Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3841
Gene name
LocationContig_247:7318..10944
Strand+
Gene length (bp)3626
Transcript length (bp)3471
Coding sequence length (bp)3471
Protein length (aa) 1157

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02891 zf-MIZ MIZ/SP-RING zinc finger 1.1E-11 1008 1064

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8NF64|ZMIZ2_HUMAN Zinc finger MIZ domain-containing protein 2 OS=Homo sapiens GN=ZMIZ2 PE=1 SV=2 895 1119 1.0E-13
sp|Q8CIE2|ZMIZ2_MOUSE Zinc finger MIZ domain-containing protein 2 OS=Mus musculus GN=Zmiz2 PE=2 SV=2 895 1119 2.0E-13
sp|Q94361|GEI17_CAEEL E3 SUMO-protein ligase gei-17 OS=Caenorhabditis elegans GN=gei-17 PE=1 SV=4 968 1111 2.0E-13
sp|Q9ULJ6|ZMIZ1_HUMAN Zinc finger MIZ domain-containing protein 1 OS=Homo sapiens GN=ZMIZ1 PE=1 SV=3 895 1119 2.0E-12
sp|Q6P1E1|ZMIZ1_MOUSE Zinc finger MIZ domain-containing protein 1 OS=Mus musculus GN=Zmiz1 PE=2 SV=1 895 1119 3.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8NF64|ZMIZ2_HUMAN Zinc finger MIZ domain-containing protein 2 OS=Homo sapiens GN=ZMIZ2 PE=1 SV=2 895 1119 1.0E-13
sp|Q8CIE2|ZMIZ2_MOUSE Zinc finger MIZ domain-containing protein 2 OS=Mus musculus GN=Zmiz2 PE=2 SV=2 895 1119 2.0E-13
sp|Q94361|GEI17_CAEEL E3 SUMO-protein ligase gei-17 OS=Caenorhabditis elegans GN=gei-17 PE=1 SV=4 968 1111 2.0E-13
sp|Q9ULJ6|ZMIZ1_HUMAN Zinc finger MIZ domain-containing protein 1 OS=Homo sapiens GN=ZMIZ1 PE=1 SV=3 895 1119 2.0E-12
sp|Q6P1E1|ZMIZ1_MOUSE Zinc finger MIZ domain-containing protein 1 OS=Mus musculus GN=Zmiz1 PE=2 SV=1 895 1119 3.0E-12
sp|Q04195|SIZ1_YEAST E3 SUMO-protein ligase SIZ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIZ1 PE=1 SV=1 968 1110 2.0E-10
sp|Q12216|SIZ2_YEAST E3 SUMO-protein ligase SIZ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NFI1 PE=1 SV=1 986 1108 5.0E-09
sp|A0A0A7EPL0|PIAL1_ARATH E4 SUMO-protein ligase PIAL1 OS=Arabidopsis thaliana GN=PIAL1 PE=2 SV=1 983 1148 5.0E-09
sp|O94451|PLI1_SCHPO E3 SUMO-protein ligase pli1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pli1 PE=1 SV=3 980 1106 2.0E-08
sp|F4JYG0|PIAL2_ARATH E4 SUMO-protein ligase PIAL2 OS=Arabidopsis thaliana GN=PIAL2 PE=1 SV=1 1007 1125 7.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0046872 metal ion binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0046914 transition metal ion binding No
GO:0043169 cation binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Zinc finger, MIZ-type

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup755
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5303
Ophiocordyceps australis map64 (Brazil) OphauB2|3841 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|00931
Ophiocordyceps camponoti-floridani Ophcf2|00932
Ophiocordyceps camponoti-rufipedis Ophun1|4955
Ophiocordyceps kimflemingae Ophio5|5282
Ophiocordyceps subramaniannii Hirsu2|2359

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3841
MVMSNETSYAFLGLQRPAWMLAATPSTTATAERPNRARTGAPPRGSGPRPSPPGSKGLSKGLSKGLPKHLCNANN
SSAAQPQPPKWATIAPIKRPVSHSPHRPTLDMTATADCSRETGADAPSCDQLPALISADNFAPSGGTCIVADAQH
PAVLSHDCQKMAGPHEPSILPSPALTSEPSPAASTPNFTDSAAHPDGSLALSHHNLASPAASLNPTPLQSAQACF
ASTETAPSGSSEPRHDSSIHFVPQVESTGPTSAAATTLPPSMAPSVLVLPALAPNPPSLDSTAKRLSSQFAAPGA
VQNEGAVDDRPQKRQRIASTPQTPHLLSSVTADSPQPLIHYLQGFETQLKAALPTLAGNSPTAMRYTLLLEAFQK
NDFFFIILHQIFCIWLLDKNLAYPLVNVARPLTDSALRILSSALNCNSDLYLDNTSRWFASWPLPSNIYAGAQIR
QMAPKIFQQIDHFMPSFAHKWQTVAQATRDRGFPMLVVEMKEQLMCPSPTMHSIFFSSTRRALGYTDDQRISLLL
QRVFLFDQGNESRPRTDAAAFFYSRQAIAHQYHSLVMGSRSGQTQLSNTVSHHTHHTMSEHAPSAYYPAQPQSQP
TPLMSNAAAPMTGFPNSPRDANAFGANAGFRGIRGPGQVACPAPAYSTTTMTTNGTVLTPSLPDGFVTSNPAGYV
QGAQAAAYSLPPQTATQSLQGPRLMQTAPPPQVSDTRQSRLARPMSSQQGTFFAQGQQLAPLPPRPLQTWPLGPQ
QAPVVRQSSQMVVRSQHSVAQPSRSLPPTNEWESVSVGLHLLHLRSPTRAPLGPTNLSDDKRFYQYVTHFAVEPR
VMPARRGLRVLSFFVSEEEKAKLVKTTNSNGLPMALYSSQSLRYRLRMSKYGRDTCEAKTEDWVIRPYAWPACLF
LTFNEQMVQPRRSQHFGRDLPIELTDLVCVGENTLKVSMPDEAANHVKDQLYWIAIEVVAFNDHDGVRLAVEMNE
HTTIAETKQDVERRLTANSSDDVIVQNNTLCVSITDPFSFDLIETPVRGVDCKHLECFDLENWLQTRPQKQSKTG
HEPCTVDCWKCPICGLDARPVSLRVNDFLVDVRKNIKNNKGVCVKKIEIVADGSWKAIEEEDEGDTEDETPLMNT
LVQRRKEASSRTDSAPTLKRALRTIIVLDDD*
Coding >OphauB2|3841
ATGGTGATGAGCAATGAGACGTCTTACGCCTTTCTCGGGCTCCAGCGGCCGGCCTGGATGTTGGCGGCTACACCA
AGCACTACGGCCACGGCGGAAAGGCCAAACAGGGCAAGGACTGGTGCACCGCCGCGTGGATCAGGTCCCAGGCCG
AGCCCCCCCGGCTCCAAGGGCCTCTCCAAGGGCCTCTCCAAGGGCCTCCCCAAGCACCTCTGCAACGCCAACAAT
TCCTCTGCTGCTCAACCTCAACCGCCCAAATGGGCAACAATAGCGCCAATCAAGCGCCCCGTCTCCCACTCGCCT
CATCGGCCGACCCTTGACATGACTGCCACTGCTGACTGTTCCCGCGAGACTGGTGCTGATGCGCCGTCTTGCGAC
CAGCTGCCGGCCCTCATCTCCGCTGACAATTTTGCGCCCTCAGGAGGCACATGCATCGTTGCCGACGCGCAACAT
CCCGCTGTGCTCTCGCACGACTGCCAGAAAATGGCTGGGCCCCACGAGCCTTCTATTCTTCCTTCGCCTGCTCTC
ACCAGCGAGCCCAGCCCGGCTGCATCAACGCCAAACTTTACCGATAGCGCTGCCCACCCCGATGGCTCCCTGGCC
CTCTCGCACCACAATCTGGCCTCTCCCGCTGCCAGCTTGAATCCAACACCCTTGCAGTCGGCGCAAGCCTGCTTC
GCCTCGACTGAAACAGCGCCTAGTGGCTCCAGCGAGCCTCGCCATGACTCCTCGATCCATTTTGTCCCACAAGTC
GAGTCTACGGGCCCGACTTCGGCTGCAGCCACGACTTTGCCTCCATCCATGGCCCCTTCAGTTCTTGTTCTCCCC
GCCCTCGCTCCAAACCCGCCCAGCCTCGACAGTACTGCCAAGCGCCTGTCGAGCCAATTTGCTGCCCCTGGTGCC
GTCCAAAATGAGGGCGCAGTGGATGACAGGCCTCAGAAACGGCAGCGCATCGCCAGCACTCCTCAAACACCACAC
TTGCTCTCGTCTGTCACGGCAGACAGCCCGCAGCCTCTGATTCACTACCTGCAGGGCTTTGAAACCCAATTAAAG
GCTGCCCTACCCACTCTGGCGGGCAATTCTCCCACAGCGATGCGATATACGCTGCTCCTGGAAGCCTTTCAGAAA
AACGACTTCTTTTTCATCATTCTTCACCAGATATTCTGCATATGGCTTCTGGATAAAAACCTTGCTTATCCCCTT
GTCAATGTTGCACGCCCTCTGACTGACTCTGCTCTCCGCATTCTCTCGAGTGCTTTGAATTGCAACTCGGATCTA
TACTTGGACAATACATCCCGCTGGTTCGCCTCGTGGCCACTTCCTTCTAATATCTATGCTGGTGCGCAAATTCGT
CAAATGGCCCCCAAGATTTTCCAACAAATCGACCACTTCATGCCGTCCTTTGCCCACAAATGGCAAACTGTCGCA
CAAGCCACACGTGACAGAGGCTTTCCCATGCTGGTGGTGGAGATGAAGGAGCAGCTCATGTGTCCCTCGCCAACA
ATGCACTCCATCTTTTTCTCATCGACAAGACGCGCTCTTGGCTACACTGATGACCAGCGCATCTCCCTCTTGCTG
CAACGCGTCTTCCTCTTTGACCAAGGAAACGAGTCTCGGCCCCGTACTGACGCCGCTGCCTTTTTCTACTCGCGC
CAGGCCATTGCGCATCAGTATCACTCTCTTGTCATGGGCTCTCGCTCCGGCCAGACACAGCTGTCCAACACTGTC
TCTCATCACACCCACCACACGATGAGTGAGCACGCCCCAAGTGCTTACTACCCGGCCCAACCTCAAAGCCAGCCC
ACCCCTTTGATGAGCAATGCAGCTGCCCCTATGACTGGCTTCCCCAATAGCCCTCGTGATGCCAACGCCTTTGGA
GCAAATGCCGGTTTTCGGGGCATTAGAGGCCCGGGTCAAGTCGCCTGTCCAGCTCCAGCTTACAGCACCACCACA
ATGACCACCAATGGCACCGTCTTGACGCCTTCGCTGCCAGACGGTTTTGTAACGAGCAACCCGGCTGGCTATGTG
CAAGGTGCACAGGCTGCGGCTTACTCGCTGCCACCCCAGACTGCAACTCAGTCACTTCAAGGACCAAGGTTGATG
CAAACAGCACCTCCTCCTCAAGTGTCTGACACACGGCAAAGTCGACTCGCGAGGCCCATGAGTAGTCAGCAGGGC
ACCTTCTTTGCCCAGGGGCAGCAGCTCGCCCCCCTTCCCCCGCGGCCCCTGCAAACGTGGCCGTTGGGCCCCCAA
CAGGCACCTGTGGTCAGGCAGTCGAGCCAAATGGTGGTGCGCAGTCAACATTCTGTGGCTCAGCCAAGTCGCAGT
CTGCCACCCACAAATGAATGGGAGTCTGTTTCTGTGGGTCTGCATTTGCTGCATTTACGCAGTCCCACGAGAGCA
CCCTTGGGACCAACTAACCTCAGCGACGATAAGCGCTTCTACCAATACGTGACGCATTTTGCCGTGGAGCCGCGA
GTCATGCCTGCCCGACGCGGTCTTCGTGTCCTTTCGTTTTTCGTGTCGGAGGAGGAAAAGGCCAAGCTCGTAAAG
ACGACAAATTCAAACGGCTTGCCCATGGCCCTTTACTCTAGCCAATCGCTCCGCTATCGCCTTCGCATGTCTAAA
TACGGCCGAGACACTTGCGAGGCAAAGACTGAGGATTGGGTGATTCGGCCATATGCTTGGCCGGCCTGTCTGTTC
TTGACATTCAATGAGCAAATGGTACAGCCGCGTCGCAGTCAGCACTTTGGGCGAGATTTGCCAATCGAGCTTACC
GACCTGGTGTGTGTTGGAGAAAACACACTCAAGGTTAGCATGCCCGACGAAGCGGCCAATCATGTCAAGGACCAG
CTCTACTGGATCGCGATTGAAGTCGTGGCGTTCAACGACCACGATGGCGTGCGTCTTGCCGTGGAGATGAATGAG
CATACCACGATTGCCGAGACGAAGCAAGATGTTGAGCGGCGCCTGACAGCAAATAGCAGCGACGACGTCATTGTC
CAAAACAATACCCTTTGTGTCTCGATAACGGACCCCTTTAGCTTTGATTTGATTGAGACGCCTGTTCGCGGCGTC
GACTGCAAACATCTTGAATGCTTTGATCTAGAAAACTGGCTGCAGACTCGACCGCAAAAGCAAAGCAAGACGGGC
CACGAGCCTTGTACAGTCGACTGCTGGAAATGCCCCATATGTGGACTCGACGCTAGGCCTGTCAGTCTGCGAGTC
AATGACTTTCTTGTCGACGTGCGCAAAAACATCAAGAACAACAAGGGCGTTTGCGTCAAGAAGATTGAGATTGTT
GCCGATGGCAGCTGGAAAGCGATTGAGGAAGAGGACGAGGGTGATACAGAAGATGAGACACCATTAATGAATACT
TTGGTACAGCGACGAAAGGAGGCTTCATCTAGGACAGATAGTGCACCGACTTTGAAGCGCGCTCTTCGCACAATC
ATCGTTTTGGATGATGATTAG
Transcript >OphauB2|3841
ATGGTGATGAGCAATGAGACGTCTTACGCCTTTCTCGGGCTCCAGCGGCCGGCCTGGATGTTGGCGGCTACACCA
AGCACTACGGCCACGGCGGAAAGGCCAAACAGGGCAAGGACTGGTGCACCGCCGCGTGGATCAGGTCCCAGGCCG
AGCCCCCCCGGCTCCAAGGGCCTCTCCAAGGGCCTCTCCAAGGGCCTCCCCAAGCACCTCTGCAACGCCAACAAT
TCCTCTGCTGCTCAACCTCAACCGCCCAAATGGGCAACAATAGCGCCAATCAAGCGCCCCGTCTCCCACTCGCCT
CATCGGCCGACCCTTGACATGACTGCCACTGCTGACTGTTCCCGCGAGACTGGTGCTGATGCGCCGTCTTGCGAC
CAGCTGCCGGCCCTCATCTCCGCTGACAATTTTGCGCCCTCAGGAGGCACATGCATCGTTGCCGACGCGCAACAT
CCCGCTGTGCTCTCGCACGACTGCCAGAAAATGGCTGGGCCCCACGAGCCTTCTATTCTTCCTTCGCCTGCTCTC
ACCAGCGAGCCCAGCCCGGCTGCATCAACGCCAAACTTTACCGATAGCGCTGCCCACCCCGATGGCTCCCTGGCC
CTCTCGCACCACAATCTGGCCTCTCCCGCTGCCAGCTTGAATCCAACACCCTTGCAGTCGGCGCAAGCCTGCTTC
GCCTCGACTGAAACAGCGCCTAGTGGCTCCAGCGAGCCTCGCCATGACTCCTCGATCCATTTTGTCCCACAAGTC
GAGTCTACGGGCCCGACTTCGGCTGCAGCCACGACTTTGCCTCCATCCATGGCCCCTTCAGTTCTTGTTCTCCCC
GCCCTCGCTCCAAACCCGCCCAGCCTCGACAGTACTGCCAAGCGCCTGTCGAGCCAATTTGCTGCCCCTGGTGCC
GTCCAAAATGAGGGCGCAGTGGATGACAGGCCTCAGAAACGGCAGCGCATCGCCAGCACTCCTCAAACACCACAC
TTGCTCTCGTCTGTCACGGCAGACAGCCCGCAGCCTCTGATTCACTACCTGCAGGGCTTTGAAACCCAATTAAAG
GCTGCCCTACCCACTCTGGCGGGCAATTCTCCCACAGCGATGCGATATACGCTGCTCCTGGAAGCCTTTCAGAAA
AACGACTTCTTTTTCATCATTCTTCACCAGATATTCTGCATATGGCTTCTGGATAAAAACCTTGCTTATCCCCTT
GTCAATGTTGCACGCCCTCTGACTGACTCTGCTCTCCGCATTCTCTCGAGTGCTTTGAATTGCAACTCGGATCTA
TACTTGGACAATACATCCCGCTGGTTCGCCTCGTGGCCACTTCCTTCTAATATCTATGCTGGTGCGCAAATTCGT
CAAATGGCCCCCAAGATTTTCCAACAAATCGACCACTTCATGCCGTCCTTTGCCCACAAATGGCAAACTGTCGCA
CAAGCCACACGTGACAGAGGCTTTCCCATGCTGGTGGTGGAGATGAAGGAGCAGCTCATGTGTCCCTCGCCAACA
ATGCACTCCATCTTTTTCTCATCGACAAGACGCGCTCTTGGCTACACTGATGACCAGCGCATCTCCCTCTTGCTG
CAACGCGTCTTCCTCTTTGACCAAGGAAACGAGTCTCGGCCCCGTACTGACGCCGCTGCCTTTTTCTACTCGCGC
CAGGCCATTGCGCATCAGTATCACTCTCTTGTCATGGGCTCTCGCTCCGGCCAGACACAGCTGTCCAACACTGTC
TCTCATCACACCCACCACACGATGAGTGAGCACGCCCCAAGTGCTTACTACCCGGCCCAACCTCAAAGCCAGCCC
ACCCCTTTGATGAGCAATGCAGCTGCCCCTATGACTGGCTTCCCCAATAGCCCTCGTGATGCCAACGCCTTTGGA
GCAAATGCCGGTTTTCGGGGCATTAGAGGCCCGGGTCAAGTCGCCTGTCCAGCTCCAGCTTACAGCACCACCACA
ATGACCACCAATGGCACCGTCTTGACGCCTTCGCTGCCAGACGGTTTTGTAACGAGCAACCCGGCTGGCTATGTG
CAAGGTGCACAGGCTGCGGCTTACTCGCTGCCACCCCAGACTGCAACTCAGTCACTTCAAGGACCAAGGTTGATG
CAAACAGCACCTCCTCCTCAAGTGTCTGACACACGGCAAAGTCGACTCGCGAGGCCCATGAGTAGTCAGCAGGGC
ACCTTCTTTGCCCAGGGGCAGCAGCTCGCCCCCCTTCCCCCGCGGCCCCTGCAAACGTGGCCGTTGGGCCCCCAA
CAGGCACCTGTGGTCAGGCAGTCGAGCCAAATGGTGGTGCGCAGTCAACATTCTGTGGCTCAGCCAAGTCGCAGT
CTGCCACCCACAAATGAATGGGAGTCTGTTTCTGTGGGTCTGCATTTGCTGCATTTACGCAGTCCCACGAGAGCA
CCCTTGGGACCAACTAACCTCAGCGACGATAAGCGCTTCTACCAATACGTGACGCATTTTGCCGTGGAGCCGCGA
GTCATGCCTGCCCGACGCGGTCTTCGTGTCCTTTCGTTTTTCGTGTCGGAGGAGGAAAAGGCCAAGCTCGTAAAG
ACGACAAATTCAAACGGCTTGCCCATGGCCCTTTACTCTAGCCAATCGCTCCGCTATCGCCTTCGCATGTCTAAA
TACGGCCGAGACACTTGCGAGGCAAAGACTGAGGATTGGGTGATTCGGCCATATGCTTGGCCGGCCTGTCTGTTC
TTGACATTCAATGAGCAAATGGTACAGCCGCGTCGCAGTCAGCACTTTGGGCGAGATTTGCCAATCGAGCTTACC
GACCTGGTGTGTGTTGGAGAAAACACACTCAAGGTTAGCATGCCCGACGAAGCGGCCAATCATGTCAAGGACCAG
CTCTACTGGATCGCGATTGAAGTCGTGGCGTTCAACGACCACGATGGCGTGCGTCTTGCCGTGGAGATGAATGAG
CATACCACGATTGCCGAGACGAAGCAAGATGTTGAGCGGCGCCTGACAGCAAATAGCAGCGACGACGTCATTGTC
CAAAACAATACCCTTTGTGTCTCGATAACGGACCCCTTTAGCTTTGATTTGATTGAGACGCCTGTTCGCGGCGTC
GACTGCAAACATCTTGAATGCTTTGATCTAGAAAACTGGCTGCAGACTCGACCGCAAAAGCAAAGCAAGACGGGC
CACGAGCCTTGTACAGTCGACTGCTGGAAATGCCCCATATGTGGACTCGACGCTAGGCCTGTCAGTCTGCGAGTC
AATGACTTTCTTGTCGACGTGCGCAAAAACATCAAGAACAACAAGGGCGTTTGCGTCAAGAAGATTGAGATTGTT
GCCGATGGCAGCTGGAAAGCGATTGAGGAAGAGGACGAGGGTGATACAGAAGATGAGACACCATTAATGAATACT
TTGGTACAGCGACGAAAGGAGGCTTCATCTAGGACAGATAGTGCACCGACTTTGAAGCGCGCTCTTCGCACAATC
ATCGTTTTGGATGATGATTAG
Gene >OphauB2|3841
ATGGTGATGAGCAATGAGACGTCTTACGCCTTTCTCGGGCTCCAGCGGCCGGCCTGGATGTTGGCGGCTACACCA
AGCACTACGGCCACGGCGGAAAGGCCAAACAGGGCAAGGACTGGTGCACCGCCGCGTGGATCAGGTCCCAGGCCG
AGCCCCCCCGGCTCCAAGGGCCTCTCCAAGGGCCTCTCCAAGGGCCTCCCCAAGCACCTCTGCAACGCCAACAAT
TCCTCTGCTGCTCAACCTCAACCGCCCAAATGGGCAACAATAGCGCCAATCAAGCGCCCCGTCTCCCACTCGCCT
CATCGGCCGACCCTTGACATGACTGCCACTGCTGACTGTTCCCGCGAGACTGGTGCTGATGCGCCGTCTTGCGAC
CAGCTGCCGGCCCTCATCTCCGCTGACAATTTTGCGCCCTCAGGAGGCACATGCATCGTTGCCGACGCGCAACAT
CCCGCTGTGCTCTCGCACGACTGCCAGAAAATGGCTGGGCCCCAGTGAGCCTTCTCGTCTTGCCCAAGCCCAAAT
CTCTAGACTCCCACGCTGACTGTCTTGCTGTCCGCCCTCTCTGACTTGCAGCGAGCCTTCTATTCTTCCTTCGCC
TGCTCTCACCAGCGAGCCCAGCCCGGCTGCATCAACGCCAAACTTTACCGATAGCGCTGCCCACCCCGATGGCTC
CCTGGCCCTCTCGCACCACAATCTGGCCTCTCCCGCTGCCAGCTTGAATCCAACACCCTTGCAGTCGGCGCAAGC
CTGCTTCGCCTCGACTGAAACAGCGCCTAGTGGCTCCAGCGAGCCTCGCCATGACTCCTCGATCCATTTTGTCCC
ACAAGTCGAGTCTACGGGCCCGACTTCGGCTGCAGCCACGACTTTGCCTCCATCCATGGCCCCTTCAGTTCTTGT
TCTCCCCGCCCTCGCTCCAAACCCGCCCAGCCTCGACAGTACTGCCAAGCGCCTGTCGAGCCAATTTGCTGCCCC
TGGTGCCGTCCAAAATGAGGGCGCAGTGGATGACAGGCCTCAGAAACGGCAGCGCATCGCCAGCACTCCTCAAAC
ACCACACTTGCTCTCGTCTGTCACGGCAGACAGCCCGCAGCCTCTGATTCACTACCTGCAGGGCTTTGAAACCCA
ATTAAAGGCTGCCCTACCCACTCTGGCGGGCAATTCTCCCACAGCGATGCGATATACGCTGCTCCTGGAAGCCTT
TCAGAAAAACGACTTCTTTTTCATCATTCTTCACCAGATATTCTGCATATGGCTTCTGGATAAAAACCTTGCTTA
TCCCCTTGTCAATGTTGCACGCCCTCTGACTGACTCTGCTCTCCGCATTCTCTCGAGTGCTTTGAATTGCAACTC
GGATCTATACTTGGACAATACATCCCGCTGGTTCGCCTCGTGGCCACTTCCTTCTAATATCTATGCTGGTGCGCA
AATTCGTCAAATGGCCCCCAAGATTTTCCAACAAATCGACCACTTCATGCCGTCCTTTGCCCACAAATGGCAAAC
TGTCGCACAAGCCACACGTGACAGAGGCTTTCCCATGCTGGTGGTGGAGATGAAGGAGCAGCTCATGTGTCCCTC
GCCAACAATGCACTCCATCTTTTTCTCATCGACAAGACGCGCTCTTGGCTACACTGATGACCAGCGCATCTCCCT
CTTGCTGCAACGCGTCTTCCTCTTTGACCAAGGAAACGAGTCTCGGCCCCGTACTGACGCCGCTGCCTTTTTCTA
CTCGCGCCAGGCCATTGCGCATCAGTATCACTCTCTTGTCATGGGTAGGCCCTCATCTTTTACCGCTCATCACAT
TGCTGCAAGCCAAGGCCCCCCCACACTAACGGTTTCATGCAGGCTCTCGCTCCGGCCAGACACAGCTGTCCAACA
CTGTCTCTCATCACACCCACCACACGATGAGTGAGCACGCCCCAAGTGCTTACTACCCGGCCCAACCTCAAAGCC
AGCCCACCCCTTTGATGAGCAATGCAGCTGCCCCTATGACTGGCTTCCCCAATAGCCCTCGTGATGCCAACGCCT
TTGGAGCAAATGCCGGTTTTCGGGGCATTAGAGGCCCGGGTCAAGTCGCCTGTCCAGCTCCAGCTTACAGCACCA
CCACAATGACCACCAATGGCACCGTCTTGACGCCTTCGCTGCCAGACGGTTTTGTAACGAGCAACCCGGCTGGCT
ATGTGCAAGGTGCACAGGCTGCGGCTTACTCGCTGCCACCCCAGACTGCAACTCAGTCACTTCAAGGACCAAGGT
TGATGCAAACAGCACCTCCTCCTCAAGTGTCTGACACACGGCAAAGTCGACTCGCGAGGCCCATGAGTAGTCAGC
AGGGCACCTTCTTTGCCCAGGGGCAGCAGCTCGCCCCCCTTCCCCCGCGGCCCCTGCAAACGTGGCCGTTGGGCC
CCCAACAGGCACCTGTGGTCAGGCAGTCGAGCCAAATGGTGGTGCGCAGTCAACATTCTGTGGCTCAGCCAAGTC
GCAGTCTGCCACCCACAAATGAATGGGAGTCTGTTTCTGTGGGTCTGCATTTGCTGCATTTACGCAGTCCCACGA
GAGCACCCTTGGGACCAACTAACCTCAGCGACGATAAGCGCTTCTACCAATACGTGACGCATTTTGCCGTGGAGC
CGCGAGTCATGCCTGCCCGACGCGGTCTTCGTGTCCTTTCGTTTTTCGTGTCGGAGGAGGAAAAGGCCAAGCTCG
TAAAGACGACAAATTCAAACGGCTTGCCCATGGCCCTTTACTCTAGCCAATCGCTCCGCTATCGCCTTCGCATGT
CTAAATACGGCCGAGACACTTGCGAGGCAAAGACTGAGGATTGGGTGATTCGGCCATATGCTTGGCCGGCCTGTC
TGTTCTTGACATTCAATGAGCAAATGGTACAGCCGCGTCGCAGTCAGCACTTTGGGCGAGATTTGCCAATCGAGC
TTACCGACCTGGTGTGTGTTGGAGAAAACACACTCAAGGTTAGCATGCCCGACGAAGCGGCCAATCATGTCAAGG
ACCAGCTCTACTGGATCGCGATTGAAGTCGTGGCGTTCAACGACCACGATGGCGTGCGTCTTGCCGTGGAGATGA
ATGAGCATACCACGATTGCCGAGACGAAGCAAGATGTTGAGCGGCGCCTGACAGCAAATAGCAGCGACGACGTCA
TTGTCCAAAACAATACCCTTTGTGTCTCGATAACGGACCCCTTTAGCTTTGATTTGATTGAGACGCCTGTTCGCG
GCGTCGACTGCAAACATCTTGAATGCTTTGATCTAGAAAACTGGCTGCAGACTCGACCGCAAAAGCAAAGCAAGA
CGGGCCACGAGCCTTGTACAGTCGACTGCTGGAAATGCCCCATATGTGGACTCGACGCTAGGCCTGTCAGTCTGC
GAGTCAATGACTTTCTTGTCGACGTGCGCAAAAACATCAAGAACAACAAGGGCGTTTGCGTCAAGAAGATTGAGA
TTGTTGCCGATGGCAGCTGGAAAGCGATTGAGGAAGAGGACGAGGGTGATACAGAAGATGAGACACCATTAATGA
ATACTTTGGTACAGCGACGAAAGGAGGCTTCATCTAGGACAGATAGTGCACCGACTTTGAAGCGCGCTCTTCGCA
CAATCATCGTTTTGGATGATGATTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail