoideum GN=cdc5l PE=3 SV=1 665 774 4.0E-07
sp|P10290|MYBC_MAIZE Anthocyanin regulatory C1 protein OS=Zea mays GN=C1 PE=2 SV=1 4 102 4.0E-07
sp|P04197|MYB_DROME Myb protein OS=Drosophila melanogaster GN=Myb PE=1 SV=2 6 103 1.0E-06
sp|Q9FNV8|MY114_ARATH Transcription factor MYB114 OS=Arabidopsis thaliana GN=MYB114 PE=1 SV=1 4 92 1.0E-06
sp|Q38850|MYB5_ARATH Transcription repressor MYB5 OS=Arabidopsis thaliana GN=MYB5 PE=1 SV=1 4 93 1.0E-06
sp|Q9C9C8|MY122_ARATH Transcription factor MYB122 OS=Arabidopsis thaliana GN=MYB122 PE=1 SV=1 4 93 1.0E-06
sp|P91868|SNPC4_CAEEL snRNA-activating protein complex subunit 4 homolog OS=Caenorhabditis elegans GN=snpc-4 PE=2 SV=1 4 172 1.0E-06
sp|Q9FE25|MYB75_ARATH Transcription factor MYB75 OS=Arabidopsis thaliana GN=MYB75 PE=1 SV=1 4 92 2.0E-06
sp|Q8BP86|SNPC4_MOUSE snRNA-activating protein complex subunit 4 OS=Mus musculus GN=Snapc4 PE=1 SV=2 2 101 3.0E-06
sp|Q54HP1|MYBQ_DICDI Myb-like protein Q OS=Dictyostelium discoideum GN=mybQ PE=3 SV=1 2 102 3.0E-06
sp|Q9SZP1|MYB4_ARATH Transcription repressor MYB4 OS=Arabidopsis thaliana GN=MYB4 PE=1 SV=1 7 93 5.0E-06
sp|P20025|MYB38_MAIZE Myb-related protein Zm38 OS=Zea mays PE=2 SV=1 7 93 7.0E-06
sp|Q9ZTC3|MYB90_ARATH Transcription factor MYB90 OS=Arabidopsis thaliana GN=MYB90 PE=1 SV=1 4 92 7.0E-06
sp|P81396|MYB40_ANTMA Myb-related protein 340 OS=Antirrhinum majus GN=MYB340 PE=2 SV=1 4 128 8.0E-06
sp|P01104|MYB_AVIMB Transforming protein Myb OS=Avian myeloblastosis virus GN=V-MYB PE=1 SV=2 38 103 9.0E-06
sp|Q9S9K9|MYB3_ARATH Transcription factor MYB3 OS=Arabidopsis thaliana GN=MYB3 PE=1 SV=1 7 93 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 47 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3871
MPVVKGGVWTNIEDETLKAAVSKYGLNQWARVSSLLARKTPKQCKARWNEWLDPSIKKIEWSKDEDEKLLHLAKI
MPTQWRTIAPIVGRTANQCLERYQKLLDEAEAREASALGLAGPDGAETQAPSADDVRRLRPGEVDPDPETKPARP
DTVDLDEDEKEMLSEARARLANTQGKKAKRKARERQQEESRRLATLQKRRELKTAGINVKVTTRKKGEMDYNADI
PFEKKAAPGFFDTSEEQLRNEAQRKAFDPQKQQLATKRKGDGDDEAGRKRRKGDKEGMSETQKAAIKAGQMQKLR
EAEQNSKRRPLSLPAPQIGQGELEDIVKMGKLGEAASSSALEGENDATRGLVTSYDSLNPSAPIRTPRVPEQQDH
IANEIRNIRALNETKSALLGGENTPLHQGEGSTGFQSIMPRQQTMATPNPMATPLTRGMDGAAATPLRPGQTPMR
TPRDTYALNQDGGMSLASATPRDMHMRQAALKKELLAGLAALPKPKEQEWEFDVPDEQQEPASTTQTQPEDAAER
DARQRERLAAQEELERRRRSQVLQRGLPRPALVDCTRLLKDADELGDEAEALIAREAVALMAADAAKYPLPGGEV
RGVAPRLQEIDDGALAKARLAILSETKTLPSSEHVEFYFEGRAGDATLLGLGCYTDDAGEQEAAMRAQFDLMQES
IMSTAEQGAKLEKKLSLRLGGYQKRHKTLSDKIRDAYQALERAQSAYTGLETLAVAEDVAVERRLGALRDEVEFI
SRREREAQQEYRKARDELDGLRGK*
Coding >OphauB2|3871
ATGCCCGTCGTCAAGGGCGGCGTGTGGACCAACATTGAGGATGAGACGCTCAAGGCGGCCGTGTCGAAATATGGC
CTCAACCAATGGGCCCGCGTCTCGTCTCTGCTGGCGCGCAAGACGCCCAAGCAATGCAAGGCGCGGTGGAACGAA
TGGCTGGATCCGAGCATCAAGAAGATTGAATGGAGCAAAGACGAAGACGAGAAGCTGCTGCACCTGGCCAAGATT
ATGCCCACGCAATGGCGCACCATTGCCCCGATTGTAGGGCGCACGGCCAACCAGTGCCTGGAGCGCTATCAGAAA
CTTCTGGACGAGGCTGAAGCGCGCGAGGCGTCGGCGCTGGGTCTGGCGGGCCCGGACGGGGCAGAGACACAGGCC
CCCAGTGCTGACGATGTGCGGCGTCTGCGGCCCGGAGAAGTGGACCCCGACCCTGAGACGAAGCCGGCGCGTCCA
GACACGGTGGACCTGGACGAGGACGAAAAGGAAATGCTGAGCGAGGCGCGTGCTCGGCTGGCGAATACACAGGGC
AAAAAGGCAAAACGCAAGGCTCGAGAGCGCCAGCAAGAAGAGTCGCGGCGGCTGGCTACCCTGCAGAAGCGACGC
GAGCTCAAGACGGCGGGCATCAATGTCAAGGTGACGACGCGCAAAAAGGGCGAGATGGACTACAATGCGGACATT
CCGTTTGAGAAGAAGGCAGCGCCCGGCTTCTTTGACACGTCGGAGGAGCAGCTTCGCAACGAGGCGCAGCGCAAG
GCGTTTGATCCGCAAAAGCAGCAGCTGGCCACGAAGCGCAAGGGCGACGGCGACGACGAGGCAGGGCGCAAGCGG
CGAAAGGGCGACAAGGAGGGCATGTCGGAGACGCAAAAGGCGGCCATCAAGGCTGGGCAGATGCAGAAGCTGCGC
GAGGCGGAGCAAAACAGCAAACGACGGCCGCTCAGCCTGCCGGCTCCGCAAATCGGCCAGGGCGAGCTCGAGGAC
ATTGTCAAGATGGGCAAACTGGGCGAGGCGGCCAGCAGCTCTGCGCTCGAGGGCGAAAACGACGCGACACGCGGC
CTCGTCACCTCGTACGACTCTCTCAACCCGAGCGCGCCCATTCGAACGCCCCGGGTACCCGAGCAGCAGGACCAC
ATTGCCAATGAGATTCGCAACATTCGCGCCCTCAACGAGACCAAGTCGGCGCTGCTGGGGGGCGAGAACACGCCG
CTGCATCAAGGCGAGGGCTCAACGGGCTTCCAGAGCATCATGCCTCGCCAGCAAACCATGGCCACGCCCAACCCC
ATGGCCACACCGCTGACGAGGGGCATGGACGGCGCTGCAGCGACGCCTCTGCGGCCAGGCCAGACGCCAATGCGA
ACGCCGCGCGACACATATGCCCTCAACCAAGACGGCGGCATGTCGCTGGCATCAGCCACGCCGCGCGACATGCAC
ATGCGGCAAGCGGCTCTCAAGAAGGAGCTCCTGGCCGGCCTTGCCGCACTGCCCAAGCCCAAGGAGCAAGAGTGG
GAGTTTGACGTGCCCGACGAGCAGCAAGAGCCAGCCTCGACGACGCAGACGCAGCCCGAGGACGCGGCCGAGCGC
GACGCGCGCCAGAGGGAGCGACTGGCGGCACAGGAGGAACTGGAGCGCCGGCGCCGCAGCCAAGTCTTGCAGCGC
GGACTGCCGCGCCCGGCGCTGGTGGACTGCACGCGCCTGCTCAAGGATGCCGACGAGCTGGGCGACGAGGCCGAG
GCTCTGATTGCGCGGGAGGCTGTGGCGCTCATGGCGGCTGATGCGGCCAAGTATCCGCTCCCGGGCGGCGAGGTG
CGAGGCGTGGCGCCGCGGCTGCAAGAGATTGACGACGGGGCGCTGGCCAAGGCGCGGCTGGCCATTTTGTCCGAG
ACGAAGACGCTGCCGAGCAGCGAGCATGTGGAGTTTTACTTTGAGGGGCGGGCGGGCGACGCGACGCTGCTTGGG
CTGGGGTGCTATACCGATGACGCTGGGGAGCAAGAGGCGGCCATGCGCGCCCAATTTGACCTCATGCAAGAATCC
ATCATGTCTACGGCCGAGCAAGGCGCCAAGCTGGAAAAGAAGCTCTCTCTCCGCCTCGGCGGCTACCAAAAGCGA
CACAAGACGCTGAGCGACAAAATACGCGACGCATACCAAGCCCTGGAGCGCGCGCAGAGTGCGTATACAGGGCTC
GAGACGCTGGCGGTGGCGGAAGACGTGGCGGTGGAGCGGCGGCTGGGCGCGCTGCGTGACGAGGTGGAGTTTATT
AGTCGGCGGGAAAGGGAGGCGCAGCAAGAGTATCGCAAGGCGAGGGATGAGTTGGATGGGCTCAGGGGCAAGTAA
Transcript >OphauB2|3871
ATGCCCGTCGTCAAGGGCGGCGTGTGGACCAACATTGAGGATGAGACGCTCAAGGCGGCCGTGTCGAAATATGGC
CTCAACCAATGGGCCCGCGTCTCGTCTCTGCTGGCGCGCAAGACGCCCAAGCAATGCAAGGCGCGGTGGAACGAA
TGGCTGGATCCGAGCATCAAGAAGATTGAATGGAGCAAAGACGAAGACGAGAAGCTGCTGCACCTGGCCAAGATT
ATGCCCACGCAATGGCGCACCATTGCCCCGATTGTAGGGCGCACGGCCAACCAGTGCCTGGAGCGCTATCAGAAA
CTTCTGGACGAGGCTGAAGCGCGCGAGGCGTCGGCGCTGGGTCTGGCGGGCCCGGACGGGGCAGAGACACAGGCC
CCCAGTGCTGACGATGTGCGGCGTCTGCGGCCCGGAGAAGTGGACCCCGACCCTGAGACGAAGCCGGCGCGTCCA
GACACGGTGGACCTGGACGAGGACGAAAAGGAAATGCTGAGCGAGGCGCGTGCTCGGCTGGCGAATACACAGGGC
AAAAAGGCAAAACGCAAGGCTCGAGAGCGCCAGCAAGAAGAGTCGCGGCGGCTGGCTACCCTGCAGAAGCGACGC
GAGCTCAAGACGGCGGGCATCAATGTCAAGGTGACGACGCGCAAAAAGGGCGAGATGGACTACAATGCGGACATT
CCGTTTGAGAAGAAGGCAGCGCCCGGCTTCTTTGACACGTCGGAGGAGCAGCTTCGCAACGAGGCGCAGCGCAAG
GCGTTTGATCCGCAAAAGCAGCAGCTGGCCACGAAGCGCAAGGGCGACGGCGACGACGAGGCAGGGCGCAAGCGG
CGAAAGGGCGACAAGGAGGGCATGTCGGAGACGCAAAAGGCGGCCATCAAGGCTGGGCAGATGCAGAAGCTGCGC
GAGGCGGAGCAAAACAGCAAACGACGGCCGCTCAGCCTGCCGGCTCCGCAAATCGGCCAGGGCGAGCTCGAGGAC
ATTGTCAAGATGGGCAAACTGGGCGAGGCGGCCAGCAGCTCTGCGCTCGAGGGCGAAAACGACGCGACACGCGGC
CTCGTCACCTCGTACGACTCTCTCAACCCGAGCGCGCCCATTCGAACGCCCCGGGTACCCGAGCAGCAGGACCAC
ATTGCCAATGAGATTCGCAACATTCGCGCCCTCAACGAGACCAAGTCGGCGCTGCTGGGGGGCGAGAACACGCCG
CTGCATCAAGGCGAGGGCTCAACGGGCTTCCAGAGCATCATGCCTCGCCAGCAAACCATGGCCACGCCCAACCCC
ATGGCCACACCGCTGACGAGGGGCATGGACGGCGCTGCAGCGACGCCTCTGCGGCCAGGCCAGACGCCAATGCGA
ACGCCGCGCGACACATATGCCCTCAACCAAGACGGCGGCATGTCGCTGGCATCAGCCACGCCGCGCGACATGCAC
ATGCGGCAAGCGGCTCTCAAGAAGGAGCTCCTGGCCGGCCTTGCCGCACTGCCCAAGCCCAAGGAGCAAGAGTGG
GAGTTTGACGTGCCCGACGAGCAGCAAGAGCCAGCCTCGACGACGCAGACGCAGCCCGAGGACGCGGCCGAGCGC
GACGCGCGCCAGAGGGAGCGACTGGCGGCACAGGAGGAACTGGAGCGCCGGCGCCGCAGCCAAGTCTTGCAGCGC
GGACTGCCGCGCCCGGCGCTGGTGGACTGCACGCGCCTGCTCAAGGATGCCGACGAGCTGGGCGACGAGGCCGAG
GCTCTGATTGCGCGGGAGGCTGTGGCGCTCATGGCGGCTGATGCGGCCAAGTATCCGCTCCCGGGCGGCGAGGTG
CGAGGCGTGGCGCCGCGGCTGCAAGAGATTGACGACGGGGCGCTGGCCAAGGCGCGGCTGGCCATTTTGTCCGAG
ACGAAGACGCTGCCGAGCAGCGAGCATGTGGAGTTTTACTTTGAGGGGCGGGCGGGCGACGCGACGCTGCTTGGG
CTGGGGTGCTATACCGATGACGCTGGGGAGCAAGAGGCGGCCATGCGCGCCCAATTTGACCTCATGCAAGAATCC
ATCATGTCTACGGCCGAGCAAGGCGCCAAGCTGGAAAAGAAGCTCTCTCTCCGCCTCGGCGGCTACCAAAAGCGA
CACAAGACGCTGAGCGACAAAATACGCGACGCATACCAAGCCCTGGAGCGCGCGCAGAGTGCGTATACAGGGCTC
GAGACGCTGGCGGTGGCGGAAGACGTGGCGGTGGAGCGGCGGCTGGGCGCGCTGCGTGACGAGGTGGAGTTTATT
AGTCGGCGGGAAAGGGAGGCGCAGCAAGAGTATCGCAAGGCGAGGGATGAGTTGGATGGGCTCAGGGGCAAGTAA
Gene >OphauB2|3871
ATGCCCGTCGTCAAGGGCGGCGTGTGGACCAACATTGAGGATGAGACGCTCAAGGCGGCCGTGTCGAAATATGGC
CTCAACCAATGGGCCCGCGTCTCGTCTCTGCTGGCGCGCAAGACGCCCAAGCAATGCAAGGCGCGGTGGAACGAA
TGGCTGGATCCGAGCATCAAGAAGATTGAATGGAGCAAAGACGAAGACGAGAAGCTGCTGCACCTGGCCAAGATT
ATGCCCACGCAATGGCGCACCATTGCCCCGATTGTAGGGCGCACGGCCAACCAGTGCCTGGAGCGCTATCAGAAA
CTTCTGGACGAGGCTGAAGCGCGCGAGGCGTCGGCGCTGGGTCTGGCGGGCCCGGACGGGGCAGAGACACAGGCC
CCCAGTGCTGACGATGTGCGGCGTCTGCGGCCCGGAGAAGTGGACCCCGACCCTGAGACGAAGCCGGCGCGTCCA
GACACGGTGGACCTGGACGAGGACGAAAAGGAAATGCTGAGCGAGGCGCGTGCTCGGCTGGCGAATACACAGGGC
AAAAAGGCAAAACGCAAGGCTCGAGAGCGCCAGCAAGAAGAGTCGCGGCGGCTGGCTACCCTGCAGAAGCGACGC
GAGCTCAAGACGGCGGGCATCAATGTCAAGGTGACGACGCGCAAAAAGGGCGAGATGGACTACAATGCGGACATT
CCGTTTGAGAAGAAGGCAGCGCCCGGCTTCTTTGACACGTCGGAGGAGCAGCTTCGCAACGAGGCGCAGCGCAAG
GCGTTTGATCCGCAAAAGCAGCAGCTGGCCACGAAGCGCAAGGGCGACGGCGACGACGAGGCAGGGCGCAAGCGG
CGAAAGGGCGACAAGGAGGGCATGTCGGAGACGCAAAAGGCGGCCATCAAGGCTGGGCAGATGCAGAAGCTGCGC
GAGGCGGAGCAAAACAGCAAACGACGGCCGCTCAGCCTGCCGGCTCCGCAAATCGGCCAGGGCGAGCTCGAGGAC
ATTGTCAAGATGGGCAAACTGGGCGAGGCGGCCAGCAGCTCTGCGCTCGAGGGCGAAAACGACGCGACACGCGGC
CTCGTCACCTCGTACGACTCTCTCAACCCGAGCGCGCCCATTCGAACGCCCCGGGTACCCGAGCAGCAGGACCAC
ATTGCCAATGAGATTCGCAACATTCGCGCCCTCAACGAGACCAAGTCGGCGCTGCTGGGGGGCGAGAACACGCCG
CTGCATCAAGGCGAGGGCTCAACGGGCTTCCAGAGCATCATGCCTCGCCAGCAAACCATGGCCACGCCCAACCCC
ATGGCCACACCGCTGACGAGGGGCATGGACGGCGCTGCAGCGACGCCTCTGCGGCCAGGCCAGACGCCAATGCGA
ACGCCGCGCGACACATATGCCCTCAACCAAGACGGCGGCATGTCGCTGGCATCAGCCACGCCGCGCGACATGCAC
ATGCGGCAAGCGGCTCTCAAGAAGGAGCTCCTGGCCGGCCTTGCCGCACTGCCCAAGCCCAAGGAGCAAGAGTGG
GAGTTTGACGTGCCCGACGAGCAGCAAGAGCCAGCCTCGACGACGCAGACGCAGCCCGAGGACGCGGCCGAGCGC
GACGCGCGCCAGAGGGAGCGACTGGCGGCACAGGAGGAACTGGAGCGCCGGCGCCGCAGCCAAGTCTTGCAGCGC
GGACTGCCGCGCCCGGCGCTGGTGGACTGCACGCGCCTGCTCAAGGATGCCGACGAGCTGGGCGACGAGGCCGAG
GCTCTGATTGCGCGGGAGGCTGTGGCGCTCATGGCGGCTGATGCGGCCAAGTATCCGCTCCCGGGCGGCGAGGTG
CGAGGCGTGGCGCCGCGGCTGCAAGAGATTGACGACGGGGCGCTGGCCAAGGCGCGGCTGGCCATTTTGTCCGAG
ACGAAGACGCTGCCGAGCAGCGAGCATGTGGAGTTTTACTTTGAGGGGCGGGCGGGCGACGCGACGCTGCTTGGG
CTGGGGTGCTATACCGATGACGCTGGGGAGCAAGAGGCGGCCATGCGCGCCCAATTTGACGCGAGTTTTTTTTTT
TTTTTTCCCTTTTTTTTTCCCTCTTCATCTCCACGATTTCTTCTTTGCGAGTTGTATCTACTGACACGCCCTCGT
CCTCGTACAGCTCATGCAAGAATCCATCATGTCTACGGCCGAGCAAGGCGCCAAGCTGGAAAAGAAGCTCTCTCT
CCGCCTCGGCGGCTACCAAAAGCGACACAAGACGCTGAGCGACAAAATACGCGACGCATACCAAGCCCTGGAGCG
CGCGCAGAGTGCGTATACAGGGCTCGAGACGCTGGCGGTGGCGGAAGACGTGGCGGTGGAGCGGCGGCTGGGCGC
GCTGCGTGACGAGGTGGAGTTTATTAGTCGGCGGGAAAGGGAGGCGCAGCAAGAGTATCGCAAGGCGAGGGATGA
GTTGGATGGGCTCAGGGGCAAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail