Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3852
Gene name
LocationContig_248:15121..16594
Strand-
Gene length (bp)1473
Transcript length (bp)1173
Coding sequence length (bp)1173
Protein length (aa) 391

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00549 Ligase_CoA CoA-ligase 1.2E-15 258 352
PF08442 ATP-grasp_2 ATP-grasp domain 2.8E-09 30 197

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P567|SUCB_NEUCR Probable succinyl-CoA ligase [GDP-forming] subunit beta, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B9J10.140 PE=3 SV=1 19 382 2.0E-62
sp|P53587|SUCB_NEOFR Succinyl-CoA ligase [GDP-forming] subunit beta, hydrogenosomal OS=Neocallimastix frontalis GN=SCSB PE=2 SV=2 15 382 8.0E-61
sp|Q2GEF1|SUCC_NEOSM Succinyl-CoA ligase [ADP-forming] subunit beta OS=Neorickettsia sennetsu (strain Miyayama) GN=sucC PE=3 SV=1 115 380 3.0E-60
sp|Q869S7|SUCB2_DICDI Succinyl-CoA ligase [GDP-forming] subunit beta, mitochondrial OS=Dictyostelium discoideum GN=scsB PE=3 SV=1 15 379 6.0E-60
sp|O97580|SUCB1_PIG Succinyl-CoA ligase [ADP-forming] subunit beta, mitochondrial (Fragment) OS=Sus scrofa GN=SUCLA2 PE=2 SV=1 26 382 6.0E-58
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P567|SUCB_NEUCR Probable succinyl-CoA ligase [GDP-forming] subunit beta, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B9J10.140 PE=3 SV=1 19 382 2.0E-62
sp|P53587|SUCB_NEOFR Succinyl-CoA ligase [GDP-forming] subunit beta, hydrogenosomal OS=Neocallimastix frontalis GN=SCSB PE=2 SV=2 15 382 8.0E-61
sp|Q2GEF1|SUCC_NEOSM Succinyl-CoA ligase [ADP-forming] subunit beta OS=Neorickettsia sennetsu (strain Miyayama) GN=sucC PE=3 SV=1 115 380 3.0E-60
sp|Q869S7|SUCB2_DICDI Succinyl-CoA ligase [GDP-forming] subunit beta, mitochondrial OS=Dictyostelium discoideum GN=scsB PE=3 SV=1 15 379 6.0E-60
sp|O97580|SUCB1_PIG Succinyl-CoA ligase [ADP-forming] subunit beta, mitochondrial (Fragment) OS=Sus scrofa GN=SUCLA2 PE=2 SV=1 26 382 6.0E-58
sp|A1AZH7|SUCC_PARDP Succinyl-CoA ligase [ADP-forming] subunit beta OS=Paracoccus denitrificans (strain Pd 1222) GN=sucC PE=3 SV=1 28 379 4.0E-57
sp|Q55AI5|SUCB1_DICDI Succinyl-CoA ligase [ADP-forming] subunit beta, mitochondrial OS=Dictyostelium discoideum GN=scsC PE=3 SV=1 26 382 4.0E-57
sp|Q6MGW1|SUCC_BDEBA Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=sucC PE=3 SV=1 28 359 4.0E-57
sp|Q148D5|SUCB1_BOVIN Succinyl-CoA ligase [ADP-forming] subunit beta, mitochondrial OS=Bos taurus GN=SUCLA2 PE=2 SV=1 26 382 7.0E-57
sp|Q9Z2I9|SUCB1_MOUSE Succinyl-CoA ligase [ADP-forming] subunit beta, mitochondrial OS=Mus musculus GN=Sucla2 PE=1 SV=2 6 382 1.0E-56
sp|Q03184|SUCB_TRIVA Succinyl-CoA ligase [GDP-forming] subunit beta, hydrogenosomal OS=Trichomonas vaginalis PE=1 SV=1 81 358 2.0E-56
sp|A4WNM6|SUCC_RHOS5 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=sucC PE=3 SV=1 28 379 3.0E-56
sp|A1UQV9|SUCC_BARBK Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=sucC PE=3 SV=1 116 378 4.0E-56
sp|Q2IIC1|SUCC_ANADE Succinyl-CoA ligase [ADP-forming] subunit beta OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=sucC PE=3 SV=1 28 381 5.0E-56
sp|P53588|SUCB1_CAEEL Probable succinyl-CoA ligase [ADP-forming] subunit beta, mitochondrial OS=Caenorhabditis elegans GN=F47B10.1 PE=3 SV=1 8 381 7.0E-56
sp|A7I2F2|SUCC_CAMHC Succinyl-CoA ligase [ADP-forming] subunit beta OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=sucC PE=3 SV=1 28 380 9.0E-56
sp|B0T3D1|SUCC_CAUSK Succinyl-CoA ligase [ADP-forming] subunit beta OS=Caulobacter sp. (strain K31) GN=sucC PE=3 SV=1 115 379 1.0E-55
sp|B2SYE8|SUCC_BURPP Succinyl-CoA ligase [ADP-forming] subunit beta OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=sucC PE=3 SV=1 149 357 1.0E-55
sp|Q07UX6|SUCC_RHOP5 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rhodopseudomonas palustris (strain BisA53) GN=sucC PE=3 SV=1 115 379 1.0E-55
sp|B4UDP4|SUCC_ANASK Succinyl-CoA ligase [ADP-forming] subunit beta OS=Anaeromyxobacter sp. (strain K) GN=sucC PE=3 SV=1 28 381 2.0E-55
sp|B8JAE0|SUCC_ANAD2 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=sucC PE=3 SV=1 28 381 2.0E-55
sp|Q13UH9|SUCC_BURXL Succinyl-CoA ligase [ADP-forming] subunit beta OS=Burkholderia xenovorans (strain LB400) GN=sucC PE=3 SV=1 149 357 2.0E-55
sp|Q9P2R7|SUCB1_HUMAN Succinyl-CoA ligase [ADP-forming] subunit beta, mitochondrial OS=Homo sapiens GN=SUCLA2 PE=1 SV=3 26 382 2.0E-55
sp|A8MM16|SUCC_ALKOO Succinyl-CoA ligase [ADP-forming] subunit beta OS=Alkaliphilus oremlandii (strain OhILAs) GN=sucC PE=3 SV=1 28 380 2.0E-55
sp|Q8A9M7|SUCC_BACTN Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=sucC PE=3 SV=1 28 379 2.0E-55
sp|P66868|SUCC_BRUSU Succinyl-CoA ligase [ADP-forming] subunit beta OS=Brucella suis biovar 1 (strain 1330) GN=sucC PE=3 SV=1 116 375 4.0E-55
sp|B0CIT0|SUCC_BRUSI Succinyl-CoA ligase [ADP-forming] subunit beta OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=sucC PE=3 SV=1 116 375 4.0E-55
sp|A5VSQ3|SUCC_BRUO2 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=sucC PE=3 SV=1 116 375 4.0E-55
sp|P66867|SUCC_BRUME Succinyl-CoA ligase [ADP-forming] subunit beta OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=sucC PE=3 SV=1 116 375 4.0E-55
sp|C0RFH1|SUCC_BRUMB Succinyl-CoA ligase [ADP-forming] subunit beta OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=sucC PE=3 SV=1 116 375 4.0E-55
sp|A9M8R2|SUCC_BRUC2 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=sucC PE=3 SV=1 116 375 4.0E-55
sp|Q57AX2|SUCC_BRUAB Succinyl-CoA ligase [ADP-forming] subunit beta OS=Brucella abortus biovar 1 (strain 9-941) GN=sucC PE=3 SV=1 116 375 4.0E-55
sp|B2S880|SUCC_BRUA1 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Brucella abortus (strain S19) GN=sucC PE=3 SV=1 116 375 4.0E-55
sp|Q4R517|SUCB1_MACFA Succinyl-CoA ligase [ADP-forming] subunit beta, mitochondrial OS=Macaca fascicularis GN=SUCLA2 PE=2 SV=1 26 382 5.0E-55
sp|Q9YI37|SUCB1_COLLI Succinyl-CoA ligase [ADP-forming] subunit beta, mitochondrial (Fragment) OS=Columba livia GN=SUCLA2 PE=1 SV=1 26 382 5.0E-55
sp|Q0I3A8|SUCC_HAES1 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Haemophilus somnus (strain 129Pt) GN=sucC PE=3 SV=1 156 383 6.0E-55
sp|B0UUF3|SUCC_HISS2 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Histophilus somni (strain 2336) GN=sucC PE=3 SV=1 156 383 1.0E-54
sp|A0RPE8|SUCC_CAMFF Succinyl-CoA ligase [ADP-forming] subunit beta OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=sucC PE=3 SV=1 28 383 1.0E-54
sp|Q6K9N6|SUCB_ORYSJ Succinyl-CoA ligase [ADP-forming] subunit beta, mitochondrial OS=Oryza sativa subsp. japonica GN=Os02g0621700 PE=1 SV=1 86 379 2.0E-54
sp|B9KNB3|SUCC_RHOSK Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=sucC PE=3 SV=1 28 379 2.0E-54
sp|Q3IZ84|SUCC_RHOS4 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=sucC PE=3 SV=1 28 379 2.0E-54
sp|A3PN13|SUCC_RHOS1 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=sucC PE=3 SV=1 28 379 2.0E-54
sp|P53312|SUCB_YEAST Succinyl-CoA ligase [ADP-forming] subunit beta, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LSC2 PE=1 SV=1 81 382 2.0E-54
sp|B3CME9|SUCC_WOLPP Succinyl-CoA ligase [ADP-forming] subunit beta OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=sucC PE=3 SV=1 131 379 4.0E-54
sp|B2UMH5|SUCC_AKKM8 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=sucC PE=3 SV=1 76 357 5.0E-54
sp|A0KA72|SUCC_BURCH Succinyl-CoA ligase [ADP-forming] subunit beta OS=Burkholderia cenocepacia (strain HI2424) GN=sucC PE=3 SV=1 147 357 5.0E-54
sp|B1JY14|SUCC_BURCC Succinyl-CoA ligase [ADP-forming] subunit beta OS=Burkholderia cenocepacia (strain MC0-3) GN=sucC PE=3 SV=1 147 357 5.0E-54
sp|Q1BTW6|SUCC_BURCA Succinyl-CoA ligase [ADP-forming] subunit beta OS=Burkholderia cenocepacia (strain AU 1054) GN=sucC PE=3 SV=1 147 357 5.0E-54
sp|Q6G1M1|SUCC_BARHE Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=sucC PE=3 SV=1 116 378 6.0E-54
sp|B4EBY6|SUCC_BURCJ Succinyl-CoA ligase [ADP-forming] subunit beta OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=sucC PE=3 SV=1 147 357 1.0E-53
sp|Q2RV33|SUCC_RHORT Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=sucC PE=3 SV=1 115 383 1.0E-53
sp|B3CTW0|SUCC_ORITI Succinyl-CoA ligase [ADP-forming] subunit beta OS=Orientia tsutsugamushi (strain Ikeda) GN=sucC PE=3 SV=1 100 379 1.0E-53
sp|Q21CW8|SUCC_RHOPB Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rhodopseudomonas palustris (strain BisB18) GN=sucC PE=3 SV=1 28 383 1.0E-53
sp|O82662|SUCB_ARATH Succinyl-CoA ligase [ADP-forming] subunit beta, mitochondrial OS=Arabidopsis thaliana GN=At2g20420 PE=1 SV=1 86 379 2.0E-53
sp|Q9AB94|SUCC_CAUCR Succinyl-CoA ligase [ADP-forming] subunit beta OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=sucC PE=3 SV=1 115 375 2.0E-53
sp|B8GYZ1|SUCC_CAUCN Succinyl-CoA ligase [ADP-forming] subunit beta OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=sucC PE=3 SV=1 115 375 2.0E-53
sp|A7HT39|SUCC_PARL1 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=sucC PE=3 SV=1 116 357 2.0E-53
sp|Q39D96|SUCC_BURL3 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=sucC PE=3 SV=1 147 357 2.0E-53
sp|A9AFT3|SUCC_BURM1 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=sucC PE=3 SV=1 147 357 3.0E-53
sp|A4JHJ8|SUCC_BURVG Succinyl-CoA ligase [ADP-forming] subunit beta OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=sucC PE=3 SV=1 147 357 3.0E-53
sp|B4RCH3|SUCC_PHEZH Succinyl-CoA ligase [ADP-forming] subunit beta OS=Phenylobacterium zucineum (strain HLK1) GN=sucC PE=3 SV=1 115 379 4.0E-53
sp|Q0BC71|SUCC_BURCM Succinyl-CoA ligase [ADP-forming] subunit beta OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=sucC PE=3 SV=1 147 357 4.0E-53
sp|B1YVY6|SUCC_BURA4 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Burkholderia ambifaria (strain MC40-6) GN=sucC PE=3 SV=1 147 357 4.0E-53
sp|A4G230|SUCC_HERAR Succinyl-CoA ligase [ADP-forming] subunit beta OS=Herminiimonas arsenicoxydans GN=sucC PE=3 SV=1 116 382 5.0E-53
sp|B2UGE2|SUCC_RALPJ Succinyl-CoA ligase [ADP-forming] subunit beta OS=Ralstonia pickettii (strain 12J) GN=sucC PE=3 SV=1 116 357 5.0E-53
sp|O94415|SUCB_SCHPO Probable succinyl-CoA ligase [GDP-forming] subunit beta, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1620.08 PE=3 SV=1 115 390 6.0E-53
sp|Q11CV8|SUCC_CHESB Succinyl-CoA ligase [ADP-forming] subunit beta OS=Chelativorans sp. (strain BNC1) GN=sucC PE=3 SV=1 115 353 8.0E-53
sp|Q89X60|SUCC_BRADU Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=sucC PE=3 SV=1 115 366 8.0E-53
sp|Q5L0N7|SUCC_GEOKA Succinyl-CoA ligase [ADP-forming] subunit beta OS=Geobacillus kaustophilus (strain HTA426) GN=sucC PE=3 SV=1 28 380 8.0E-53
sp|A5CC52|SUCC_ORITB Succinyl-CoA ligase [ADP-forming] subunit beta OS=Orientia tsutsugamushi (strain Boryong) GN=sucC PE=3 SV=1 100 379 1.0E-52
sp|Q9PAH1|SUCC_XYLFA Succinyl-CoA ligase [ADP-forming] subunit beta OS=Xylella fastidiosa (strain 9a5c) GN=sucC PE=3 SV=1 28 378 1.0E-52
sp|A7GYI5|SUCC_CAMC5 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Campylobacter curvus (strain 525.92) GN=sucC PE=3 SV=1 28 382 1.0E-52
sp|B2AHC1|SUCC_CUPTR Succinyl-CoA ligase [ADP-forming] subunit beta OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=sucC PE=3 SV=1 116 357 1.0E-52
sp|A4IM83|SUCC_GEOTN Succinyl-CoA ligase [ADP-forming] subunit beta OS=Geobacillus thermodenitrificans (strain NG80-2) GN=sucC PE=3 SV=1 28 380 2.0E-52
sp|A6SUY3|SUCC_JANMA Succinyl-CoA ligase [ADP-forming] subunit beta OS=Janthinobacterium sp. (strain Marseille) GN=sucC PE=3 SV=1 116 382 2.0E-52
sp|A9IZV3|SUCC_BART1 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=sucC PE=3 SV=1 116 378 2.0E-52
sp|B3E7B3|SUCC_GEOLS Succinyl-CoA ligase [ADP-forming] subunit beta OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=sucC PE=3 SV=1 28 380 2.0E-52
sp|Q15UW6|SUCC_PSEA6 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=sucC PE=3 SV=1 156 381 2.0E-52
sp|Q5GSB6|SUCC_WOLTR Succinyl-CoA ligase [ADP-forming] subunit beta OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=sucC PE=3 SV=1 115 382 2.0E-52
sp|C0ZFB3|SUCC_BREBN Succinyl-CoA ligase [ADP-forming] subunit beta OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=sucC PE=3 SV=1 28 359 3.0E-52
sp|C0R4N4|SUCC_WOLWR Succinyl-CoA ligase [ADP-forming] subunit beta OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=sucC PE=3 SV=1 115 379 4.0E-52
sp|Q84LB6|SUCB_SOLLC Succinyl-CoA ligase [ADP-forming] subunit beta, mitochondrial OS=Solanum lycopersicum PE=1 SV=1 81 379 4.0E-52
sp|Q2T0U7|SUCC_BURTA Succinyl-CoA ligase [ADP-forming] subunit beta OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=sucC PE=3 SV=1 147 357 4.0E-52
sp|Q87A98|SUCC_XYLFT Succinyl-CoA ligase [ADP-forming] subunit beta OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=sucC PE=3 SV=1 28 378 4.0E-52
sp|B2I9R4|SUCC_XYLF2 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Xylella fastidiosa (strain M23) GN=sucC PE=3 SV=1 28 378 4.0E-52
sp|Q73FW3|SUCC_WOLPM Succinyl-CoA ligase [ADP-forming] subunit beta OS=Wolbachia pipientis wMel GN=sucC PE=3 SV=1 115 379 4.0E-52
sp|Q13DR5|SUCC_RHOPS Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rhodopseudomonas palustris (strain BisB5) GN=sucC PE=3 SV=1 115 366 5.0E-52
sp|A5FYZ9|SUCC_ACICJ Succinyl-CoA ligase [ADP-forming] subunit beta OS=Acidiphilium cryptum (strain JF-5) GN=sucC PE=3 SV=1 116 383 5.0E-52
sp|Q2YXM1|SUCC_STAAB Succinyl-CoA ligase [ADP-forming] subunit beta OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=sucC PE=3 SV=1 28 383 5.0E-52
sp|B1XRZ4|SUCC_POLNS Succinyl-CoA ligase [ADP-forming] subunit beta OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=sucC PE=3 SV=1 149 357 5.0E-52
sp|Q2G3G8|SUCC_NOVAD Succinyl-CoA ligase [ADP-forming] subunit beta OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=sucC PE=3 SV=1 115 386 6.0E-52
sp|Q63WW2|SUCC_BURPS Succinyl-CoA ligase [ADP-forming] subunit beta OS=Burkholderia pseudomallei (strain K96243) GN=sucC PE=3 SV=1 147 357 7.0E-52
sp|A3N693|SUCC_BURP6 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Burkholderia pseudomallei (strain 668) GN=sucC PE=3 SV=1 147 357 7.0E-52
sp|Q3JVL5|SUCC_BURP1 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Burkholderia pseudomallei (strain 1710b) GN=sucC PE=3 SV=1 147 357 7.0E-52
sp|A3NRX7|SUCC_BURP0 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Burkholderia pseudomallei (strain 1106a) GN=sucC PE=3 SV=1 147 357 7.0E-52
sp|A1V6W8|SUCC_BURMS Succinyl-CoA ligase [ADP-forming] subunit beta OS=Burkholderia mallei (strain SAVP1) GN=sucC PE=3 SV=1 147 357 7.0E-52
sp|Q62MG7|SUCC_BURMA Succinyl-CoA ligase [ADP-forming] subunit beta OS=Burkholderia mallei (strain ATCC 23344) GN=sucC PE=3 SV=1 147 357 7.0E-52
sp|A2S8U3|SUCC_BURM9 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Burkholderia mallei (strain NCTC 10229) GN=sucC PE=3 SV=1 147 357 7.0E-52
sp|A3MH60|SUCC_BURM7 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Burkholderia mallei (strain NCTC 10247) GN=sucC PE=3 SV=1 147 357 7.0E-52
sp|A6WXE8|SUCC_OCHA4 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=sucC PE=3 SV=1 116 375 7.0E-52
sp|A8EYY8|SUCC_RICCK Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rickettsia canadensis (strain McKiel) GN=sucC PE=3 SV=1 115 379 1.0E-51
sp|Q475M1|SUCC_CUPPJ Succinyl-CoA ligase [ADP-forming] subunit beta OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=sucC PE=3 SV=1 116 357 1.0E-51
sp|Q2S3H9|SUCC_SALRD Succinyl-CoA ligase [ADP-forming] subunit beta OS=Salinibacter ruber (strain DSM 13855 / M31) GN=sucC PE=3 SV=1 102 383 1.0E-51
sp|C5D8V2|SUCC_GEOSW Succinyl-CoA ligase [ADP-forming] subunit beta OS=Geobacillus sp. (strain WCH70) GN=sucC PE=3 SV=1 28 380 1.0E-51
sp|A9IKE3|SUCC_BORPD Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=sucC PE=3 SV=1 115 357 1.0E-51
sp|Q9Z2I8|SUCB2_MOUSE Succinyl-CoA ligase [GDP-forming] subunit beta, mitochondrial OS=Mus musculus GN=Suclg2 PE=1 SV=3 23 368 1.0E-51
sp|Q2J3G9|SUCC_RHOP2 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rhodopseudomonas palustris (strain HaA2) GN=sucC PE=3 SV=1 28 366 1.0E-51
sp|Q6GHJ0|SUCC_STAAR Succinyl-CoA ligase [ADP-forming] subunit beta OS=Staphylococcus aureus (strain MRSA252) GN=sucC PE=3 SV=1 156 383 1.0E-51
sp|B0U5F8|SUCC_XYLFM Succinyl-CoA ligase [ADP-forming] subunit beta OS=Xylella fastidiosa (strain M12) GN=sucC PE=3 SV=1 28 359 1.0E-51
sp|P66872|SUCC_STAAW Succinyl-CoA ligase [ADP-forming] subunit beta OS=Staphylococcus aureus (strain MW2) GN=sucC PE=3 SV=1 156 383 2.0E-51
sp|A8Z3S5|SUCC_STAAT Succinyl-CoA ligase [ADP-forming] subunit beta OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=sucC PE=3 SV=1 156 383 2.0E-51
sp|Q6G9W8|SUCC_STAAS Succinyl-CoA ligase [ADP-forming] subunit beta OS=Staphylococcus aureus (strain MSSA476) GN=sucC PE=3 SV=1 156 383 2.0E-51
sp|P99071|SUCC_STAAN Succinyl-CoA ligase [ADP-forming] subunit beta OS=Staphylococcus aureus (strain N315) GN=sucC PE=1 SV=1 156 383 2.0E-51
sp|P66871|SUCC_STAAM Succinyl-CoA ligase [ADP-forming] subunit beta OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=sucC PE=3 SV=1 156 383 2.0E-51
sp|A6QGE5|SUCC_STAAE Succinyl-CoA ligase [ADP-forming] subunit beta OS=Staphylococcus aureus (strain Newman) GN=sucC PE=3 SV=1 156 383 2.0E-51
sp|Q5HGI7|SUCC_STAAC Succinyl-CoA ligase [ADP-forming] subunit beta OS=Staphylococcus aureus (strain COL) GN=sucC PE=3 SV=1 156 383 2.0E-51
sp|A5ISD0|SUCC_STAA9 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Staphylococcus aureus (strain JH9) GN=sucC PE=3 SV=1 156 383 2.0E-51
sp|Q2FZ37|SUCC_STAA8 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Staphylococcus aureus (strain NCTC 8325) GN=sucC PE=3 SV=1 156 383 2.0E-51
sp|Q2FHJ3|SUCC_STAA3 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Staphylococcus aureus (strain USA300) GN=sucC PE=3 SV=1 156 383 2.0E-51
sp|A6U164|SUCC_STAA2 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Staphylococcus aureus (strain JH1) GN=sucC PE=3 SV=1 156 383 2.0E-51
sp|A7X1L8|SUCC_STAA1 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=sucC PE=3 SV=1 156 383 2.0E-51
sp|B1ZP17|SUCC_OPITP Succinyl-CoA ligase [ADP-forming] subunit beta OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=sucC PE=3 SV=1 115 380 2.0E-51
sp|Q21RF9|SUCC_RHOFT Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=sucC PE=3 SV=1 115 357 2.0E-51
sp|Q4ZUW7|SUCC_PSEU2 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Pseudomonas syringae pv. syringae (strain B728a) GN=sucC PE=3 SV=1 158 384 2.0E-51
sp|Q9EYG9|SUCC_RHIME Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rhizobium meliloti (strain 1021) GN=sucC PE=3 SV=1 115 375 2.0E-51
sp|Q1D6I9|SUCC_MYXXD Succinyl-CoA ligase [ADP-forming] subunit beta OS=Myxococcus xanthus (strain DK 1622) GN=sucC PE=3 SV=1 28 359 2.0E-51
sp|Q98EC5|SUCC_RHILO Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rhizobium loti (strain MAFF303099) GN=sucC PE=3 SV=1 115 375 3.0E-51
sp|A4SZY0|SUCC_POLSQ Succinyl-CoA ligase [ADP-forming] subunit beta OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=sucC PE=3 SV=1 149 357 3.0E-51
sp|Q2KYF7|SUCC_BORA1 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bordetella avium (strain 197N) GN=sucC PE=3 SV=1 149 357 3.0E-51
sp|Q3KFU6|SUCC_PSEPF Succinyl-CoA ligase [ADP-forming] subunit beta OS=Pseudomonas fluorescens (strain Pf0-1) GN=sucC PE=3 SV=1 156 384 4.0E-51
sp|B6JE33|SUCC_OLICO Succinyl-CoA ligase [ADP-forming] subunit beta OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=sucC PE=3 SV=1 28 379 4.0E-51
sp|B9DPG0|SUCC_STACT Succinyl-CoA ligase [ADP-forming] subunit beta OS=Staphylococcus carnosus (strain TM300) GN=sucC PE=3 SV=1 28 383 4.0E-51
sp|C3K6N0|SUCC_PSEFS Succinyl-CoA ligase [ADP-forming] subunit beta OS=Pseudomonas fluorescens (strain SBW25) GN=sucC PE=3 SV=1 156 384 4.0E-51
sp|Q883Z4|SUCC_PSESM Succinyl-CoA ligase [ADP-forming] subunit beta OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=sucC PE=3 SV=1 158 384 6.0E-51
sp|A1WD26|SUCC_ACISJ Succinyl-CoA ligase [ADP-forming] subunit beta OS=Acidovorax sp. (strain JS42) GN=sucC PE=3 SV=1 149 357 6.0E-51
sp|B9MHW0|SUCC_ACIET Succinyl-CoA ligase [ADP-forming] subunit beta OS=Acidovorax ebreus (strain TPSY) GN=sucC PE=3 SV=1 149 357 6.0E-51
sp|Q48K68|SUCC_PSE14 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=sucC PE=3 SV=1 158 384 6.0E-51
sp|A4YKC6|SUCC_BRASO Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bradyrhizobium sp. (strain ORS278) GN=sucC PE=3 SV=1 115 353 6.0E-51
sp|Q7VVU5|SUCC_BORPE Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=sucC PE=3 SV=1 149 357 6.0E-51
sp|Q7W789|SUCC_BORPA Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=sucC PE=3 SV=1 149 357 6.0E-51
sp|Q7WKM5|SUCC_BORBR Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=sucC PE=3 SV=1 149 357 6.0E-51
sp|A4XV90|SUCC_PSEMY Succinyl-CoA ligase [ADP-forming] subunit beta OS=Pseudomonas mendocina (strain ymp) GN=sucC PE=3 SV=1 156 384 8.0E-51
sp|Q6FYD1|SUCC_BARQU Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bartonella quintana (strain Toulouse) GN=sucC PE=3 SV=1 116 375 1.0E-50
sp|Q4KFY6|SUCC_PSEF5 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=sucC PE=3 SV=1 156 384 1.0E-50
sp|Q122H7|SUCC_POLSJ Succinyl-CoA ligase [ADP-forming] subunit beta OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=sucC PE=3 SV=1 115 357 1.0E-50
sp|A7GRG6|SUCC_BACCN Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=sucC PE=3 SV=1 28 359 1.0E-50
sp|Q5WFP4|SUCC_BACSK Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bacillus clausii (strain KSM-K16) GN=sucC PE=3 SV=1 28 359 2.0E-50
sp|Q0KE75|SUCC_CUPNH Succinyl-CoA ligase [ADP-forming] subunit beta OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=sucC PE=3 SV=1 116 357 2.0E-50
sp|A6UDP2|SUCC_SINMW Succinyl-CoA ligase [ADP-forming] subunit beta OS=Sinorhizobium medicae (strain WSM419) GN=sucC PE=3 SV=1 115 375 2.0E-50
sp|A5E936|SUCC_BRASB Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=sucC PE=3 SV=1 115 379 2.0E-50
sp|A1TW81|SUCC_ACIAC Succinyl-CoA ligase [ADP-forming] subunit beta OS=Acidovorax citrulli (strain AAC00-1) GN=sucC PE=3 SV=1 149 357 2.0E-50
sp|B2V8I4|SUCC_SULSY Succinyl-CoA ligase [ADP-forming] subunit beta OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=sucC PE=3 SV=1 115 359 2.0E-50
sp|B9EBC7|SUCC_MACCJ Succinyl-CoA ligase [ADP-forming] subunit beta OS=Macrococcus caseolyticus (strain JCSC5402) GN=sucC PE=3 SV=1 115 385 2.0E-50
sp|Q9KA20|SUCC_BACHD Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=sucC PE=3 SV=1 28 359 3.0E-50
sp|Q2K3F0|SUCC_RHIEC Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=sucC PE=3 SV=1 89 357 3.0E-50
sp|B3GX29|SUCC_ACTP7 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=sucC PE=3 SV=1 156 384 4.0E-50
sp|Q1H031|SUCC_METFK Succinyl-CoA ligase [ADP-forming] subunit beta OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=sucC PE=3 SV=1 28 357 4.0E-50
sp|A1AVI3|SUCC_RUTMC Succinyl-CoA ligase [ADP-forming] subunit beta OS=Ruthia magnifica subsp. Calyptogena magnifica GN=sucC PE=3 SV=1 90 382 5.0E-50
sp|Q0AKU3|SUCC_MARMM Succinyl-CoA ligase [ADP-forming] subunit beta OS=Maricaulis maris (strain MCS10) GN=sucC PE=3 SV=1 116 349 5.0E-50
sp|Q47AN8|SUCC_DECAR Succinyl-CoA ligase [ADP-forming] subunit beta OS=Dechloromonas aromatica (strain RCB) GN=sucC PE=3 SV=1 149 359 6.0E-50
sp|A3MZH0|SUCC_ACTP2 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=sucC PE=3 SV=1 156 384 6.0E-50
sp|Q8Y1Y3|SUCC_RALSO Succinyl-CoA ligase [ADP-forming] subunit beta OS=Ralstonia solanacearum (strain GMI1000) GN=sucC PE=3 SV=1 149 357 7.0E-50
sp|P53589|SUCB2_CAEEL Succinyl-CoA ligase [GDP-forming] subunit beta, mitochondrial OS=Caenorhabditis elegans GN=sucg-1 PE=3 SV=1 19 378 7.0E-50
sp|B0BTV5|SUCC_ACTPJ Succinyl-CoA ligase [ADP-forming] subunit beta OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=sucC PE=3 SV=1 156 384 8.0E-50
sp|Q96I99|SUCB2_HUMAN Succinyl-CoA ligase [GDP-forming] subunit beta, mitochondrial OS=Homo sapiens GN=SUCLG2 PE=1 SV=2 23 368 9.0E-50
sp|A6TKJ3|SUCC_ALKMQ Succinyl-CoA ligase [ADP-forming] subunit beta OS=Alkaliphilus metalliredigens (strain QYMF) GN=sucC PE=3 SV=1 28 359 1.0E-49
sp|A5VB78|SUCC_SPHWW Succinyl-CoA ligase [ADP-forming] subunit beta OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=sucC PE=3 SV=1 115 386 1.0E-49
sp|B6J8N7|SUCC_COXB1 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Coxiella burnetii (strain CbuK_Q154) GN=sucC PE=3 SV=1 171 379 1.0E-49
sp|A9BQA5|SUCC_DELAS Succinyl-CoA ligase [ADP-forming] subunit beta OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=sucC PE=3 SV=1 149 357 1.0E-49
sp|A9N8R8|SUCC_COXBR Succinyl-CoA ligase [ADP-forming] subunit beta OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=sucC PE=3 SV=1 171 379 2.0E-49
sp|Q5WZ04|SUCC_LEGPL Succinyl-CoA ligase [ADP-forming] subunit beta OS=Legionella pneumophila (strain Lens) GN=sucC PE=3 SV=1 79 359 2.0E-49
sp|A5IH21|SUCC_LEGPC Succinyl-CoA ligase [ADP-forming] subunit beta OS=Legionella pneumophila (strain Corby) GN=sucC PE=3 SV=1 79 359 2.0E-49
sp|P53590|SUCB2_PIG Succinyl-CoA ligase [GDP-forming] subunit beta, mitochondrial (Fragment) OS=Sus scrofa GN=SUCLG2 PE=1 SV=2 23 378 2.0E-49
sp|C1A8X8|SUCC_GEMAT Succinyl-CoA ligase [ADP-forming] subunit beta OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=sucC PE=3 SV=1 28 381 2.0E-49
sp|A5EX54|SUCC_DICNV Succinyl-CoA ligase [ADP-forming] subunit beta OS=Dichelobacter nodosus (strain VCS1703A) GN=sucC PE=3 SV=1 28 370 2.0E-49
sp|Q5X7K6|SUCC_LEGPA Succinyl-CoA ligase [ADP-forming] subunit beta OS=Legionella pneumophila (strain Paris) GN=sucC PE=3 SV=1 79 383 3.0E-49
sp|A9KBQ4|SUCC_COXBN Succinyl-CoA ligase [ADP-forming] subunit beta OS=Coxiella burnetii (strain Dugway 5J108-111) GN=sucC PE=3 SV=1 171 379 3.0E-49
sp|Q92I21|SUCC_RICCN Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=sucC PE=3 SV=1 115 379 4.0E-49
sp|B6IZ97|SUCC_COXB2 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Coxiella burnetii (strain CbuG_Q212) GN=sucC PE=3 SV=1 171 379 4.0E-49
sp|P53592|SUCC_COXBU Succinyl-CoA ligase [ADP-forming] subunit beta OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=sucC PE=3 SV=2 171 379 4.0E-49
sp|A1VUC0|SUCC_POLNA Succinyl-CoA ligase [ADP-forming] subunit beta OS=Polaromonas naphthalenivorans (strain CJ2) GN=sucC PE=3 SV=1 115 357 4.0E-49
sp|Q4FP29|SUCC_PELUB Succinyl-CoA ligase [ADP-forming] subunit beta OS=Pelagibacter ubique (strain HTCC1062) GN=sucC PE=3 SV=1 115 379 4.0E-49
sp|A8GNF5|SUCC_RICAH Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rickettsia akari (strain Hartford) GN=sucC PE=3 SV=1 115 359 5.0E-49
sp|Q3MHX5|SUCB2_BOVIN Succinyl-CoA ligase [GDP-forming] subunit beta, mitochondrial OS=Bos taurus GN=SUCLG2 PE=2 SV=1 8 349 5.0E-49
sp|C3PNF9|SUCC_RICAE Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rickettsia africae (strain ESF-5) GN=sucC PE=3 SV=1 115 379 6.0E-49
sp|Q2N695|SUCC_ERYLH Succinyl-CoA ligase [ADP-forming] subunit beta OS=Erythrobacter litoralis (strain HTCC2594) GN=sucC PE=3 SV=1 102 378 6.0E-49
sp|B3PQ90|SUCC_RHIE6 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rhizobium etli (strain CIAT 652) GN=sucC PE=3 SV=1 103 357 7.0E-49
sp|Q74EA5|SUCC_GEOSL Succinyl-CoA ligase [ADP-forming] subunit beta OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=sucC PE=3 SV=1 28 368 8.0E-49
sp|Q1IJS5|SUCC_KORVE Succinyl-CoA ligase [ADP-forming] subunit beta OS=Koribacter versatilis (strain Ellin345) GN=sucC PE=3 SV=1 28 368 1.0E-48
sp|Q65JP0|SUCC_BACLD Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=sucC PE=3 SV=1 28 368 1.0E-48
sp|Q6HEX9|SUCC_BACHK Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=sucC PE=3 SV=1 28 359 1.0E-48
sp|Q636J0|SUCC_BACCZ Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bacillus cereus (strain ZK / E33L) GN=sucC PE=3 SV=1 28 359 1.0E-48
sp|B9IVC5|SUCC_BACCQ Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bacillus cereus (strain Q1) GN=sucC PE=3 SV=1 28 359 1.0E-48
sp|B7HLG9|SUCC_BACC7 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bacillus cereus (strain AH187) GN=sucC PE=3 SV=1 28 359 1.0E-48
sp|C1EP60|SUCC_BACC3 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bacillus cereus (strain 03BB102) GN=sucC PE=3 SV=1 28 359 1.0E-48
sp|Q732N4|SUCC_BACC1 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=sucC PE=3 SV=1 28 359 1.0E-48
sp|A0RHK9|SUCC_BACAH Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bacillus thuringiensis (strain Al Hakam) GN=sucC PE=3 SV=1 28 359 1.0E-48
sp|Q8CPH5|SUCC_STAES Succinyl-CoA ligase [ADP-forming] subunit beta OS=Staphylococcus epidermidis (strain ATCC 12228) GN=sucC PE=3 SV=1 28 383 2.0E-48
sp|Q5HPU5|SUCC_STAEQ Succinyl-CoA ligase [ADP-forming] subunit beta OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=sucC PE=3 SV=1 28 383 2.0E-48
sp|Q81WK0|SUCC_BACAN Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bacillus anthracis GN=sucC PE=3 SV=1 28 359 2.0E-48
sp|C3L791|SUCC_BACAC Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=sucC PE=3 SV=1 28 359 2.0E-48
sp|C3P5N7|SUCC_BACAA Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bacillus anthracis (strain A0248) GN=sucC PE=3 SV=1 28 359 2.0E-48
sp|Q021N6|SUCC_SOLUE Succinyl-CoA ligase [ADP-forming] subunit beta OS=Solibacter usitatus (strain Ellin6076) GN=sucC PE=3 SV=1 28 381 2.0E-48
sp|B7HDV9|SUCC_BACC4 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bacillus cereus (strain B4264) GN=sucC PE=3 SV=1 28 359 3.0E-48
sp|A8F1K7|SUCC_RICM5 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rickettsia massiliae (strain Mtu5) GN=sucC PE=3 SV=1 115 359 3.0E-48
sp|C0QQH3|SUCC_PERMH Succinyl-CoA ligase [ADP-forming] subunit beta OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=sucC PE=3 SV=1 115 381 3.0E-48
sp|Q4L5U8|SUCC_STAHJ Succinyl-CoA ligase [ADP-forming] subunit beta OS=Staphylococcus haemolyticus (strain JCSC1435) GN=sucC PE=3 SV=1 28 383 3.0E-48
sp|Q819X0|SUCC_BACCR Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=sucC PE=3 SV=1 28 359 3.0E-48
sp|A8GS29|SUCC_RICRS Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rickettsia rickettsii (strain Sheila Smith) GN=sucC PE=3 SV=1 115 359 4.0E-48
sp|B0BXJ5|SUCC_RICRO Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rickettsia rickettsii (strain Iowa) GN=sucC PE=3 SV=1 115 359 4.0E-48
sp|A1APQ8|SUCC_PELPD Succinyl-CoA ligase [ADP-forming] subunit beta OS=Pelobacter propionicus (strain DSM 2379) GN=sucC PE=3 SV=1 28 388 5.0E-48
sp|C4K0K1|SUCC_RICPU Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rickettsia peacockii (strain Rustic) GN=sucC PE=3 SV=1 115 359 6.0E-48
sp|B7IUJ5|SUCC_BACC2 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bacillus cereus (strain G9842) GN=sucC PE=3 SV=1 28 359 6.0E-48
sp|Q49X32|SUCC_STAS1 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=sucC PE=3 SV=1 156 383 7.0E-48
sp|B9L5I6|SUCC_NAUPA Succinyl-CoA ligase [ADP-forming] subunit beta OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=sucC PE=3 SV=1 116 361 7.0E-48
sp|P80886|SUCC_BACSU Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bacillus subtilis (strain 168) GN=sucC PE=1 SV=2 28 368 7.0E-48
sp|A7Z4M9|SUCC_BACMF Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=sucC PE=3 SV=1 156 368 8.0E-48
sp|B2FRS3|SUCC_STRMK Succinyl-CoA ligase [ADP-forming] subunit beta OS=Stenotrophomonas maltophilia (strain K279a) GN=sucC PE=3 SV=1 28 359 8.0E-48
sp|B4ST72|SUCC_STRM5 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Stenotrophomonas maltophilia (strain R551-3) GN=sucC PE=3 SV=1 28 359 8.0E-48
sp|O05966|SUCC_RICPR Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rickettsia prowazekii (strain Madrid E) GN=sucC PE=3 SV=1 115 379 1.0E-47
sp|B4RL77|SUCC_NEIG2 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Neisseria gonorrhoeae (strain NCCP11945) GN=sucC PE=3 SV=1 156 359 1.0E-47
sp|B4U901|SUCC_HYDS0 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=sucC PE=3 SV=1 115 382 1.0E-47
sp|C4L610|SUCC_EXISA Succinyl-CoA ligase [ADP-forming] subunit beta OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=sucC PE=3 SV=1 156 357 1.0E-47
sp|B5EMG2|SUCC_ACIF5 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=sucC PE=3 SV=1 116 359 1.0E-47
sp|B7J4G8|SUCC_ACIF2 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=sucC PE=3 SV=1 116 359 1.0E-47
sp|Q31FV4|SUCC_THICR Succinyl-CoA ligase [ADP-forming] subunit beta OS=Thiomicrospira crunogena (strain XCL-2) GN=sucC PE=3 SV=1 103 383 1.0E-47
sp|Q5F878|SUCC_NEIG1 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=sucC PE=3 SV=1 156 359 1.0E-47
sp|Q2W063|SUCC_MAGSA Succinyl-CoA ligase [ADP-forming] subunit beta OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=sucC PE=3 SV=1 116 383 1.0E-47
sp|Q8UC60|SUCC_AGRFC Succinyl-CoA ligase [ADP-forming] subunit beta OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=sucC PE=3 SV=1 116 359 2.0E-47
sp|A9M4F8|SUCC_NEIM0 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Neisseria meningitidis serogroup C (strain 053442) GN=sucC PE=3 SV=1 156 359 2.0E-47
sp|Q9JUT0|SUCC_NEIMA Succinyl-CoA ligase [ADP-forming] subunit beta OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=sucC PE=3 SV=1 156 359 2.0E-47
sp|Q4ULQ7|SUCC_RICFE Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=sucC PE=3 SV=1 115 359 2.0E-47
sp|Q9JZP4|SUCC_NEIMB Succinyl-CoA ligase [ADP-forming] subunit beta OS=Neisseria meningitidis serogroup B (strain MC58) GN=sucC PE=3 SV=1 156 359 2.0E-47
sp|Q1RH55|SUCC_RICBR Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rickettsia bellii (strain RML369-C) GN=sucC PE=3 SV=1 115 359 2.0E-47
sp|A8GUV0|SUCC_RICB8 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rickettsia bellii (strain OSU 85-389) GN=sucC PE=3 SV=1 115 359 2.0E-47
sp|A9VT74|SUCC_BACWK Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bacillus weihenstephanensis (strain KBAB4) GN=sucC PE=3 SV=1 28 359 2.0E-47
sp|A1KTM6|SUCC_NEIMF Succinyl-CoA ligase [ADP-forming] subunit beta OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=sucC PE=3 SV=1 156 359 2.0E-47
sp|A6Q7S7|SUCC_SULNB Succinyl-CoA ligase [ADP-forming] subunit beta OS=Sulfurovum sp. (strain NBC37-1) GN=sucC PE=3 SV=1 115 371 3.0E-47
sp|Q7NZ47|SUCC_CHRVO Succinyl-CoA ligase [ADP-forming] subunit beta OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=sucC PE=3 SV=1 162 357 3.0E-47
sp|Q1QQR3|SUCC_NITHX Succinyl-CoA ligase [ADP-forming] subunit beta OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=sucC PE=3 SV=1 28 379 3.0E-47
sp|Q8F746|SUCC_LEPIN Succinyl-CoA ligase [ADP-forming] subunit beta OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=sucC PE=3 SV=1 115 359 3.0E-47
sp|Q72PA2|SUCC_LEPIC Succinyl-CoA ligase [ADP-forming] subunit beta OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=sucC PE=3 SV=1 115 359 3.0E-47
sp|B3Q760|SUCC_RHOPT Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rhodopseudomonas palustris (strain TIE-1) GN=sucC PE=3 SV=1 28 366 4.0E-47
sp|Q6NDB7|SUCC_RHOPA Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=sucC PE=3 SV=1 28 366 4.0E-47
sp|A8FD73|SUCC_BACP2 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bacillus pumilus (strain SAFR-032) GN=sucC PE=3 SV=1 156 368 4.0E-47
sp|Q5P7A7|SUCC_AROAE Succinyl-CoA ligase [ADP-forming] subunit beta OS=Aromatoleum aromaticum (strain EbN1) GN=sucC PE=3 SV=1 149 357 4.0E-47
sp|Q68WU5|SUCC_RICTY Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=sucC PE=3 SV=1 115 379 5.0E-47
sp|Q5PBI8|SUCC_ANAMM Succinyl-CoA ligase [ADP-forming] subunit beta OS=Anaplasma marginale (strain St. Maries) GN=sucC PE=3 SV=1 156 385 5.0E-47
sp|B9JCF4|SUCC_AGRRK Succinyl-CoA ligase [ADP-forming] subunit beta OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=sucC PE=3 SV=1 115 379 6.0E-47
sp|A1KAU3|SUCC_AZOSB Succinyl-CoA ligase [ADP-forming] subunit beta OS=Azoarcus sp. (strain BH72) GN=sucC PE=3 SV=1 149 357 6.0E-47
sp|Q28U74|SUCC_JANSC Succinyl-CoA ligase [ADP-forming] subunit beta OS=Jannaschia sp. (strain CCS1) GN=sucC PE=3 SV=1 116 379 6.0E-47
sp|B1YIL7|SUCC_EXIS2 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=sucC PE=3 SV=1 115 359 6.0E-47
sp|A7NNW3|SUCC_ROSCS Succinyl-CoA ligase [ADP-forming] subunit beta OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=sucC PE=3 SV=1 28 357 7.0E-47
sp|Q1LTZ4|SUCC_BAUCH Succinyl-CoA ligase [ADP-forming] subunit beta OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=sucC PE=3 SV=1 28 386 8.0E-47
sp|A6Q391|SUCC_NITSB Succinyl-CoA ligase [ADP-forming] subunit beta OS=Nitratiruptor sp. (strain SB155-2) GN=sucC PE=3 SV=1 28 361 1.0E-46
sp|C5BL83|SUCC_TERTT Succinyl-CoA ligase [ADP-forming] subunit beta OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=sucC PE=3 SV=1 158 357 1.0E-46
sp|A1SWX6|SUCC_PSYIN Succinyl-CoA ligase [ADP-forming] subunit beta OS=Psychromonas ingrahamii (strain 37) GN=sucC PE=3 SV=1 156 379 1.0E-46
sp|Q5NHF3|SUCC_FRATT Succinyl-CoA ligase [ADP-forming] subunit beta OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=sucC PE=3 SV=1 28 357 1.0E-46
sp|Q14IV5|SUCC_FRAT1 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=sucC PE=3 SV=1 28 357 1.0E-46
sp|Q0BKS4|SUCC_FRATO Succinyl-CoA ligase [ADP-forming] subunit beta OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=sucC PE=3 SV=1 28 357 2.0E-46
sp|B3EN95|SUCC_CHLPB Succinyl-CoA ligase [ADP-forming] subunit beta OS=Chlorobium phaeobacteroides (strain BS1) GN=sucC PE=3 SV=1 28 357 2.0E-46
sp|A5V080|SUCC_ROSS1 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Roseiflexus sp. (strain RS-1) GN=sucC PE=3 SV=1 28 384 2.0E-46
sp|Q2A253|SUCC_FRATH Succinyl-CoA ligase [ADP-forming] subunit beta OS=Francisella tularensis subsp. holarctica (strain LVS) GN=sucC PE=3 SV=1 28 357 2.0E-46
sp|A7NDR1|SUCC_FRATF Succinyl-CoA ligase [ADP-forming] subunit beta OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=sucC PE=3 SV=1 28 357 2.0E-46
sp|A5UIW0|SUCC_HAEIG Succinyl-CoA ligase [ADP-forming] subunit beta OS=Haemophilus influenzae (strain PittGG) GN=sucC PE=3 SV=1 156 384 2.0E-46
sp|B0TZ23|SUCC_FRAP2 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=sucC PE=3 SV=1 28 357 2.0E-46
sp|A4IZC2|SUCC_FRATW Succinyl-CoA ligase [ADP-forming] subunit beta OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=sucC PE=3 SV=1 28 357 2.0E-46
sp|Q0C5F3|SUCC_HYPNA Succinyl-CoA ligase [ADP-forming] subunit beta OS=Hyphomonas neptunium (strain ATCC 15444) GN=sucC PE=3 SV=1 116 379 2.0E-46
sp|A0Q5H4|SUCC_FRATN Succinyl-CoA ligase [ADP-forming] subunit beta OS=Francisella tularensis subsp. novicida (strain U112) GN=sucC PE=3 SV=1 28 357 2.0E-46
sp|B0RPQ9|SUCC_XANCB Succinyl-CoA ligase [ADP-forming] subunit beta OS=Xanthomonas campestris pv. campestris (strain B100) GN=sucC PE=3 SV=1 28 359 2.0E-46
sp|B0KNW8|SUCC_PSEPG Succinyl-CoA ligase [ADP-forming] subunit beta OS=Pseudomonas putida (strain GB-1) GN=sucC PE=3 SV=1 156 384 3.0E-46
sp|Q8P676|SUCC_XANCP Succinyl-CoA ligase [ADP-forming] subunit beta OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=sucC PE=3 SV=1 28 359 3.0E-46
sp|Q4UXU0|SUCC_XANC8 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Xanthomonas campestris pv. campestris (strain 8004) GN=sucC PE=3 SV=1 28 359 3.0E-46
sp|B2SDM1|SUCC_FRATM Succinyl-CoA ligase [ADP-forming] subunit beta OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=sucC PE=3 SV=1 28 357 3.0E-46
sp|Q2SD35|SUCC_HAHCH Succinyl-CoA ligase [ADP-forming] subunit beta OS=Hahella chejuensis (strain KCTC 2396) GN=sucC PE=3 SV=1 156 353 3.0E-46
sp|B5ZSR9|SUCC_RHILW Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=sucC PE=3 SV=1 116 357 3.0E-46
sp|Q053V6|SUCC_LEPBL Succinyl-CoA ligase [ADP-forming] subunit beta OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=sucC PE=3 SV=1 115 359 4.0E-46
sp|Q04QS3|SUCC_LEPBJ Succinyl-CoA ligase [ADP-forming] subunit beta OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=sucC PE=3 SV=1 115 359 4.0E-46
sp|B9JTS8|SUCC_AGRVS Succinyl-CoA ligase [ADP-forming] subunit beta OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=sucC PE=3 SV=1 115 375 5.0E-46
sp|A1VYP2|SUCC_CAMJJ Succinyl-CoA ligase [ADP-forming] subunit beta OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=sucC PE=3 SV=1 157 350 5.0E-46
sp|P45101|SUCC_HAEIN Succinyl-CoA ligase [ADP-forming] subunit beta OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=sucC PE=3 SV=1 28 382 6.0E-46
sp|C1DM53|SUCC_AZOVD Succinyl-CoA ligase [ADP-forming] subunit beta OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=sucC PE=3 SV=1 28 384 6.0E-46
sp|Q5HVN3|SUCC_CAMJR Succinyl-CoA ligase [ADP-forming] subunit beta OS=Campylobacter jejuni (strain RM1221) GN=sucC PE=3 SV=1 157 350 7.0E-46
sp|Q9PHY1|SUCC_CAMJE Succinyl-CoA ligase [ADP-forming] subunit beta OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=sucC PE=3 SV=1 157 350 7.0E-46
sp|Q5NMF5|SUCC_ZYMMO Succinyl-CoA ligase [ADP-forming] subunit beta OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=sucC PE=3 SV=1 28 375 1.0E-45
sp|Q4QLA3|SUCC_HAEI8 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Haemophilus influenzae (strain 86-028NP) GN=sucC PE=3 SV=1 156 382 1.0E-45
sp|Q822A1|SUCC_CHLCV Succinyl-CoA ligase [ADP-forming] subunit beta OS=Chlamydophila caviae (strain GPIC) GN=sucC PE=3 SV=1 30 383 2.0E-45
sp|Q3ATR4|SUCC_CHLCH Succinyl-CoA ligase [ADP-forming] subunit beta OS=Chlorobium chlorochromatii (strain CaD3) GN=sucC PE=3 SV=1 28 357 2.0E-45
sp|Q1AWI8|SUCC_RUBXD Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=sucC PE=3 SV=1 28 383 2.0E-45
sp|Q3BQ83|SUCC_XANC5 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=sucC PE=3 SV=1 28 359 2.0E-45
sp|Q1MAW1|SUCC_RHIL3 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=sucC PE=3 SV=1 86 359 2.0E-45
sp|A5UCR4|SUCC_HAEIE Succinyl-CoA ligase [ADP-forming] subunit beta OS=Haemophilus influenzae (strain PittEE) GN=sucC PE=3 SV=1 156 382 3.0E-45
sp|B4S612|SUCC_PROA2 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=sucC PE=3 SV=1 28 375 3.0E-45
sp|C4L8V5|SUCC_TOLAT Succinyl-CoA ligase [ADP-forming] subunit beta OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=sucC PE=3 SV=1 28 382 3.0E-45
sp|B9LB77|SUCC_CHLSY Succinyl-CoA ligase [ADP-forming] subunit beta OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=sucC PE=3 SV=1 28 357 4.0E-45
sp|A9WJ74|SUCC_CHLAA Succinyl-CoA ligase [ADP-forming] subunit beta OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=sucC PE=3 SV=1 28 357 4.0E-45
sp|A8FKV6|SUCC_CAMJ8 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=sucC PE=3 SV=1 157 350 4.0E-45
sp|Q3B5J6|SUCC_CHLL7 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=sucC PE=3 SV=1 28 357 5.0E-45
sp|A7H4K9|SUCC_CAMJD Succinyl-CoA ligase [ADP-forming] subunit beta OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=sucC PE=3 SV=1 157 350 5.0E-45
sp|A1WLG5|SUCC_VEREI Succinyl-CoA ligase [ADP-forming] subunit beta OS=Verminephrobacter eiseniae (strain EF01-2) GN=sucC PE=3 SV=1 115 357 6.0E-45
sp|B1JAV3|SUCC_PSEPW Succinyl-CoA ligase [ADP-forming] subunit beta OS=Pseudomonas putida (strain W619) GN=sucC PE=3 SV=1 156 384 6.0E-45
sp|Q1I7L3|SUCC_PSEE4 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Pseudomonas entomophila (strain L48) GN=sucC PE=3 SV=1 156 384 6.0E-45
sp|Q8PHL5|SUCC_XANAC Succinyl-CoA ligase [ADP-forming] subunit beta OS=Xanthomonas axonopodis pv. citri (strain 306) GN=sucC PE=3 SV=1 28 359 6.0E-45
sp|Q5HC25|SUCC_EHRRW Succinyl-CoA ligase [ADP-forming] subunit beta OS=Ehrlichia ruminantium (strain Welgevonden) GN=sucC PE=3 SV=1 164 383 6.0E-45
sp|C1DB55|SUCC_LARHH Succinyl-CoA ligase [ADP-forming] subunit beta OS=Laribacter hongkongensis (strain HLHK9) GN=sucC PE=3 SV=1 115 359 6.0E-45
sp|B8GCC9|SUCC_CHLAD Succinyl-CoA ligase [ADP-forming] subunit beta OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=sucC PE=3 SV=1 28 357 7.0E-45
sp|Q88FB2|SUCC_PSEPK Succinyl-CoA ligase [ADP-forming] subunit beta OS=Pseudomonas putida (strain KT2440) GN=sucC PE=3 SV=1 156 384 7.0E-45
sp|A5W114|SUCC_PSEP1 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=sucC PE=3 SV=1 156 384 7.0E-45
sp|C0QLM0|SUCC_DESAH Succinyl-CoA ligase [ADP-forming] subunit beta OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=sucC PE=3 SV=1 149 357 7.0E-45
sp|Q5H2H4|SUCC_XANOR Succinyl-CoA ligase [ADP-forming] subunit beta OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=sucC PE=3 SV=1 110 359 8.0E-45
sp|B2ST87|SUCC_XANOP Succinyl-CoA ligase [ADP-forming] subunit beta OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=sucC PE=3 SV=1 110 359 8.0E-45
sp|Q2P5E6|SUCC_XANOM Succinyl-CoA ligase [ADP-forming] subunit beta OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=sucC PE=3 SV=1 110 359 8.0E-45
sp|B8F4Q2|SUCC_HAEPS Succinyl-CoA ligase [ADP-forming] subunit beta OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=sucC PE=3 SV=1 156 357 8.0E-45
sp|A7MQX5|SUCC_CROS8 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=sucC PE=3 SV=1 156 357 9.0E-45
sp|Q5FH54|SUCC_EHRRG Succinyl-CoA ligase [ADP-forming] subunit beta OS=Ehrlichia ruminantium (strain Gardel) GN=sucC PE=3 SV=1 164 383 9.0E-45
sp|Q3SVK4|SUCC_NITWN Succinyl-CoA ligase [ADP-forming] subunit beta OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=sucC PE=3 SV=1 28 383 1.0E-44
sp|A6GY30|SUCC_FLAPJ Succinyl-CoA ligase [ADP-forming] subunit beta OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=sucC PE=3 SV=1 28 359 1.0E-44
sp|A5WC33|SUCC_PSYWF Succinyl-CoA ligase [ADP-forming] subunit beta OS=Psychrobacter sp. (strain PRwf-1) GN=sucC PE=3 SV=1 161 357 1.0E-44
sp|Q9YI36|SUCB2_COLLI Succinyl-CoA ligase [GDP-forming] subunit beta, mitochondrial (Fragment) OS=Columba livia GN=SUCLG2 PE=1 SV=1 116 349 1.0E-44
sp|A8ZRW7|SUCC_DESOH Succinyl-CoA ligase [ADP-forming] subunit beta OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=sucC PE=3 SV=1 102 357 1.0E-44
sp|B3EFL3|SUCC_CHLL2 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=sucC PE=3 SV=1 28 357 1.0E-44
sp|Q5QU21|SUCC_IDILO Succinyl-CoA ligase [ADP-forming] subunit beta OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=sucC PE=3 SV=1 28 359 1.0E-44
sp|Q02K73|SUCC_PSEAB Succinyl-CoA ligase [ADP-forming] subunit beta OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=sucC PE=3 SV=1 156 384 1.0E-44
sp|P53593|SUCC_PSEAE Succinyl-CoA ligase [ADP-forming] subunit beta OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=sucC PE=3 SV=2 156 384 2.0E-44
sp|B7UVD3|SUCC_PSEA8 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Pseudomonas aeruginosa (strain LESB58) GN=sucC PE=3 SV=1 156 384 2.0E-44
sp|A6V7K5|SUCC_PSEA7 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Pseudomonas aeruginosa (strain PA7) GN=sucC PE=3 SV=1 156 384 2.0E-44
sp|Q32IK3|SUCC_SHIDS Succinyl-CoA ligase [ADP-forming] subunit beta OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=sucC PE=3 SV=1 156 353 2.0E-44
sp|Q3Z476|SUCC_SHISS Succinyl-CoA ligase [ADP-forming] subunit beta OS=Shigella sonnei (strain Ss046) GN=sucC PE=3 SV=1 156 353 2.0E-44
sp|P0A839|SUCC_SHIFL Succinyl-CoA ligase [ADP-forming] subunit beta OS=Shigella flexneri GN=sucC PE=3 SV=1 156 353 2.0E-44
sp|B1LLG1|SUCC_ECOSM Succinyl-CoA ligase [ADP-forming] subunit beta OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=sucC PE=3 SV=1 156 353 2.0E-44
sp|B6I7Z9|SUCC_ECOSE Succinyl-CoA ligase [ADP-forming] subunit beta OS=Escherichia coli (strain SE11) GN=sucC PE=3 SV=1 156 353 2.0E-44
sp|B7N9W6|SUCC_ECOLU Succinyl-CoA ligase [ADP-forming] subunit beta OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=sucC PE=3 SV=1 156 353 2.0E-44
sp|P0A836|SUCC_ECOLI Succinyl-CoA ligase [ADP-forming] subunit beta OS=Escherichia coli (strain K12) GN=sucC PE=1 SV=1 156 353 2.0E-44
sp|B1IY02|SUCC_ECOLC Succinyl-CoA ligase [ADP-forming] subunit beta OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=sucC PE=3 SV=1 156 353 2.0E-44
sp|P0A837|SUCC_ECOL6 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=sucC PE=3 SV=1 156 353 2.0E-44
sp|A7ZXY8|SUCC_ECOHS Succinyl-CoA ligase [ADP-forming] subunit beta OS=Escherichia coli O9:H4 (strain HS) GN=sucC PE=3 SV=1 156 353 2.0E-44
sp|B1X6Q8|SUCC_ECODH Succinyl-CoA ligase [ADP-forming] subunit beta OS=Escherichia coli (strain K12 / DH10B) GN=sucC PE=3 SV=1 156 353 2.0E-44
sp|C4ZWK2|SUCC_ECOBW Succinyl-CoA ligase [ADP-forming] subunit beta OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=sucC PE=3 SV=1 156 353 2.0E-44
sp|B7NMS9|SUCC_ECO7I Succinyl-CoA ligase [ADP-forming] subunit beta OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=sucC PE=3 SV=1 156 353 2.0E-44
sp|B5YQR7|SUCC_ECO5E Succinyl-CoA ligase [ADP-forming] subunit beta OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=sucC PE=3 SV=1 156 353 2.0E-44
sp|P0A838|SUCC_ECO57 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Escherichia coli O157:H7 GN=sucC PE=3 SV=1 156 353 2.0E-44
sp|B7LAD4|SUCC_ECO55 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Escherichia coli (strain 55989 / EAEC) GN=sucC PE=3 SV=1 156 353 2.0E-44
sp|A7ZJA8|SUCC_ECO24 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=sucC PE=3 SV=1 156 353 2.0E-44
sp|Q9CNZ0|SUCC_PASMU Succinyl-CoA ligase [ADP-forming] subunit beta OS=Pasteurella multocida (strain Pm70) GN=sucC PE=3 SV=1 156 384 2.0E-44
sp|B3QPP2|SUCC_CHLP8 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Chlorobaculum parvum (strain NCIB 8327) GN=sucC PE=3 SV=1 115 357 2.0E-44
sp|B5FNF9|SUCC_SALDC Succinyl-CoA ligase [ADP-forming] subunit beta OS=Salmonella dublin (strain CT_02021853) GN=sucC PE=3 SV=1 156 353 2.0E-44
sp|B4RYG2|SUCC_ALTMD Succinyl-CoA ligase [ADP-forming] subunit beta OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=sucC PE=3 SV=1 156 384 2.0E-44
sp|O84828|SUCC_CHLTR Succinyl-CoA ligase [ADP-forming] subunit beta OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=sucC PE=3 SV=1 28 381 2.0E-44
sp|Q3KKL8|SUCC_CHLTA Succinyl-CoA ligase [ADP-forming] subunit beta OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=sucC PE=3 SV=1 28 381 2.0E-44
sp|P66869|SUCC_SALTY Succinyl-CoA ligase [ADP-forming] subunit beta OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=sucC PE=3 SV=1 156 353 2.0E-44
sp|P66870|SUCC_SALTI Succinyl-CoA ligase [ADP-forming] subunit beta OS=Salmonella typhi GN=sucC PE=3 SV=1 156 353 2.0E-44
sp|B4TQ53|SUCC_SALSV Succinyl-CoA ligase [ADP-forming] subunit beta OS=Salmonella schwarzengrund (strain CVM19633) GN=sucC PE=3 SV=1 156 353 2.0E-44
sp|B5BC72|SUCC_SALPK Succinyl-CoA ligase [ADP-forming] subunit beta OS=Salmonella paratyphi A (strain AKU_12601) GN=sucC PE=3 SV=1 156 353 2.0E-44
sp|C0PWE7|SUCC_SALPC Succinyl-CoA ligase [ADP-forming] subunit beta OS=Salmonella paratyphi C (strain RKS4594) GN=sucC PE=3 SV=1 156 353 2.0E-44
sp|A9MTQ2|SUCC_SALPB Succinyl-CoA ligase [ADP-forming] subunit beta OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=sucC PE=3 SV=1 156 353 2.0E-44
sp|Q5PCM7|SUCC_SALPA Succinyl-CoA ligase [ADP-forming] subunit beta OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=sucC PE=3 SV=1 156 353 2.0E-44
sp|B4SZE2|SUCC_SALNS Succinyl-CoA ligase [ADP-forming] subunit beta OS=Salmonella newport (strain SL254) GN=sucC PE=3 SV=1 156 353 2.0E-44
sp|B4TBD7|SUCC_SALHS Succinyl-CoA ligase [ADP-forming] subunit beta OS=Salmonella heidelberg (strain SL476) GN=sucC PE=3 SV=1 156 353 2.0E-44
sp|B5R689|SUCC_SALG2 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=sucC PE=3 SV=1 156 353 2.0E-44
sp|B5QWG8|SUCC_SALEP Succinyl-CoA ligase [ADP-forming] subunit beta OS=Salmonella enteritidis PT4 (strain P125109) GN=sucC PE=3 SV=1 156 353 2.0E-44
sp|Q57RL3|SUCC_SALCH Succinyl-CoA ligase [ADP-forming] subunit beta OS=Salmonella choleraesuis (strain SC-B67) GN=sucC PE=3 SV=1 156 353 2.0E-44
sp|B5EZG1|SUCC_SALA4 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Salmonella agona (strain SL483) GN=sucC PE=3 SV=1 156 353 2.0E-44
sp|A9MJL9|SUCC_SALAR Succinyl-CoA ligase [ADP-forming] subunit beta OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=sucC PE=3 SV=1 156 353 3.0E-44
sp|Q2GJ42|SUCC_ANAPZ Succinyl-CoA ligase [ADP-forming] subunit beta OS=Anaplasma phagocytophilum (strain HZ) GN=sucC PE=3 SV=1 115 384 3.0E-44
sp|A4VKQ1|SUCC_PSEU5 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Pseudomonas stutzeri (strain A1501) GN=sucC PE=3 SV=1 156 357 4.0E-44
sp|B7M5P1|SUCC_ECO8A Succinyl-CoA ligase [ADP-forming] subunit beta OS=Escherichia coli O8 (strain IAI1) GN=sucC PE=3 SV=1 156 357 5.0E-44
sp|A4W879|SUCC_ENT38 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Enterobacter sp. (strain 638) GN=sucC PE=3 SV=1 156 357 7.0E-44
sp|A5FHX8|SUCC_FLAJ1 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=sucC PE=3 SV=1 156 359 7.0E-44
sp|B0VEF2|SUCC_ACIBY Succinyl-CoA ligase [ADP-forming] subunit beta OS=Acinetobacter baumannii (strain AYE) GN=sucC PE=3 SV=1 28 357 9.0E-44
sp|A3M887|SUCC_ACIBT Succinyl-CoA ligase [ADP-forming] subunit beta OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=sucC PE=3 SV=2 28 357 9.0E-44
sp|B2HXG0|SUCC_ACIBC Succinyl-CoA ligase [ADP-forming] subunit beta OS=Acinetobacter baumannii (strain ACICU) GN=sucC PE=3 SV=1 28 357 9.0E-44
sp|B7I6T2|SUCC_ACIB5 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Acinetobacter baumannii (strain AB0057) GN=sucC PE=3 SV=1 28 357 9.0E-44
sp|B7GXK7|SUCC_ACIB3 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Acinetobacter baumannii (strain AB307-0294) GN=sucC PE=3 SV=1 28 357 9.0E-44
sp|Q0A5K0|SUCC_ALKEH Succinyl-CoA ligase [ADP-forming] subunit beta OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=sucC PE=3 SV=1 156 378 1.0E-43
sp|B0BAS9|SUCC_CHLTB Succinyl-CoA ligase [ADP-forming] subunit beta OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=sucC PE=3 SV=1 28 381 1.0E-43
sp|B0B950|SUCC_CHLT2 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=sucC PE=3 SV=1 28 381 1.0E-43
sp|A0KJK9|SUCC_AERHH Succinyl-CoA ligase [ADP-forming] subunit beta OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=sucC PE=3 SV=1 156 384 1.0E-43
sp|A4SND2|SUCC_AERS4 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Aeromonas salmonicida (strain A449) GN=sucC PE=3 SV=1 156 384 1.0E-43
sp|A4SDL6|SUCC_CHLPM Succinyl-CoA ligase [ADP-forming] subunit beta OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=sucC PE=3 SV=1 28 357 1.0E-43
sp|Q64U25|SUCC_BACFR Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bacteroides fragilis (strain YCH46) GN=sucC PE=3 SV=1 102 379 1.0E-43
sp|Q5LCW4|SUCC_BACFN Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=sucC PE=3 SV=1 102 379 1.0E-43
sp|B0VSL0|SUCC_ACIBS Succinyl-CoA ligase [ADP-forming] subunit beta OS=Acinetobacter baumannii (strain SDF) GN=sucC PE=3 SV=1 28 357 2.0E-43
sp|O67546|SUCC_AQUAE Succinyl-CoA ligase [ADP-forming] subunit beta OS=Aquifex aeolicus (strain VF5) GN=sucC PE=3 SV=1 28 384 2.0E-43
sp|Q0T6W6|SUCC_SHIF8 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Shigella flexneri serotype 5b (strain 8401) GN=sucC PE=3 SV=1 156 353 2.0E-43
sp|Q2GFL7|SUCC_EHRCR Succinyl-CoA ligase [ADP-forming] subunit beta OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=sucC PE=3 SV=1 179 380 2.0E-43
sp|A9GD65|SUCC_SORC5 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Sorangium cellulosum (strain So ce56) GN=sucC PE=3 SV=1 102 368 2.0E-43
sp|B3QWF8|SUCC_CHLT3 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=sucC PE=3 SV=1 115 357 3.0E-43
sp|Q87RE8|SUCC_VIBPA Succinyl-CoA ligase [ADP-forming] subunit beta OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=sucC PE=3 SV=1 156 384 4.0E-43
sp|B4ESR1|SUCC_PROMH Succinyl-CoA ligase [ADP-forming] subunit beta OS=Proteus mirabilis (strain HI4320) GN=sucC PE=3 SV=1 156 384 4.0E-43
sp|Q2NUM2|SUCC_SODGM Succinyl-CoA ligase [ADP-forming] subunit beta OS=Sodalis glossinidius (strain morsitans) GN=sucC PE=3 SV=1 156 353 4.0E-43
sp|A6T6F6|SUCC_KLEP7 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=sucC PE=3 SV=1 156 357 4.0E-43
sp|B5XZD1|SUCC_KLEP3 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Klebsiella pneumoniae (strain 342) GN=sucC PE=3 SV=1 156 357 4.0E-43
sp|Q3A7Y4|SUCC_PELCD Succinyl-CoA ligase [ADP-forming] subunit beta OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=sucC PE=3 SV=1 28 358 4.0E-43
sp|A0LIY8|SUCC_SYNFM Succinyl-CoA ligase [ADP-forming] subunit beta OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=sucC PE=3 SV=1 156 375 5.0E-43
sp|Q7N6V5|SUCC_PHOLL Succinyl-CoA ligase [ADP-forming] subunit beta OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=sucC PE=3 SV=1 156 384 9.0E-43
sp|Q324I4|SUCC_SHIBS Succinyl-CoA ligase [ADP-forming] subunit beta OS=Shigella boydii serotype 4 (strain Sb227) GN=sucC PE=3 SV=1 156 353 1.0E-42
sp|B2TUB2|SUCC_SHIB3 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=sucC PE=3 SV=1 156 353 1.0E-42
sp|Q6F8L4|SUCC_ACIAD Succinyl-CoA ligase [ADP-forming] subunit beta OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=sucC PE=3 SV=1 28 357 1.0E-42
sp|A3DLR9|SUCC_STAMF Succinyl-CoA ligase [ADP-forming] subunit beta OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=sucC PE=3 SV=1 28 382 1.0E-42
sp|A7N158|SUCC_VIBCB Succinyl-CoA ligase [ADP-forming] subunit beta OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=sucC PE=3 SV=1 156 384 1.0E-42
sp|B8FLW6|SUCC_DESAA Succinyl-CoA ligase [ADP-forming] subunit beta OS=Desulfatibacillum alkenivorans (strain AK-01) GN=sucC PE=3 SV=1 159 382 1.0E-42
sp|B6IP72|SUCC_RHOCS Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=sucC PE=3 SV=1 116 357 1.0E-42
sp|C5BEM7|SUCC_EDWI9 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Edwardsiella ictaluri (strain 93-146) GN=sucC PE=3 SV=1 28 357 1.0E-42
sp|Q482S1|SUCC_COLP3 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=sucC PE=3 SV=1 156 359 1.0E-42
sp|A1JRB6|SUCC_YERE8 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=sucC PE=3 SV=1 156 357 2.0E-42
sp|Q255N7|SUCC_CHLFF Succinyl-CoA ligase [ADP-forming] subunit beta OS=Chlamydophila felis (strain Fe/C-56) GN=sucC PE=3 SV=1 30 383 2.0E-42
sp|Q8EFN8|SUCC_SHEON Succinyl-CoA ligase [ADP-forming] subunit beta OS=Shewanella oneidensis (strain MR-1) GN=sucC PE=3 SV=1 158 384 2.0E-42
sp|Q6D7G2|SUCC_PECAS Succinyl-CoA ligase [ADP-forming] subunit beta OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=sucC PE=3 SV=1 156 357 2.0E-42
sp|C6DCD6|SUCC_PECCP Succinyl-CoA ligase [ADP-forming] subunit beta OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=sucC PE=3 SV=1 156 357 2.0E-42
sp|C4K7D7|SUCC_HAMD5 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=sucC PE=3 SV=1 28 353 2.0E-42
sp|B7VI35|SUCC_VIBTL Succinyl-CoA ligase [ADP-forming] subunit beta OS=Vibrio tasmaniensis (strain LGP32) GN=sucC PE=3 SV=1 156 384 2.0E-42
sp|Q080X8|SUCC_SHEFN Succinyl-CoA ligase [ADP-forming] subunit beta OS=Shewanella frigidimarina (strain NCIMB 400) GN=sucC PE=3 SV=1 158 384 3.0E-42
sp|Q12M63|SUCC_SHEDO Succinyl-CoA ligase [ADP-forming] subunit beta OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=sucC PE=3 SV=1 156 384 3.0E-42
sp|Q65SV1|SUCC_MANSM Succinyl-CoA ligase [ADP-forming] subunit beta OS=Mannheimia succiniciproducens (strain MBEL55E) GN=sucC PE=3 SV=1 156 357 3.0E-42
sp|A6VPM2|SUCC_ACTSZ Succinyl-CoA ligase [ADP-forming] subunit beta OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=sucC PE=3 SV=1 156 357 3.0E-42
sp|B4SEH6|SUCC_PELPB Succinyl-CoA ligase [ADP-forming] subunit beta OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=sucC PE=3 SV=1 28 357 4.0E-42
sp|A9B0I2|SUCC_HERA2 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=sucC PE=3 SV=1 28 383 4.0E-42
sp|Q21IW6|SUCC_SACD2 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=sucC PE=3 SV=1 156 357 5.0E-42
sp|C3LP35|SUCC_VIBCM Succinyl-CoA ligase [ADP-forming] subunit beta OS=Vibrio cholerae serotype O1 (strain M66-2) GN=sucC PE=3 SV=1 156 357 6.0E-42
sp|Q9KQB5|SUCC_VIBCH Succinyl-CoA ligase [ADP-forming] subunit beta OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=sucC PE=3 SV=1 156 357 6.0E-42
sp|A5F6G6|SUCC_VIBC3 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=sucC PE=3 SV=1 156 357 6.0E-42
sp|A8GB83|SUCC_SERP5 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Serratia proteamaculans (strain 568) GN=sucC PE=3 SV=1 156 378 7.0E-42
sp|Q7MMN3|SUCC_VIBVY Succinyl-CoA ligase [ADP-forming] subunit beta OS=Vibrio vulnificus (strain YJ016) GN=sucC PE=3 SV=1 156 382 8.0E-42
sp|Q3IGW5|SUCC_PSEHT Succinyl-CoA ligase [ADP-forming] subunit beta OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=sucC PE=3 SV=1 156 359 9.0E-42
sp|Q98KT9|MTKA_RHILO Probable malate--CoA ligase subunit beta OS=Rhizobium loti (strain MAFF303099) GN=mtkA PE=3 SV=1 156 357 9.0E-42
sp|Q3SKM1|SUCC_THIDA Succinyl-CoA ligase [ADP-forming] subunit beta OS=Thiobacillus denitrificans (strain ATCC 25259) GN=sucC PE=3 SV=1 115 381 9.0E-42
sp|B1JG57|SUCC_YERPY Succinyl-CoA ligase [ADP-forming] subunit beta OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=sucC PE=3 SV=1 156 378 1.0E-41
sp|Q66DA0|SUCC_YERPS Succinyl-CoA ligase [ADP-forming] subunit beta OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=sucC PE=3 SV=1 156 378 1.0E-41
sp|A4TNT8|SUCC_YERPP Succinyl-CoA ligase [ADP-forming] subunit beta OS=Yersinia pestis (strain Pestoides F) GN=sucC PE=3 SV=1 156 378 1.0E-41
sp|Q1CFM0|SUCC_YERPN Succinyl-CoA ligase [ADP-forming] subunit beta OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=sucC PE=3 SV=1 156 378 1.0E-41
sp|A9R2F2|SUCC_YERPG Succinyl-CoA ligase [ADP-forming] subunit beta OS=Yersinia pestis bv. Antiqua (strain Angola) GN=sucC PE=3 SV=1 156 378 1.0E-41
sp|Q8ZH00|SUCC_YERPE Succinyl-CoA ligase [ADP-forming] subunit beta OS=Yersinia pestis GN=sucC PE=3 SV=1 156 378 1.0E-41
sp|B2K8F1|SUCC_YERPB Succinyl-CoA ligase [ADP-forming] subunit beta OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=sucC PE=3 SV=1 156 378 1.0E-41
sp|Q1CAG1|SUCC_YERPA Succinyl-CoA ligase [ADP-forming] subunit beta OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=sucC PE=3 SV=1 156 378 1.0E-41
sp|A7FKR4|SUCC_YERP3 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=sucC PE=3 SV=1 156 378 1.0E-41
sp|P25126|SUCC_THETH Succinyl-CoA ligase [ADP-forming] subunit beta OS=Thermus thermophilus GN=sucC PE=1 SV=1 28 351 1.0E-41
sp|Q8DFQ1|SUCC_VIBVU Succinyl-CoA ligase [ADP-forming] subunit beta OS=Vibrio vulnificus (strain CMCP6) GN=sucC PE=3 SV=1 156 382 1.0E-41
sp|B8CR00|SUCC_SHEPW Succinyl-CoA ligase [ADP-forming] subunit beta OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=sucC PE=3 SV=1 28 384 1.0E-41
sp|O28732|SUCC1_ARCFU Succinyl-CoA ligase [ADP-forming] subunit beta-1 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=sucC1 PE=3 SV=2 28 381 1.0E-41
sp|A9L532|SUCC_SHEB9 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Shewanella baltica (strain OS195) GN=sucC PE=3 SV=1 158 384 1.0E-41
sp|A6WPA4|SUCC_SHEB8 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Shewanella baltica (strain OS185) GN=sucC PE=3 SV=1 158 384 1.0E-41
sp|A3D5J3|SUCC_SHEB5 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=sucC PE=3 SV=1 158 384 1.0E-41
sp|B8E770|SUCC_SHEB2 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Shewanella baltica (strain OS223) GN=sucC PE=3 SV=1 158 384 1.0E-41
sp|Q8KFE7|SUCC_CHLTE Succinyl-CoA ligase [ADP-forming] subunit beta OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=sucC PE=3 SV=1 28 357 1.0E-41
sp|B1KPH0|SUCC_SHEWM Succinyl-CoA ligase [ADP-forming] subunit beta OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=sucC PE=3 SV=1 28 384 2.0E-41
sp|Q30RQ3|SUCC_SULDN Succinyl-CoA ligase [ADP-forming] subunit beta OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=sucC PE=3 SV=1 116 351 2.0E-41
sp|A1WZ92|SUCC_HALHL Succinyl-CoA ligase [ADP-forming] subunit beta OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=sucC PE=3 SV=1 156 357 2.0E-41
sp|Q0HW00|SUCC_SHESR Succinyl-CoA ligase [ADP-forming] subunit beta OS=Shewanella sp. (strain MR-7) GN=sucC PE=3 SV=1 158 384 2.0E-41
sp|Q0HJQ4|SUCC_SHESM Succinyl-CoA ligase [ADP-forming] subunit beta OS=Shewanella sp. (strain MR-4) GN=sucC PE=3 SV=1 158 384 2.0E-41
sp|A1RIT3|SUCC_SHESW Succinyl-CoA ligase [ADP-forming] subunit beta OS=Shewanella sp. (strain W3-18-1) GN=sucC PE=3 SV=1 158 384 2.0E-41
sp|A4Y7Q5|SUCC_SHEPC Succinyl-CoA ligase [ADP-forming] subunit beta OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=sucC PE=3 SV=1 158 384 2.0E-41
sp|Q5L593|SUCC_CHLAB Succinyl-CoA ligase [ADP-forming] subunit beta OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=sucC PE=3 SV=1 30 382 3.0E-41
sp|B0TJP8|SUCC_SHEHH Succinyl-CoA ligase [ADP-forming] subunit beta OS=Shewanella halifaxensis (strain HAW-EB4) GN=sucC PE=3 SV=1 156 359 3.0E-41
sp|A1S5I0|SUCC_SHEAM Succinyl-CoA ligase [ADP-forming] subunit beta OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=sucC PE=3 SV=1 158 384 4.0E-41
sp|A8H3H6|SUCC_SHEPA Succinyl-CoA ligase [ADP-forming] subunit beta OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=sucC PE=3 SV=1 158 384 4.0E-41
sp|Q3YSV6|SUCC_EHRCJ Succinyl-CoA ligase [ADP-forming] subunit beta OS=Ehrlichia canis (strain Jake) GN=sucC PE=3 SV=1 163 383 4.0E-41
sp|A8FX46|SUCC_SHESH Succinyl-CoA ligase [ADP-forming] subunit beta OS=Shewanella sediminis (strain HAW-EB3) GN=sucC PE=3 SV=1 158 384 6.0E-41
sp|A0LZD4|SUCC_GRAFK Succinyl-CoA ligase [ADP-forming] subunit beta OS=Gramella forsetii (strain KT0803) GN=sucC PE=3 SV=1 156 368 7.0E-41
sp|Q0VPF7|SUCC_ALCBS Succinyl-CoA ligase [ADP-forming] subunit beta OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=sucC PE=3 SV=1 28 379 9.0E-41
sp|B5FC28|SUCC_VIBFM Succinyl-CoA ligase [ADP-forming] subunit beta OS=Vibrio fischeri (strain MJ11) GN=sucC PE=3 SV=1 156 353 1.0E-40
sp|Q5E6M6|SUCC_VIBF1 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=sucC PE=3 SV=1 156 353 1.0E-40
sp|A6VZ30|SUCC_MARMS Succinyl-CoA ligase [ADP-forming] subunit beta OS=Marinomonas sp. (strain MWYL1) GN=sucC PE=3 SV=1 156 384 1.0E-40
sp|Q6ARL2|SUCC_DESPS Succinyl-CoA ligase [ADP-forming] subunit beta OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=sucC PE=3 SV=1 96 375 2.0E-40
sp|Q4FVH9|SUCC_PSYA2 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=sucC PE=3 SV=1 156 359 3.0E-40
sp|B9LRR0|SUCC_HALLT Succinyl-CoA ligase [ADP-forming] subunit beta OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=sucC PE=3 SV=1 28 383 3.0E-40
sp|A3QDH6|SUCC_SHELP Succinyl-CoA ligase [ADP-forming] subunit beta OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=sucC PE=3 SV=1 156 359 4.0E-40
sp|Q3INN3|SUCC_NATPD Succinyl-CoA ligase [ADP-forming] subunit beta OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=sucC PE=3 SV=1 28 385 5.0E-40
sp|A0KVX6|SUCC_SHESA Succinyl-CoA ligase [ADP-forming] subunit beta OS=Shewanella sp. (strain ANA-3) GN=sucC PE=3 SV=1 158 384 5.0E-40
sp|B6EHV6|SUCC_ALISL Succinyl-CoA ligase [ADP-forming] subunit beta OS=Aliivibrio salmonicida (strain LFI1238) GN=sucC PE=3 SV=1 156 353 8.0E-40
sp|Q1QEK5|SUCC_PSYCK Succinyl-CoA ligase [ADP-forming] subunit beta OS=Psychrobacter cryohalolentis (strain K5) GN=sucC PE=3 SV=1 156 359 8.0E-40
sp|A1TZS9|SUCC_MARHV Succinyl-CoA ligase [ADP-forming] subunit beta OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=sucC PE=3 SV=1 156 381 1.0E-39
sp|A1BE51|SUCC_CHLPD Succinyl-CoA ligase [ADP-forming] subunit beta OS=Chlorobium phaeobacteroides (strain DSM 266) GN=sucC PE=3 SV=1 115 357 1.0E-39
sp|C1F2F2|SUCC_ACIC5 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=sucC PE=3 SV=1 156 359 1.0E-39
sp|Q6LTB5|SUCC_PHOPR Succinyl-CoA ligase [ADP-forming] subunit beta OS=Photobacterium profundum GN=sucC PE=3 SV=1 156 353 1.0E-39
sp|A4WL16|SUCC_PYRAR Succinyl-CoA ligase [ADP-forming] subunit beta OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=sucC PE=3 SV=1 28 381 2.0E-39
sp|O28097|SUCC2_ARCFU Succinyl-CoA ligase [ADP-forming] subunit beta-2 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=sucC2 PE=3 SV=1 28 383 4.0E-39
sp|B8GN38|SUCC_THISH Succinyl-CoA ligase [ADP-forming] subunit beta OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=sucC PE=3 SV=1 156 357 4.0E-39
sp|Q6MBM7|SUCC_PARUW Succinyl-CoA ligase [ADP-forming] subunit beta OS=Protochlamydia amoebophila (strain UWE25) GN=sucC PE=3 SV=1 28 358 5.0E-39
sp|Q7UKI3|SUCC_RHOBA Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=sucC PE=3 SV=2 115 357 8.0E-39
sp|B2VBR6|SUCC_ERWT9 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=sucC PE=3 SV=1 156 384 8.0E-39
sp|B2GM49|SUCC_KOCRD Succinyl-CoA ligase [ADP-forming] subunit beta OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=sucC PE=3 SV=1 28 377 1.0E-38
sp|P53594|MTKA_METEA Malate--CoA ligase subunit beta OS=Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / AM1) GN=mtkA PE=3 SV=2 116 379 3.0E-38
sp|Q9PL99|SUCC_CHLMU Succinyl-CoA ligase [ADP-forming] subunit beta OS=Chlamydia muridarum (strain MoPn / Nigg) GN=sucC PE=3 SV=1 28 381 3.0E-38
sp|C5C916|SUCC_MICLC Succinyl-CoA ligase [ADP-forming] subunit beta OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=sucC PE=3 SV=1 28 364 4.0E-38
sp|Q7M9A6|SUCC_WOLSU Succinyl-CoA ligase [ADP-forming] subunit beta OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=sucC PE=3 SV=1 28 381 6.0E-38
sp|B0SAP0|SUCC_LEPBA Succinyl-CoA ligase [ADP-forming] subunit beta OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=sucC PE=3 SV=1 102 359 7.0E-38
sp|Q9Z6T6|SUCC_CHLPN Succinyl-CoA ligase [ADP-forming] subunit beta OS=Chlamydia pneumoniae GN=sucC PE=3 SV=1 28 358 1.0E-37
sp|B8D5I6|SUCC_DESK1 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Desulfurococcus kamchatkensis (strain 1221n / DSM 18924) GN=sucC PE=3 SV=1 162 380 2.0E-37
sp|A1TEP3|SUCC_MYCVP Succinyl-CoA ligase [ADP-forming] subunit beta OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=sucC PE=3 SV=1 28 377 2.0E-37
sp|A4XBE5|SUCC_SALTO Succinyl-CoA ligase [ADP-forming] subunit beta OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=sucC PE=3 SV=1 28 364 4.0E-37
sp|A8A8L8|SUCC_IGNH4 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=sucC PE=3 SV=1 84 382 1.0E-36
sp|B1MJJ0|SUCC_MYCA9 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=sucC PE=3 SV=1 28 369 2.0E-36
sp|A4T6V7|SUCC_MYCGI Succinyl-CoA ligase [ADP-forming] subunit beta OS=Mycobacterium gilvum (strain PYR-GCK) GN=sucC PE=3 SV=1 28 377 3.0E-36
sp|A1RTB8|SUCC_PYRIL Succinyl-CoA ligase [ADP-forming] subunit beta OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=sucC PE=3 SV=1 28 382 3.0E-36
sp|Q8ZVF3|SUCC_PYRAE Succinyl-CoA ligase [ADP-forming] subunit beta OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=sucC PE=3 SV=1 28 381 4.0E-36
sp|Q6AD57|SUCC_LEIXX Succinyl-CoA ligase [ADP-forming] subunit beta OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=sucC PE=3 SV=1 28 379 4.0E-36
sp|Q5V4Q4|SUCC_HALMA Succinyl-CoA ligase [ADP-forming] subunit beta OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=sucC PE=3 SV=1 28 386 5.0E-36
sp|C1ALT7|SUCC_MYCBT Succinyl-CoA ligase [ADP-forming] subunit beta OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=sucC PE=3 SV=1 28 381 5.0E-36
sp|A1KH85|SUCC_MYCBP Succinyl-CoA ligase [ADP-forming] subunit beta OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=sucC PE=3 SV=1 28 381 5.0E-36
sp|Q7U0Z1|SUCC_MYCBO Succinyl-CoA ligase [ADP-forming] subunit beta OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=sucC PE=3 SV=1 28 381 5.0E-36
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3852
MQKCRLGLAGLVQKPSIYSVPKTGARWLTLYKSQALDMLQQAGVRVRPSQVVSTACEAEAAAKQYGYDCSIKTSD
SQEQAVQRPGQAAAMASKMLSQRAKAQLVVAQRVEQVGLWYLAMTIDRENYCPAIVVSTRPGHVQWFDFGFSEGI
TDQVVQRLAQQLGLSAALSSSMQALLQGLYRVFRAKEASHVEIGSLALGANGSLTCLDARLAFDPAAAHRQPVLF
AQRDTQHQQPAEVEAEQHGLVYVPMAGGSVGTVVNGAGLAMATADAIALHGGASANFLDAGGKATRETMLHAFAI
VARDARVASILVNVYGGITRCDMIAQSILAARHHLAIALPMVVRLQGTNSELGLDMLKSVHNGLYVESDFGRAAQ
LAVQLAEERRAEPSF*
Coding >OphauB2|3852
ATGCAAAAGTGTCGTCTGGGGCTCGCGGGCCTTGTGCAAAAGCCCTCCATCTACAGCGTGCCCAAGACGGGTGCA
CGATGGCTTACTCTTTACAAGAGCCAGGCTCTCGACATGTTGCAACAAGCCGGCGTGCGAGTGCGCCCAAGCCAA
GTTGTAAGCACGGCGTGCGAGGCGGAAGCAGCAGCAAAACAATATGGCTACGACTGCTCCATCAAGACAAGCGAC
AGCCAAGAGCAGGCAGTGCAGCGGCCCGGACAGGCTGCGGCCATGGCGAGCAAGATGCTCTCGCAGCGGGCCAAG
GCGCAGCTGGTGGTGGCGCAAAGAGTAGAGCAGGTTGGGCTGTGGTATCTGGCCATGACGATTGACCGCGAAAAC
TACTGTCCGGCCATTGTTGTCTCGACCAGGCCAGGGCATGTGCAGTGGTTCGACTTTGGCTTCTCCGAGGGCATC
ACAGACCAGGTGGTGCAGCGTCTGGCGCAGCAGCTGGGGCTGTCGGCGGCGCTCAGCTCGAGCATGCAGGCTCTG
CTGCAAGGGCTATATCGCGTCTTCCGGGCCAAGGAGGCAAGCCATGTTGAGATTGGCTCTCTGGCCCTGGGCGCC
AATGGCTCGCTGACCTGTCTCGACGCCAGACTGGCCTTTGACCCGGCCGCCGCCCATCGCCAGCCCGTGCTGTTT
GCCCAGCGCGACACACAGCACCAGCAGCCGGCCGAGGTGGAGGCAGAGCAGCATGGCCTCGTCTACGTGCCCATG
GCGGGCGGCTCCGTCGGCACCGTGGTCAACGGCGCTGGACTGGCCATGGCCACGGCTGATGCCATTGCTTTGCAC
GGCGGCGCCAGCGCAAACTTTCTCGACGCCGGCGGCAAGGCCACTCGCGAGACCATGCTGCACGCCTTTGCCATT
GTCGCCCGCGATGCCCGAGTCGCCTCCATCCTCGTCAACGTCTATGGCGGCATCACCCGCTGCGACATGATTGCC
CAATCCATCCTTGCCGCCAGACACCACCTCGCCATTGCCCTGCCCATGGTGGTGCGTCTGCAGGGCACAAACTCG
GAGCTCGGTCTCGACATGCTCAAGTCGGTCCACAATGGCCTCTATGTTGAGTCGGACTTTGGTCGCGCCGCCCAG
CTGGCTGTCCAACTCGCAGAGGAGCGACGAGCCGAGCCCTCTTTTTGA
Transcript >OphauB2|3852
ATGCAAAAGTGTCGTCTGGGGCTCGCGGGCCTTGTGCAAAAGCCCTCCATCTACAGCGTGCCCAAGACGGGTGCA
CGATGGCTTACTCTTTACAAGAGCCAGGCTCTCGACATGTTGCAACAAGCCGGCGTGCGAGTGCGCCCAAGCCAA
GTTGTAAGCACGGCGTGCGAGGCGGAAGCAGCAGCAAAACAATATGGCTACGACTGCTCCATCAAGACAAGCGAC
AGCCAAGAGCAGGCAGTGCAGCGGCCCGGACAGGCTGCGGCCATGGCGAGCAAGATGCTCTCGCAGCGGGCCAAG
GCGCAGCTGGTGGTGGCGCAAAGAGTAGAGCAGGTTGGGCTGTGGTATCTGGCCATGACGATTGACCGCGAAAAC
TACTGTCCGGCCATTGTTGTCTCGACCAGGCCAGGGCATGTGCAGTGGTTCGACTTTGGCTTCTCCGAGGGCATC
ACAGACCAGGTGGTGCAGCGTCTGGCGCAGCAGCTGGGGCTGTCGGCGGCGCTCAGCTCGAGCATGCAGGCTCTG
CTGCAAGGGCTATATCGCGTCTTCCGGGCCAAGGAGGCAAGCCATGTTGAGATTGGCTCTCTGGCCCTGGGCGCC
AATGGCTCGCTGACCTGTCTCGACGCCAGACTGGCCTTTGACCCGGCCGCCGCCCATCGCCAGCCCGTGCTGTTT
GCCCAGCGCGACACACAGCACCAGCAGCCGGCCGAGGTGGAGGCAGAGCAGCATGGCCTCGTCTACGTGCCCATG
GCGGGCGGCTCCGTCGGCACCGTGGTCAACGGCGCTGGACTGGCCATGGCCACGGCTGATGCCATTGCTTTGCAC
GGCGGCGCCAGCGCAAACTTTCTCGACGCCGGCGGCAAGGCCACTCGCGAGACCATGCTGCACGCCTTTGCCATT
GTCGCCCGCGATGCCCGAGTCGCCTCCATCCTCGTCAACGTCTATGGCGGCATCACCCGCTGCGACATGATTGCC
CAATCCATCCTTGCCGCCAGACACCACCTCGCCATTGCCCTGCCCATGGTGGTGCGTCTGCAGGGCACAAACTCG
GAGCTCGGTCTCGACATGCTCAAGTCGGTCCACAATGGCCTCTATGTTGAGTCGGACTTTGGTCGCGCCGCCCAG
CTGGCTGTCCAACTCGCAGAGGAGCGACGAGCCGAGCCCTCTTTTTGA
Gene >OphauB2|3852
ATGCAAAAGTGTCGTCTGGGGCTCGCGGGCCTTGTGCAAAAGGTATTCCACGTGCGGTGGACATGTATGCAAATG
CAACACAAAGAAAACACTTGACTCACAAAGGCCGTTGCAATAGCCCTCCATCTACAGCGTGCCCAAGACGGGTGC
ACGATGGCTTACTCTTTACAAGAGCCAGGCTCTCGACATGTTGCAACAAGTAGCTCTCCCAAACCCATTCATCAT
GGCATCCATCATGGCATCCCTCATGGCATTCATCATGGCATCCCTCATGGTACAAGACCTAAGCTCACGCATGAG
CACCAGGCCGGCGTGCGAGTGCGCCCAAGCCAAGTTGTAAGCACGGCGTGCGAGGCGGAAGCAGCAGCAAAACAA
TATGGTGAGGGCTCCCACGGCTTCAACGGCAGCAAGAGCCTGACTTTGCAGCAGGCTACGACTGCTCCATCAAGA
CAAGCGACAGCCAAGAGCAGGCAGTGCAGCGGCCCGGACAGGCTGCGGCCATGGCGAGCAAGATGCTCTCGCAGC
GGGCCAAGGCGCAGCTGGTGGTGGCGCAAAGAGTAGAGCAGGTTGGGCTGTGGTATCTGGCCATGACGATTGACC
GCGAAAACTACTGTCCGGCCATTGTTGTCTCGACCAGGCCAGGGCATGTGCAGTGGTTCGACTTTGGCTTCTCCG
AGGGCATCACAGACCAGGTGGTGCAGCGTCTGGCGCAGCAGCTGGGGCTGTCGGCGGCGCTCAGCTCGAGCATGC
AGGCTCTGCTGCAAGGGCTATATCGCGTCTTCCGGGCCAAGGAGGCAAGCCATGTTGAGATTGGCTCTCTGGCCC
TGGGCGCCAATGGCTCGCTGACCTGTCTCGACGCCAGACTGGCCTTTGACCCGGCCGCCGCCCATCGCCAGCCCG
TGCTGTTTGCCCAGCGCGACACACAGCACCAGCAGCCGGCCGAGGTGGAGGCAGAGCAGCATGGCCTCGTCTACG
TGCCCATGGCGGGCGGCTCCGTCGGCACCGTGGTCAACGGCGCTGGACTGGCCATGGCCACGGCTGATGCCATTG
CTTTGCACGGCGGCGCCAGCGCAAACTTTCTCGACGCCGGCGGCAAGGCCACTCGCGAGACCATGCTGCACGCCT
TTGCCATTGTCGCCCGCGATGCCCGAGTCGCCTCCATCCTCGTCAACGTCTATGGCGGCATCACCCGCTGCGACA
TGATTGCCCAATCCATCCTTGCCGCCAGACACCACCTCGCCATTGCCCTGCCCATGGTGGTGCGTCTGCAGGGCA
CAAACTCGGAGCTCGGTCTCGACATGGTGAGTGAGCCCTGGTCCTCCTTGTCCGTCTTGTCCGCCCCGTCCCGCC
TGACTTGTCGCCCTCTAGCTCAAGTCGGTCCACAATGGCCTCTATGTTGAGTCGGACTTTGGTCGCGCCGCCCAG
CTGGCTGTCCAACTCGCAGAGGAGCGACGAGCCGAGCCCTCTTTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail