Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3865
Gene name
LocationContig_25:21037..23209
Strand-
Gene length (bp)2172
Transcript length (bp)2085
Coding sequence length (bp)2085
Protein length (aa) 695

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11701 UNC45-central Myosin-binding striated muscle assembly central 1.1E-53 62 239

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74994|RNG3_SCHPO Ring assembly protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rng3 PE=4 SV=1 328 672 1.0E-31
sp|Q9H3U1|UN45A_HUMAN Protein unc-45 homolog A OS=Homo sapiens GN=UNC45A PE=1 SV=1 279 648 6.0E-30
sp|Q5RAP0|UN45A_PONAB Protein unc-45 homolog A OS=Pongo abelii GN=UNC45A PE=2 SV=1 279 648 1.0E-29
sp|Q99KD5|UN45A_MOUSE Protein unc-45 homolog A OS=Mus musculus GN=Unc45a PE=1 SV=2 279 657 2.0E-29
sp|Q32PZ3|UN45A_RAT Protein unc-45 homolog A OS=Rattus norvegicus GN=Unc45a PE=2 SV=1 279 648 8.0E-28
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74994|RNG3_SCHPO Ring assembly protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rng3 PE=4 SV=1 328 672 1.0E-31
sp|Q9H3U1|UN45A_HUMAN Protein unc-45 homolog A OS=Homo sapiens GN=UNC45A PE=1 SV=1 279 648 6.0E-30
sp|Q5RAP0|UN45A_PONAB Protein unc-45 homolog A OS=Pongo abelii GN=UNC45A PE=2 SV=1 279 648 1.0E-29
sp|Q99KD5|UN45A_MOUSE Protein unc-45 homolog A OS=Mus musculus GN=Unc45a PE=1 SV=2 279 657 2.0E-29
sp|Q32PZ3|UN45A_RAT Protein unc-45 homolog A OS=Rattus norvegicus GN=Unc45a PE=2 SV=1 279 648 8.0E-28
sp|Q6DGE9|UN45B_DANRE Protein unc-45 homolog B OS=Danio rerio GN=unc45b PE=1 SV=2 285 692 6.0E-25
sp|D7REX8|UN45B_XENTR Protein unc-45 homolog B OS=Xenopus tropicalis GN=unc45b PE=1 SV=1 285 686 9.0E-25
sp|Q8CGY6|UN45B_MOUSE Protein unc-45 homolog B OS=Mus musculus GN=Unc45b PE=1 SV=1 285 686 2.0E-23
sp|Q68F64|UN45B_XENLA Protein unc-45 homolog B OS=Xenopus laevis GN=unc45b PE=2 SV=1 285 686 4.0E-23
sp|Q8IWX7|UN45B_HUMAN Protein unc-45 homolog B OS=Homo sapiens GN=UNC45B PE=1 SV=1 285 686 6.0E-22
sp|P51534|SHE4_YEAST SWI5-dependent HO expression protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SHE4 PE=1 SV=2 126 665 3.0E-21
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

Domain # Start End Length
1 118 140 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3865
MATTQSLEDQTLLAFAQLMEGGQEDDETCRELDALTKLLNDDYQAGEANPQHQTICRVIDGDCVDTVLGYLDMRQ
PDSVRAHATLATSAYLKAAGQDGSKKLSAFFFDRVRRGTYDDYIVAFCVASAIFPVVPELSATLFLSEGFLGSLG
PLMRREWKSRKVETACLEMLNAACMNALCRDAVQKYCVDWLEEVVDQHPQGSEAAPGAEAKVQGEGGSISMRRHS
EQVQHLAAVILAKLRAVPSKPPPDGQPRRRVEPAVTSIQDLSAIFTKMMLRDSDEGTQHSVEGLAYASLQPSVKE
SLTADAALLDKLVDTLSQAPPKSPTTYGVLSIFLNLVRYRPRLTDQETKMQQLQAYANAAGGKSAPQDPLDDEEH
VGARCRAVFAAGLVPVLVTHSKNGSPASLSLIVSIIHALAATKSLGAPLAQQGAVKLLLAAWTALAKTDEASRRT
AAQALARILIGTNPALVFGGNRPTPITAAIRPLGSLLAPDATAERRDLLPTFEALLALTNLASLDDDDTRRAIIK
LCWPDVEEHVVSSNQLVAKAAVELVCNLVQAPDGVALYADAASPQASTRLHVLLALADADHVGIRSAAGGALASL
SGFEPVVRAIVQRERGVDVLLGLCADEDQSLRHRGVVALYNLVAADGEAGVLARQKVKQQDGVNVLKDCIKQSRN
PDVVQTAAEALGALLAEQP*
Coding >OphauB2|3865
ATGGCGACGACGCAGTCCCTCGAGGACCAGACCCTGCTGGCCTTTGCGCAGCTCATGGAAGGCGGGCAGGAAGAC
GACGAGACGTGCCGTGAGCTGGATGCTCTCACCAAGCTCCTCAATGACGACTACCAGGCGGGCGAGGCCAACCCG
CAGCACCAGACGATTTGCCGCGTGATTGACGGCGACTGCGTGGACACGGTGCTGGGCTATCTGGACATGCGGCAG
CCGGATTCGGTGCGCGCGCACGCCACGCTGGCCACGTCTGCCTATCTCAAGGCGGCAGGCCAAGACGGCTCCAAG
AAGCTGTCGGCCTTTTTCTTTGACCGGGTGCGGCGCGGCACATATGACGACTACATTGTGGCCTTTTGCGTGGCG
TCGGCCATCTTCCCCGTTGTGCCTGAGCTGTCGGCAACGCTCTTTCTCAGCGAGGGCTTCCTCGGCTCTCTCGGC
CCTCTAATGAGGCGCGAGTGGAAGAGCCGCAAGGTGGAGACGGCCTGTCTGGAAATGCTCAATGCCGCCTGCATG
AATGCCCTGTGCCGCGACGCGGTGCAAAAGTACTGCGTCGACTGGCTCGAGGAGGTTGTGGACCAGCATCCCCAG
GGCTCAGAGGCGGCTCCCGGCGCCGAGGCCAAGGTGCAGGGCGAGGGCGGCTCCATTTCCATGCGCCGCCACTCG
GAGCAGGTGCAGCACTTGGCTGCCGTCATCCTGGCCAAGCTGAGGGCAGTGCCCTCGAAGCCGCCGCCCGACGGC
CAGCCAAGACGCCGGGTTGAGCCGGCCGTCACCAGCATCCAAGACTTGTCCGCCATTTTCACCAAGATGATGTTG
CGTGACTCGGACGAGGGCACCCAGCATTCCGTCGAGGGCCTCGCCTATGCCTCGCTGCAGCCAAGTGTCAAGGAA
TCCTTGACTGCCGACGCGGCCCTGCTTGACAAACTCGTAGACACTCTCTCCCAAGCCCCTCCCAAGTCGCCAACC
ACTTATGGCGTCTTGAGCATCTTCCTCAACCTTGTGCGGTACCGCCCTCGCCTGACTGACCAAGAGACCAAGATG
CAGCAGTTGCAGGCCTATGCCAATGCGGCAGGCGGCAAGTCAGCTCCCCAGGACCCTCTAGACGATGAAGAGCAC
GTTGGCGCGCGCTGTCGAGCCGTCTTTGCCGCTGGCCTTGTTCCCGTCTTGGTGACGCACAGCAAGAATGGCTCG
CCAGCGTCTTTGAGCCTCATTGTCTCCATTATCCACGCCCTGGCCGCCACCAAGAGCCTCGGCGCCCCCCTGGCT
CAGCAAGGCGCCGTCAAGCTGCTCCTTGCTGCCTGGACGGCGCTGGCCAAGACGGACGAGGCGTCGCGCCGCACC
GCCGCCCAGGCGCTTGCCCGCATCCTCATTGGCACCAACCCAGCCCTCGTCTTTGGCGGCAACCGCCCCACGCCC
ATTACTGCCGCCATTCGCCCGCTGGGATCCCTCTTGGCGCCCGACGCCACGGCCGAGAGGCGCGACCTGTTGCCC
ACGTTTGAAGCCCTCTTGGCCCTGACCAATTTAGCCTCGCTCGACGACGACGACACGCGCCGCGCCATCATCAAG
CTCTGCTGGCCCGACGTGGAGGAACACGTGGTGTCGTCGAACCAGCTCGTGGCCAAGGCAGCCGTGGAACTCGTC
TGCAACTTGGTCCAGGCCCCCGACGGCGTGGCCCTCTACGCCGACGCTGCGAGCCCCCAGGCCAGCACCCGGCTC
CATGTCTTGCTCGCCCTGGCGGACGCGGACCATGTGGGCATTCGCAGCGCCGCGGGGGGTGCGCTGGCGTCGCTT
TCGGGCTTTGAGCCCGTGGTGCGTGCCATTGTGCAGCGCGAGCGCGGCGTCGACGTGCTGCTGGGCCTGTGCGCC
GACGAGGACCAGAGTCTGCGGCATCGTGGCGTCGTGGCCCTGTACAACTTGGTGGCGGCTGATGGCGAGGCGGGT
GTGCTGGCGCGCCAAAAGGTGAAGCAGCAGGACGGCGTCAATGTGCTCAAGGATTGCATCAAGCAGAGCCGCAAC
CCCGACGTGGTGCAGACGGCGGCCGAGGCTCTCGGGGCGCTCTTGGCGGAACAGCCTTGA
Transcript >OphauB2|3865
ATGGCGACGACGCAGTCCCTCGAGGACCAGACCCTGCTGGCCTTTGCGCAGCTCATGGAAGGCGGGCAGGAAGAC
GACGAGACGTGCCGTGAGCTGGATGCTCTCACCAAGCTCCTCAATGACGACTACCAGGCGGGCGAGGCCAACCCG
CAGCACCAGACGATTTGCCGCGTGATTGACGGCGACTGCGTGGACACGGTGCTGGGCTATCTGGACATGCGGCAG
CCGGATTCGGTGCGCGCGCACGCCACGCTGGCCACGTCTGCCTATCTCAAGGCGGCAGGCCAAGACGGCTCCAAG
AAGCTGTCGGCCTTTTTCTTTGACCGGGTGCGGCGCGGCACATATGACGACTACATTGTGGCCTTTTGCGTGGCG
TCGGCCATCTTCCCCGTTGTGCCTGAGCTGTCGGCAACGCTCTTTCTCAGCGAGGGCTTCCTCGGCTCTCTCGGC
CCTCTAATGAGGCGCGAGTGGAAGAGCCGCAAGGTGGAGACGGCCTGTCTGGAAATGCTCAATGCCGCCTGCATG
AATGCCCTGTGCCGCGACGCGGTGCAAAAGTACTGCGTCGACTGGCTCGAGGAGGTTGTGGACCAGCATCCCCAG
GGCTCAGAGGCGGCTCCCGGCGCCGAGGCCAAGGTGCAGGGCGAGGGCGGCTCCATTTCCATGCGCCGCCACTCG
GAGCAGGTGCAGCACTTGGCTGCCGTCATCCTGGCCAAGCTGAGGGCAGTGCCCTCGAAGCCGCCGCCCGACGGC
CAGCCAAGACGCCGGGTTGAGCCGGCCGTCACCAGCATCCAAGACTTGTCCGCCATTTTCACCAAGATGATGTTG
CGTGACTCGGACGAGGGCACCCAGCATTCCGTCGAGGGCCTCGCCTATGCCTCGCTGCAGCCAAGTGTCAAGGAA
TCCTTGACTGCCGACGCGGCCCTGCTTGACAAACTCGTAGACACTCTCTCCCAAGCCCCTCCCAAGTCGCCAACC
ACTTATGGCGTCTTGAGCATCTTCCTCAACCTTGTGCGGTACCGCCCTCGCCTGACTGACCAAGAGACCAAGATG
CAGCAGTTGCAGGCCTATGCCAATGCGGCAGGCGGCAAGTCAGCTCCCCAGGACCCTCTAGACGATGAAGAGCAC
GTTGGCGCGCGCTGTCGAGCCGTCTTTGCCGCTGGCCTTGTTCCCGTCTTGGTGACGCACAGCAAGAATGGCTCG
CCAGCGTCTTTGAGCCTCATTGTCTCCATTATCCACGCCCTGGCCGCCACCAAGAGCCTCGGCGCCCCCCTGGCT
CAGCAAGGCGCCGTCAAGCTGCTCCTTGCTGCCTGGACGGCGCTGGCCAAGACGGACGAGGCGTCGCGCCGCACC
GCCGCCCAGGCGCTTGCCCGCATCCTCATTGGCACCAACCCAGCCCTCGTCTTTGGCGGCAACCGCCCCACGCCC
ATTACTGCCGCCATTCGCCCGCTGGGATCCCTCTTGGCGCCCGACGCCACGGCCGAGAGGCGCGACCTGTTGCCC
ACGTTTGAAGCCCTCTTGGCCCTGACCAATTTAGCCTCGCTCGACGACGACGACACGCGCCGCGCCATCATCAAG
CTCTGCTGGCCCGACGTGGAGGAACACGTGGTGTCGTCGAACCAGCTCGTGGCCAAGGCAGCCGTGGAACTCGTC
TGCAACTTGGTCCAGGCCCCCGACGGCGTGGCCCTCTACGCCGACGCTGCGAGCCCCCAGGCCAGCACCCGGCTC
CATGTCTTGCTCGCCCTGGCGGACGCGGACCATGTGGGCATTCGCAGCGCCGCGGGGGGTGCGCTGGCGTCGCTT
TCGGGCTTTGAGCCCGTGGTGCGTGCCATTGTGCAGCGCGAGCGCGGCGTCGACGTGCTGCTGGGCCTGTGCGCC
GACGAGGACCAGAGTCTGCGGCATCGTGGCGTCGTGGCCCTGTACAACTTGGTGGCGGCTGATGGCGAGGCGGGT
GTGCTGGCGCGCCAAAAGGTGAAGCAGCAGGACGGCGTCAATGTGCTCAAGGATTGCATCAAGCAGAGCCGCAAC
CCCGACGTGGTGCAGACGGCGGCCGAGGCTCTCGGGGCGCTCTTGGCGGAACAGCCTTGA
Gene >OphauB2|3865
ATGGCGACGACGCAGTCCCTCGAGGACCAGACCCTGCTGGCCTTTGCGCAGCTCATGGAAGGCGGGCAGGAAGAC
GACGAGACGTGCCGTGAGCTGGATGCTCTCACCAAGCTCCTCAATGACGACTACCAGGCGGGCGAGGCCAACCCG
CAGCACCAGACGATTTGCCGCGTGATTGACGGCGACTGCGTGGACACGGTGCTGGGCTATCTGGACATGCGGCAG
CCGGATTCGGTGCGCGCGCACGCCACGCTGGCCACGTCTGCCTATCTCAAGGCGGCAGGCCAAGACGGCTCCAAG
AAGCTGTCGGCCTTTTTCTTTGACCGGGTGCGGCGCGGCACATATGACGACTACATTGTGGCCTTTTGCGTGGCG
TCGGCCATCTTCCCCGTTGTGCCTGAGCTGTCGGCAACGCTCTTTCTCAGCGAGGGCTTCCTCGGCTCTCTCGGC
CCTCTAATGAGGCGCGAGTGGAAGAGCCGCAAGGTGGAGACGGCCTGTCTGGAAATGCTCAATGCCGCCTGCATG
AATGCCCTGTGCCGCGACGCGGTGCAAAAGTACTGCGTCGACTGGCTCGAGGAGGTTGTGGACCAGCATCCCCAG
GGCTCAGAGGCGGCTCCCGGCGCCGAGGCCAAGGTGCAGGGCGAGGGCGGCTCCATTTCCATGCGCCGCCACTCG
GAGCAGGTGCAGCACTTGGCTGCCGTCATCCTGGCCAAGCTGAGGGTGGGTGAAAAGTCTGCTGCCGCACAAGCA
CTCTGAAGTCGAGCCTCACTTGCTCTCTCACGCGACTGACTGAGGCGGAGCTAAAAGGCAGTGCCCTCGAAGCCG
CCGCCCGACGGCCAGCCAAGACGCCGGGTTGAGCCGGCCGTCACCAGCATCCAAGACTTGTCCGCCATTTTCACC
AAGATGATGTTGCGTGACTCGGACGAGGGCACCCAGCATTCCGTCGAGGGCCTCGCCTATGCCTCGCTGCAGCCA
AGTGTCAAGGAATCCTTGACTGCCGACGCGGCCCTGCTTGACAAACTCGTAGACACTCTCTCCCAAGCCCCTCCC
AAGTCGCCAACCACTTATGGCGTCTTGAGCATCTTCCTCAACCTTGTGCGGTACCGCCCTCGCCTGACTGACCAA
GAGACCAAGATGCAGCAGTTGCAGGCCTATGCCAATGCGGCAGGCGGCAAGTCAGCTCCCCAGGACCCTCTAGAC
GATGAAGAGCACGTTGGCGCGCGCTGTCGAGCCGTCTTTGCCGCTGGCCTTGTTCCCGTCTTGGTGACGCACAGC
AAGAATGGCTCGCCAGCGTCTTTGAGCCTCATTGTCTCCATTATCCACGCCCTGGCCGCCACCAAGAGCCTCGGC
GCCCCCCTGGCTCAGCAAGGCGCCGTCAAGCTGCTCCTTGCTGCCTGGACGGCGCTGGCCAAGACGGACGAGGCG
TCGCGCCGCACCGCCGCCCAGGCGCTTGCCCGCATCCTCATTGGCACCAACCCAGCCCTCGTCTTTGGCGGCAAC
CGCCCCACGCCCATTACTGCCGCCATTCGCCCGCTGGGATCCCTCTTGGCGCCCGACGCCACGGCCGAGAGGCGC
GACCTGTTGCCCACGTTTGAAGCCCTCTTGGCCCTGACCAATTTAGCCTCGCTCGACGACGACGACACGCGCCGC
GCCATCATCAAGCTCTGCTGGCCCGACGTGGAGGAACACGTGGTGTCGTCGAACCAGCTCGTGGCCAAGGCAGCC
GTGGAACTCGTCTGCAACTTGGTCCAGGCCCCCGACGGCGTGGCCCTCTACGCCGACGCTGCGAGCCCCCAGGCC
AGCACCCGGCTCCATGTCTTGCTCGCCCTGGCGGACGCGGACCATGTGGGCATTCGCAGCGCCGCGGGGGGTGCG
CTGGCGTCGCTTTCGGGCTTTGAGCCCGTGGTGCGTGCCATTGTGCAGCGCGAGCGCGGCGTCGACGTGCTGCTG
GGCCTGTGCGCCGACGAGGACCAGAGTCTGCGGCATCGTGGCGTCGTGGCCCTGTACAACTTGGTGGCGGCTGAT
GGCGAGGCGGGTGTGCTGGCGCGCCAAAAGGTGAAGCAGCAGGACGGCGTCAATGTGCTCAAGGATTGCATCAAG
CAGAGCCGCAACCCCGACGTGGTGCAGACGGCGGCCGAGGCTCTCGGGGCGCTCTTGGCGGAACAGCCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail