Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3851
Gene name
LocationContig_248:13927..14701
Strand-
Gene length (bp)774
Transcript length (bp)654
Coding sequence length (bp)654
Protein length (aa) 218

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00132 Hexapep Bacterial transferase hexapeptide (six repeats) 5.6E-12 157 192
PF12464 Mac Maltose acetyltransferase 3.1E-13 28 85
PF14602 Hexapep_2 Hexapeptide repeat of succinyl-transferase 7.5E-12 158 192

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09707|YA39_SCHPO Putative acetyltransferase C18B11.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC18B11.09c PE=3 SV=2 20 212 2.0E-48
sp|P40892|YJV8_YEAST Putative acetyltransferase YJL218W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YJL218W PE=1 SV=1 27 211 5.0E-46
sp|P28266|NODL_RHIME Nodulation protein L OS=Rhizobium meliloti (strain 1021) GN=nodL PE=3 SV=1 27 207 4.0E-45
sp|Q552S7|Y5913_DICDI Putative acetyltransferase DDB_G0275913 OS=Dictyostelium discoideum GN=DDB_G0275913 PE=3 SV=1 25 211 5.0E-44
sp|P07464|THGA_ECOLI Galactoside O-acetyltransferase OS=Escherichia coli (strain K12) GN=lacA PE=1 SV=1 27 211 1.0E-41
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09707|YA39_SCHPO Putative acetyltransferase C18B11.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC18B11.09c PE=3 SV=2 20 212 2.0E-48
sp|P40892|YJV8_YEAST Putative acetyltransferase YJL218W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YJL218W PE=1 SV=1 27 211 5.0E-46
sp|P28266|NODL_RHIME Nodulation protein L OS=Rhizobium meliloti (strain 1021) GN=nodL PE=3 SV=1 27 207 4.0E-45
sp|Q552S7|Y5913_DICDI Putative acetyltransferase DDB_G0275913 OS=Dictyostelium discoideum GN=DDB_G0275913 PE=3 SV=1 25 211 5.0E-44
sp|P07464|THGA_ECOLI Galactoside O-acetyltransferase OS=Escherichia coli (strain K12) GN=lacA PE=1 SV=1 27 211 1.0E-41
sp|P08632|NODL_RHILV Nodulation protein L OS=Rhizobium leguminosarum bv. viciae GN=nodL PE=3 SV=1 27 207 5.0E-41
sp|P77791|MAA_ECOLI Maltose O-acetyltransferase OS=Escherichia coli (strain K12) GN=maa PE=1 SV=3 27 211 3.0E-40
sp|Q8NUR1|ATRF2_STAAW Putative acetyltransferase MW2476 OS=Staphylococcus aureus (strain MW2) GN=MW2476 PE=3 SV=1 27 212 7.0E-39
sp|Q6G6B9|ATRF2_STAAS Putative acetyltransferase SAS2441 OS=Staphylococcus aureus (strain MSSA476) GN=SAS2441 PE=3 SV=1 27 212 7.0E-39
sp|Q5HCZ5|ATRF2_STAAC Putative acetyltransferase SACOL2570 OS=Staphylococcus aureus (strain COL) GN=SACOL2570 PE=1 SV=1 27 212 7.0E-39
sp|Q7A3E8|ATRF2_STAAN Putative acetyltransferase SA2342 OS=Staphylococcus aureus (strain N315) GN=SA2342 PE=1 SV=1 27 212 1.0E-38
sp|Q7A2K9|ATRF2_STAAM Putative acetyltransferase SAV2555 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV2555 PE=3 SV=1 27 212 1.0E-38
sp|Q9KWJ8|ATRF2_STAA1 Putative acetyltransferase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=SAHV_2539 PE=3 SV=1 27 212 1.0E-38
sp|Q6GDP3|ATRF2_STAAR Putative acetyltransferase SAR2635 OS=Staphylococcus aureus (strain MRSA252) GN=SAR2635 PE=3 SV=1 27 212 1.0E-38
sp|Q4L967|ATRF2_STAHJ Putative acetyltransferase SH0499 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH0499 PE=3 SV=1 27 211 1.0E-38
sp|P37515|MAA_BACSU Probable maltose O-acetyltransferase OS=Bacillus subtilis (strain 168) GN=maa PE=3 SV=1 25 211 7.0E-38
sp|Q54UU2|Y0825_DICDI Putative acetyltransferase DDB_G0280825 OS=Dictyostelium discoideum GN=DDB_G0280825 PE=3 SV=1 25 211 4.0E-36
sp|Q86A05|Y5507_DICDI Putative acetyltransferase DDB_G0275507 OS=Dictyostelium discoideum GN=DDB_G0275507 PE=3 SV=1 21 209 8.0E-34
sp|P52984|THGA_LACLA Galactoside O-acetyltransferase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=lacA PE=3 SV=1 20 211 5.0E-32
sp|Q58464|Y1064_METJA Uncharacterized acetyltransferase MJ1064 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1064 PE=3 SV=1 87 212 2.0E-16
sp|P50869|CAT4_MORMO Chloramphenicol acetyltransferase OS=Morganella morganii GN=cat PE=3 SV=1 125 209 9.0E-13
sp|P50868|CAT4_ENTAE Chloramphenicol acetyltransferase OS=Enterobacter aerogenes GN=catB4 PE=3 SV=1 125 209 2.0E-12
sp|A7GS09|DAPH_BACCN 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dapH PE=3 SV=1 42 212 2.0E-12
sp|P0ACD3|WCAF_SHIFL Putative colanic acid biosynthesis acetyltransferase WcaF OS=Shigella flexneri GN=wcaF PE=3 SV=1 67 209 4.0E-12
sp|P0ACD2|WCAF_ECOLI Putative colanic acid biosynthesis acetyltransferase WcaF OS=Escherichia coli (strain K12) GN=wcaF PE=3 SV=1 67 209 4.0E-12
sp|Q6GIM9|ATRF1_STAAR Putative acetyltransferase SAR0816 OS=Staphylococcus aureus (strain MRSA252) GN=SAR0816 PE=3 SV=1 94 207 2.0E-11
sp|Q7A1G0|ATRF1_STAAW Putative acetyltransferase MW0724 OS=Staphylococcus aureus (strain MW2) GN=MW0724 PE=3 SV=1 94 207 3.0E-11
sp|Q6GB68|ATRF1_STAAS Putative acetyltransferase SAS0727 OS=Staphylococcus aureus (strain MSSA476) GN=SAS0727 PE=3 SV=1 94 207 3.0E-11
sp|Q7A6Q9|ATRF1_STAAN Putative acetyltransferase SA0717 OS=Staphylococcus aureus (strain N315) GN=SA0717 PE=3 SV=1 94 207 3.0E-11
sp|Q99VL4|ATRF1_STAAM Putative acetyltransferase SAV0762 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV0762 PE=3 SV=1 94 207 3.0E-11
sp|Q5HHQ6|ATRF1_STAAC Putative acetyltransferase SACOL0827 OS=Staphylococcus aureus (strain COL) GN=SACOL0827 PE=3 SV=1 94 207 3.0E-11
sp|B7GIC1|DAPH_ANOFW 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=dapH PE=3 SV=1 155 212 3.0E-11
sp|P26840|MATA_LYSSH Probable macrolide acetyltransferase (Fragment) OS=Lysinibacillus sphaericus PE=3 SV=1 159 209 3.0E-11
sp|P39856|CAPG_STAAU Protein CapG OS=Staphylococcus aureus GN=capG PE=3 SV=1 73 212 3.0E-11
sp|B9K867|DAPH_THENN 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=dapH PE=3 SV=1 155 212 4.0E-11
sp|A1ADJ6|NEUO_ECOK1 Polysialic acid O-acetyltransferase OS=Escherichia coli O1:K1 / APEC GN=neuO PE=1 SV=1 83 209 1.0E-10
sp|Q2YXZ7|DAPH_STAAB 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dapH PE=3 SV=1 89 216 3.0E-10
sp|Q7A0X6|DAPH_STAAW 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Staphylococcus aureus (strain MW2) GN=dapH PE=3 SV=1 89 216 3.0E-10
sp|Q9EZ10|DAPH_STAAU 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Staphylococcus aureus GN=dapH PE=3 SV=1 89 216 3.0E-10
sp|A8Z3X5|DAPH_STAAT 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dapH PE=3 SV=1 89 216 3.0E-10
sp|Q6G9G4|DAPH_STAAS 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Staphylococcus aureus (strain MSSA476) GN=dapH PE=3 SV=1 89 216 3.0E-10
sp|Q7A5P7|DAPH_STAAN 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Staphylococcus aureus (strain N315) GN=dapH PE=3 SV=1 89 216 3.0E-10
sp|Q7A2S0|DAPH_STAAM 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dapH PE=1 SV=1 89 216 3.0E-10
sp|Q5HG23|DAPH_STAAC 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Staphylococcus aureus (strain COL) GN=dapH PE=3 SV=1 89 216 3.0E-10
sp|A5ISS9|DAPH_STAA9 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Staphylococcus aureus (strain JH9) GN=dapH PE=3 SV=1 89 216 3.0E-10
sp|Q2FYN7|DAPH_STAA8 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Staphylococcus aureus (strain NCTC 8325) GN=dapH PE=3 SV=1 89 216 3.0E-10
sp|Q2FH41|DAPH_STAA3 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Staphylococcus aureus (strain USA300) GN=dapH PE=3 SV=1 89 216 3.0E-10
sp|A6U1L8|DAPH_STAA2 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Staphylococcus aureus (strain JH1) GN=dapH PE=3 SV=1 89 216 3.0E-10
sp|A7X274|DAPH_STAA1 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dapH PE=3 SV=1 89 216 3.0E-10
sp|O53281|Y3034_MYCTU Putative acetyltransferase Rv3034c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv3034c PE=1 SV=1 122 209 3.0E-10
sp|P26838|CAT4_ECOLX Chloramphenicol acetyltransferase OS=Escherichia coli GN=catB2 PE=3 SV=2 119 209 3.0E-10
sp|Q6GH11|DAPH_STAAR 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Staphylococcus aureus (strain MRSA252) GN=dapH PE=3 SV=1 89 216 3.0E-10
sp|O34993|YVOF_BACSU Putative acetyltransferase YvoF OS=Bacillus subtilis (strain 168) GN=yvoF PE=3 SV=1 110 216 4.0E-10
sp|A6QGU8|DAPH_STAAE 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Staphylococcus aureus (strain Newman) GN=dapH PE=3 SV=1 89 216 5.0E-10
sp|Q5FKR1|DAPH_LACAC 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=dapH PE=3 SV=1 122 212 7.0E-10
sp|P50870|VATD_ENTFC Streptogramin A acetyltransferase OS=Enterococcus faecium GN=vatD PE=1 SV=1 89 209 8.0E-10
sp|Q8ERA4|DAPH_OCEIH 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=dapH PE=3 SV=1 45 212 9.0E-10
sp|P26839|VATA_STAAU Virginiamycin A acetyltransferase OS=Staphylococcus aureus GN=vat PE=1 SV=2 132 209 9.0E-10
sp|P23364|CAT4_AGRFC Chloramphenicol acetyltransferase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=cat PE=3 SV=1 119 209 1.0E-09
sp|Q03CW1|DAPH_LACC3 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Lactobacillus casei (strain ATCC 334) GN=dapH PE=3 SV=1 84 211 2.0E-09
sp|A6LUD2|DAPH_CLOB8 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=dapH PE=3 SV=1 160 212 2.0E-09
sp|Q4L6A2|DAPH_STAHJ 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dapH PE=3 SV=1 89 216 7.0E-09
sp|B9DP25|DAPH_STACT 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Staphylococcus carnosus (strain TM300) GN=dapH PE=3 SV=1 89 216 8.0E-09
sp|P37750|WBBJ_ECOLI Putative lipopolysaccharide biosynthesis O-acetyl transferase WbbJ OS=Escherichia coli (strain K12) GN=wbbJ PE=3 SV=2 155 209 9.0E-09
sp|B2V5B7|DAPH_CLOBA 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=dapH PE=3 SV=1 159 212 1.0E-08
sp|A6LP60|DAPH_THEM4 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=dapH PE=3 SV=1 155 212 2.0E-08
sp|B2TS78|DAPH_CLOBB 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=dapH PE=3 SV=1 159 212 2.0E-08
sp|C4L2D4|DAPH_EXISA 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=dapH PE=3 SV=1 69 209 2.0E-08
sp|Q97GI6|DAPH_CLOAB 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=dapH PE=3 SV=1 113 212 2.0E-08
sp|Q8RBI7|DAPH_CALS4 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=dapH PE=3 SV=1 158 212 3.0E-08
sp|B3W7E7|DAPH_LACCB 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Lactobacillus casei (strain BL23) GN=dapH PE=3 SV=1 84 211 4.0E-08
sp|B1IMX1|DAPH_CLOBK 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Clostridium botulinum (strain Okra / Type B1) GN=dapH PE=3 SV=1 159 212 4.0E-08
sp|A5I6N5|DAPH_CLOBH 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=dapH PE=3 SV=1 159 212 4.0E-08
sp|A7FYA5|DAPH_CLOB1 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=dapH PE=3 SV=1 159 212 4.0E-08
sp|P26841|CAT4_PSEAE Chloramphenicol acetyltransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cat PE=1 SV=3 119 209 5.0E-08
sp|A7GI22|DAPH_CLOBL 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=dapH PE=3 SV=1 159 212 6.0E-08
sp|Q1AXL7|GLMU_RUBXD Bifunctional protein GlmU OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=glmU PE=3 SV=1 160 209 6.0E-08
sp|B1L0V4|DAPH_CLOBM 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=dapH PE=3 SV=1 159 212 6.0E-08
sp|C3KTL7|DAPH_CLOB6 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=dapH PE=3 SV=1 159 212 7.0E-08
sp|C1FL32|DAPH_CLOBJ 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=dapH PE=3 SV=1 159 212 7.0E-08
sp|Q39218|SAT3_ARATH Serine acetyltransferase 3, mitochondrial OS=Arabidopsis thaliana GN=SAT3 PE=1 SV=3 160 208 7.0E-08
sp|Q9X1W4|GLMU_THEMA Bifunctional protein GlmU OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=glmU PE=3 SV=1 160 209 1.0E-07
sp|B0K4I5|DAPH_THEPX 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Thermoanaerobacter sp. (strain X514) GN=dapH PE=3 SV=1 158 212 1.0E-07
sp|B0KAL9|DAPH_THEP3 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=dapH PE=3 SV=1 23 212 1.0E-07
sp|Q8DVY7|DAPH_STRMU 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dapH PE=3 SV=1 152 212 1.0E-07
sp|A8YUT1|DAPH_LACH4 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Lactobacillus helveticus (strain DPC 4571) GN=dapH PE=3 SV=1 122 212 1.0E-07
sp|A9BHR6|DAPH_PETMO 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=dapH PE=3 SV=1 155 212 1.0E-07
sp|A3CQT5|DAPH_STRSV 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Streptococcus sanguinis (strain SK36) GN=dapH PE=3 SV=1 152 212 1.0E-07
sp|Q03YE4|DAPH_LEUMM 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=dapH PE=3 SV=1 96 212 2.0E-07
sp|B1YJ41|DAPH_EXIS2 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=dapH PE=3 SV=1 158 209 2.0E-07
sp|B0RWB8|GLMU_XANCB Bifunctional protein GlmU OS=Xanthomonas campestris pv. campestris (strain B100) GN=glmU PE=3 SV=1 150 208 2.0E-07
sp|C1CN43|DAPH_STRZP 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Streptococcus pneumoniae (strain P1031) GN=dapH PE=3 SV=1 152 212 2.0E-07
sp|C1CH25|DAPH_STRZJ 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Streptococcus pneumoniae (strain JJA) GN=dapH PE=3 SV=1 152 212 2.0E-07
sp|Q8DN54|DAPH_STRR6 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dapH PE=3 SV=1 152 212 2.0E-07
sp|B2IN15|DAPH_STRPS 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Streptococcus pneumoniae (strain CGSP14) GN=dapH PE=3 SV=1 152 212 2.0E-07
sp|Q97NE6|DAPH_STRPN 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dapH PE=3 SV=1 152 212 2.0E-07
sp|B8ZPL9|DAPH_STRPJ 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dapH PE=3 SV=1 152 212 2.0E-07
sp|B1I9G3|DAPH_STRPI 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=dapH PE=3 SV=1 152 212 2.0E-07
sp|C1CAS4|DAPH_STRP7 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Streptococcus pneumoniae (strain 70585) GN=dapH PE=3 SV=1 152 212 2.0E-07
sp|B5E3A4|DAPH_STRP4 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=dapH PE=3 SV=1 152 212 2.0E-07
sp|Q04I77|DAPH_STRP2 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dapH PE=3 SV=1 152 212 2.0E-07
sp|C5CFS2|GLMU_KOSOT Bifunctional protein GlmU OS=Kosmotoga olearia (strain TBF 19.5.1) GN=glmU PE=3 SV=1 150 209 2.0E-07
sp|Q8PCZ1|GLMU_XANCP Bifunctional protein GlmU OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=glmU PE=3 SV=1 150 208 2.0E-07
sp|Q4UQF8|GLMU_XANC8 Bifunctional protein GlmU OS=Xanthomonas campestris pv. campestris (strain 8004) GN=glmU PE=3 SV=1 150 208 2.0E-07
sp|G3XD01|WBPD_PSEAE UDP-2-acetamido-3-amino-2,3-dideoxy-D-glucuronate N-acetyltransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=wbpD PE=1 SV=1 84 208 2.0E-07
sp|Q57752|Y304_METJA Uncharacterized protein MJ0304 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0304 PE=3 SV=1 109 209 2.0E-07
sp|A8AUL9|DAPH_STRGC 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=dapH PE=3 SV=1 152 212 2.0E-07
sp|C1CU00|DAPH_STRZT 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dapH PE=3 SV=1 158 212 2.0E-07
sp|B7IF15|DAPH_THEAB 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Thermosipho africanus (strain TCF52B) GN=dapH PE=3 SV=1 155 212 3.0E-07
sp|Q03IN0|DAPH_STRTD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=dapH PE=3 SV=1 152 212 3.0E-07
sp|Q5M2I4|DAPH_STRT2 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=dapH PE=3 SV=1 152 212 3.0E-07
sp|Q5LXY2|DAPH_STRT1 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=dapH PE=3 SV=1 152 212 3.0E-07
sp|B1LBD9|GLMU_THESQ Bifunctional protein GlmU OS=Thermotoga sp. (strain RQ2) GN=glmU PE=3 SV=1 160 209 3.0E-07
sp|A5ILV3|GLMU_THEP1 Bifunctional protein GlmU OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=glmU PE=3 SV=1 160 209 3.0E-07
sp|P32003|CYSE_BUCAP Serine acetyltransferase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=cysE PE=3 SV=1 115 212 4.0E-07
sp|B1MZN0|DAPH_LEUCK 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Leuconostoc citreum (strain KM20) GN=dapH PE=3 SV=1 96 212 5.0E-07
sp|A4VY24|DAPH_STRSY 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Streptococcus suis (strain 05ZYH33) GN=dapH PE=3 SV=2 152 212 6.0E-07
sp|A4W4B5|DAPH_STRS2 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Streptococcus suis (strain 98HAH33) GN=dapH PE=3 SV=1 152 212 6.0E-07
sp|B9DVY7|DAPH_STRU0 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=dapH PE=3 SV=1 152 212 6.0E-07
sp|B2G6M7|DAPH_LACRJ 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Lactobacillus reuteri (strain JCM 1112) GN=dapH PE=3 SV=1 96 212 7.0E-07
sp|A5VJ56|DAPH_LACRD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Lactobacillus reuteri (strain DSM 20016) GN=dapH PE=3 SV=1 96 212 7.0E-07
sp|Q9CIS5|DAPH_LACLA 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dapH PE=3 SV=1 152 212 8.0E-07
sp|A2RI05|DAPH_LACLM 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=dapH PE=3 SV=1 152 212 9.0E-07
sp|Q42588|SAT1_ARATH Serine acetyltransferase 1, chloroplastic OS=Arabidopsis thaliana GN=SAT1 PE=1 SV=2 115 212 1.0E-06
sp|Q8W0E4|SAT1_ORYSJ Probable serine acetyltransferase 1 OS=Oryza sativa subsp. japonica GN=SAT1 PE=2 SV=1 115 208 1.0E-06
sp|A7HKM7|GLMU_FERNB Bifunctional protein GlmU OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=glmU PE=3 SV=1 160 209 1.0E-06
sp|Q42538|SAT5_ARATH Serine acetyltransferase 5 OS=Arabidopsis thaliana GN=SAT5 PE=1 SV=1 115 212 1.0E-06
sp|A5WHT0|GLMU_PSYWF Bifunctional protein GlmU OS=Psychrobacter sp. (strain PRwf-1) GN=glmU PE=3 SV=1 150 209 2.0E-06
sp|Q032G9|DAPH_LACLS 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=dapH PE=3 SV=1 152 212 2.0E-06
sp|Q1IQY5|GLMU_KORVE Bifunctional protein GlmU OS=Koribacter versatilis (strain Ellin345) GN=glmU PE=3 SV=1 150 209 2.0E-06
sp|Q6T1W7|FDTC_ANETH dTDP-3-amino-3,6-dideoxy-alpha-D-galactopyranose 3-N-acetyltransferase OS=Aneurinibacillus thermoaerophilus GN=fdtC PE=1 SV=1 78 207 2.0E-06
sp|Q6F6U9|GLMU_ACIAD Bifunctional protein GlmU OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=glmU PE=3 SV=1 160 210 3.0E-06
sp|Q06750|CYSE_BACSU Serine acetyltransferase OS=Bacillus subtilis (strain 168) GN=cysE PE=1 SV=1 159 208 3.0E-06
sp|B2FHY5|GLMU_STRMK Bifunctional protein GlmU OS=Stenotrophomonas maltophilia (strain K279a) GN=glmU PE=3 SV=1 129 201 4.0E-06
sp|Q10S58|SAT2_ORYSJ Probable serine acetyltransferase 2 OS=Oryza sativa subsp. japonica GN=SAT2 PE=2 SV=1 160 208 5.0E-06
sp|Q0DGG8|SAT5_ORYSJ Probable serine acetyltransferase 5 OS=Oryza sativa subsp. japonica GN=SAT5 PE=2 SV=2 115 208 5.0E-06
sp|B0VPT6|GLMU_ACIBS Bifunctional protein GlmU OS=Acinetobacter baumannii (strain SDF) GN=glmU PE=3 SV=1 159 210 7.0E-06
sp|B2I2B5|GLMU_ACIBC Bifunctional protein GlmU OS=Acinetobacter baumannii (strain ACICU) GN=glmU PE=3 SV=1 159 210 7.0E-06
sp|B0V9X1|GLMU_ACIBY Bifunctional protein GlmU OS=Acinetobacter baumannii (strain AYE) GN=glmU PE=3 SV=1 159 210 8.0E-06
sp|Q88V23|DAPH_LACPL 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dapH PE=3 SV=1 158 212 8.0E-06
sp|B3PZN3|GLMU_RHIE6 Bifunctional protein GlmU OS=Rhizobium etli (strain CIAT 652) GN=glmU PE=3 SV=1 150 209 9.0E-06
sp|A8F961|CYSE_BACP2 Serine acetyltransferase OS=Bacillus pumilus (strain SAFR-032) GN=cysE PE=3 SV=1 159 208 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016407 acetyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0016746 acyltransferase activity No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3851
MASPEKDQALISFAKTLANVPWCDDYEKMISGSRYNANVPELLEGRFKAKKLMHKYNNHFPHDATVQSLTSDREA
FLKAMLGKVGQNPFIEPPLNIDYGCNISIGHSFYSNFNLVILDCAMVTIGNRVMFGPFVSIFAATHETDVQSRRD
GIERASGVTIGDDCWIGGNTTIMPGVTIGKGCTIGAGSVVTRSIPPFSLALGSPARVIKAVEPVPDI*
Coding >OphauB2|3851
ATGGCGTCTCCGGAAAAAGATCAGGCCCTCATCTCATTCGCCAAGACCCTGGCCAATGTGCCTTGGTGTGACGAC
TATGAAAAAATGATTTCTGGCTCAAGGTACAATGCCAATGTGCCAGAGCTCCTCGAGGGCCGCTTCAAGGCCAAA
AAACTCATGCACAAGTACAACAACCACTTTCCCCATGATGCCACGGTGCAGTCACTCACATCCGACCGCGAGGCC
TTTCTCAAGGCCATGCTGGGCAAAGTCGGCCAGAACCCCTTTATAGAGCCGCCCCTCAACATTGACTATGGCTGC
AACATCAGCATTGGCCATTCCTTCTACTCAAACTTCAACCTCGTCATTCTCGACTGTGCCATGGTGACAATTGGC
AACCGTGTCATGTTTGGCCCCTTTGTCTCCATCTTTGCCGCCACCCACGAGACCGACGTCCAGTCTCGCCGCGAC
GGCATCGAGCGTGCCAGCGGCGTCACCATTGGCGACGACTGCTGGATCGGCGGCAACACCACAATCATGCCTGGC
GTCACCATTGGCAAGGGATGCACCATTGGCGCTGGCAGCGTCGTTACTCGCTCAATACCGCCTTTTTCCCTTGCT
CTTGGATCTCCCGCACGAGTCATCAAGGCCGTTGAGCCAGTCCCTGACATTTAA
Transcript >OphauB2|3851
ATGGCGTCTCCGGAAAAAGATCAGGCCCTCATCTCATTCGCCAAGACCCTGGCCAATGTGCCTTGGTGTGACGAC
TATGAAAAAATGATTTCTGGCTCAAGGTACAATGCCAATGTGCCAGAGCTCCTCGAGGGCCGCTTCAAGGCCAAA
AAACTCATGCACAAGTACAACAACCACTTTCCCCATGATGCCACGGTGCAGTCACTCACATCCGACCGCGAGGCC
TTTCTCAAGGCCATGCTGGGCAAAGTCGGCCAGAACCCCTTTATAGAGCCGCCCCTCAACATTGACTATGGCTGC
AACATCAGCATTGGCCATTCCTTCTACTCAAACTTCAACCTCGTCATTCTCGACTGTGCCATGGTGACAATTGGC
AACCGTGTCATGTTTGGCCCCTTTGTCTCCATCTTTGCCGCCACCCACGAGACCGACGTCCAGTCTCGCCGCGAC
GGCATCGAGCGTGCCAGCGGCGTCACCATTGGCGACGACTGCTGGATCGGCGGCAACACCACAATCATGCCTGGC
GTCACCATTGGCAAGGGATGCACCATTGGCGCTGGCAGCGTCGTTACTCGCTCAATACCGCCTTTTTCCCTTGCT
CTTGGATCTCCCGCACGAGTCATCAAGGCCGTTGAGCCAGTCCCTGACATTTAA
Gene >OphauB2|3851
ATGGCGTCTCCGGAAAAAGATCAGGCCCTCATCTCATTCGCCAAGACCCTGGCCAATGTGCCTTGGTGTGACGAC
TATGAAAAAATGATTTCTGGCTCAAGGTTTGCAGCTTGCCTTCTTGCCCCAACCAACGCAAAGCACACTTGGCCT
GACGATGCAAACGAGACTAGGTACAATGCCAATGTGCCAGAGCTCCTCGAGGGCCGCTTCAAGGCCAAAAAACTC
ATGCACAAGTACAACAACCACTTTCCCCATGATGCCACGGTGCAGTCACTCACATCCGACCGCGAGGCCTTTCTC
AAGGCCATGCTGGGCAAAGTCGGCCAGAACCCCTTTATAGAGCCGCCCCTCAACATTGACTATGGCTGCAACATC
AGCATTGGCCATTCCTTCTACTCAAACTTCAAGTACGTCGTCGCCTCTGCCGCCTCGAGTCTCGTGCCTGACATT
GCCCACAGCCTCGTCATTCTCGACTGTGCCATGGTGACAATTGGCAACCGTGTCATGTTTGGCCCCTTTGTCTCC
ATCTTTGCCGCCACCCACGAGACCGACGTCCAGTCTCGCCGCGACGGCATCGAGCGTGCCAGCGGCGTCACCATT
GGCGACGACTGCTGGATCGGCGGCAACACCACAATCATGCCTGGCGTCACCATTGGCAAGGGATGCACCATTGGC
GCTGGCAGCGTCGTTACTCGCTCAATACCGCCTTTTTCCCTTGCTCTTGGATCTCCCGCACGAGTCATCAAGGCC
GTTGAGCCAGTCCCTGACATTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail