Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3840
Gene name
LocationContig_247:968..3934
Strand-
Gene length (bp)2966
Transcript length (bp)2814
Coding sequence length (bp)2814
Protein length (aa) 938

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14604 SH3_9 Variant SH3 domain 3.1E-14 21 73
PF00018 SH3_1 SH3 domain 1.6E-12 20 69
PF07647 SAM_2 SAM domain (Sterile alpha motif) 2.3E-12 231 297
PF00169 PH PH domain 4.2E-09 711 841

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38041|BOB1_YEAST Protein BOB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BOI1 PE=1 SV=1 671 885 2.0E-40
sp|P39969|BOI2_YEAST Protein BOI2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BOI2 PE=1 SV=1 687 868 5.0E-40
sp|O74653|POB1_SCHPO Protein pob1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pob1 PE=1 SV=1 645 882 7.0E-28
sp|P39969|BOI2_YEAST Protein BOI2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BOI2 PE=1 SV=1 20 321 3.0E-16
sp|P38041|BOB1_YEAST Protein BOB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BOI1 PE=1 SV=1 20 302 1.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38041|BOB1_YEAST Protein BOB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BOI1 PE=1 SV=1 671 885 2.0E-40
sp|P39969|BOI2_YEAST Protein BOI2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BOI2 PE=1 SV=1 687 868 5.0E-40
sp|O74653|POB1_SCHPO Protein pob1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pob1 PE=1 SV=1 645 882 7.0E-28
sp|P39969|BOI2_YEAST Protein BOI2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BOI2 PE=1 SV=1 20 321 3.0E-16
sp|P38041|BOB1_YEAST Protein BOB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BOI1 PE=1 SV=1 20 302 1.0E-14
sp|O74653|POB1_SCHPO Protein pob1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pob1 PE=1 SV=1 19 69 4.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3840
MASRGAGEAQARPDVGDTLIVIHDFQARSSDELSLAKGDRVELIERDDEFGDGWFLGRHLGNGNTGLFPEVYTRP
APKSALTSSKPLAPVAEISHNRHASDVGSAPSKPAKESRSPPVSPTASHLPETATTLPLNSTKTDAASASSSRLS
SLAFGSLGSRGQDSQVLNETLHVIDEHITHLRTSPSNGALRAAATDSGSEYSATVDQRMSYIQGEETDEEEERPH
TRQQVQAWTPDEVAQHLFTAGVEKHHCDIFRDQEISGEVLLGMDQSSLFIKAFDLGSVGRRLKTWHKIKELQDAV
SSQQATTRRTTVTYNDETGNEESKRTRKRTSTVTNPVSTTRPVSVQSRRLSATQQTPKASPTMMNTPPSPQALRD
SPTRPNYVKRPSAASVRELHHSRRHSSTDFRLSGPAGAPAVSPDGSTEGVHKKVPSFDRNWTLGSALSQPQAPRP
LSSAGLHEVATGTEADLLQDSAVDLDRGYFSGTDADGRKRNVLRKRDSTSHSQKSSYADEQRVRSATALSRHSRF
GSVDSFRDMVPSPAVQKYYGIQPTPHRRTASTNTAESSRHLPQSKDGPPPTVTNLDGGSASGRSQGSPVTARHPG
FNSDWLSSVVNKPMGLGRPGMRAISDRLTMNRSRDVGTPDPAFDSPARTGSSTPSAGASLDLESPGTGKTSSTSV
MPPNKANRKKGKKETSAYTRGLEKISPLEAKASADYYGWMKKKSSNLMTTWKPRLFVLRGRRMAYYYSEEDEQEK
GLIDISFHRVLPADNERLTGFHATITGAGNAPGGESWGGLEKGDDSVFIFKLVPPRTGLSKAVNFTKPTVHYFAV
PNLQQGRLWMAALMKATIERDDGQPITSTYQQKTISLAKAKLMRHRPPALMNLDEGKEEEHKASGSKKVNGLGIF
GESDSGVSGMDRLGGAKADGLDAAAGDDEGAEVPQTA*
Coding >OphauB2|3840
ATGGCTTCACGAGGCGCAGGCGAAGCTCAGGCCCGGCCTGACGTGGGTGACACTCTCATCGTCATTCATGACTTC
CAGGCGCGTAGCTCTGATGAGCTGAGCCTTGCCAAGGGAGACCGCGTCGAGCTGATTGAGCGCGACGATGAATTC
GGCGACGGATGGTTTTTGGGTCGCCACCTGGGGAATGGCAATACAGGATTATTCCCTGAAGTTTATACGCGACCG
GCGCCCAAATCTGCCTTGACGTCGTCGAAACCTTTGGCTCCCGTTGCCGAGATAAGCCACAATCGCCATGCATCC
GACGTTGGCAGTGCTCCTAGCAAGCCTGCCAAGGAATCGAGATCCCCCCCAGTGTCACCAACGGCCAGCCACCTG
CCAGAGACGGCGACGACGTTGCCGTTAAACTCGACCAAGACAGACGCGGCAAGTGCATCAAGCTCGCGTCTATCG
TCGTTGGCCTTTGGATCTCTTGGCAGCAGGGGACAGGATAGTCAAGTTTTGAACGAGACGCTTCACGTCATTGAC
GAGCACATTACTCACTTGCGAACCTCTCCGAGCAACGGGGCGCTACGAGCCGCAGCGACAGACTCTGGCAGCGAG
TATAGCGCGACGGTTGACCAAAGAATGTCATATATTCAGGGCGAAGAGACAGACGAAGAGGAGGAGAGACCGCAC
ACGCGCCAGCAGGTGCAAGCCTGGACTCCCGATGAAGTGGCTCAGCACCTCTTCACAGCAGGGGTAGAGAAGCAT
CACTGTGACATTTTCAGGGACCAAGAGATTTCTGGAGAGGTGCTGCTTGGCATGGACCAAAGCTCGCTCTTTATA
AAGGCCTTTGACCTGGGCTCTGTCGGCAGGCGTTTGAAGACTTGGCACAAGATTAAGGAGCTTCAAGACGCCGTT
AGCAGCCAACAGGCGACGACGCGGAGGACAACGGTGACGTACAATGACGAGACTGGCAACGAGGAGAGCAAGCGC
ACGAGGAAACGAACAAGCACCGTTACAAACCCCGTCTCTACCACGAGACCCGTGTCGGTGCAGAGCCGCCGGCTG
TCGGCGACGCAACAGACACCCAAGGCGTCGCCGACAATGATGAATACACCTCCGTCGCCGCAGGCTCTGCGCGAT
AGCCCAACTCGACCCAATTATGTGAAGCGGCCGTCGGCTGCATCCGTCAGGGAGCTGCACCACTCTCGCCGCCAC
TCGTCGACCGACTTTCGGCTGTCGGGCCCTGCTGGCGCGCCGGCTGTCAGTCCCGACGGGAGCACCGAGGGCGTG
CACAAGAAGGTGCCGTCGTTTGACCGGAACTGGACGCTTGGCAGTGCTCTATCACAGCCTCAGGCACCAAGGCCC
CTCTCATCGGCTGGCTTGCATGAGGTGGCGACGGGCACTGAAGCAGACTTGCTCCAAGACTCGGCAGTTGACTTG
GATCGAGGCTACTTCTCGGGCACCGATGCCGACGGCCGGAAGCGCAATGTGCTGAGGAAACGCGACAGCACCAGC
CACTCGCAAAAGTCGAGCTACGCAGACGAACAGCGGGTGCGAAGCGCAACGGCGCTGTCTCGGCACTCGAGGTTT
GGCAGTGTCGACTCGTTTCGCGACATGGTGCCTTCGCCGGCGGTGCAAAAATACTATGGCATCCAGCCGACGCCG
CATAGGAGAACGGCGTCGACAAACACGGCCGAGTCGTCTCGCCATTTGCCCCAGTCCAAGGACGGTCCTCCGCCC
ACGGTTACCAATCTCGATGGCGGATCCGCTTCGGGGCGCTCCCAGGGATCCCCCGTAACTGCCAGGCATCCGGGC
TTCAACTCTGATTGGCTGTCGTCGGTTGTGAACAAGCCCATGGGCCTGGGGCGCCCTGGAATGCGCGCAATTTCG
GACAGGCTGACTATGAATCGCTCCCGAGACGTTGGGACTCCGGATCCCGCCTTTGACTCGCCTGCCAGGACGGGC
TCTAGCACCCCTTCTGCCGGCGCCAGCCTCGATTTGGAGTCTCCTGGCACGGGCAAAACGTCTAGCACGTCAGTC
ATGCCGCCCAACAAGGCGAATCGAAAAAAGGGCAAGAAGGAAACGAGCGCCTACACGAGGGGACTGGAGAAAATT
TCGCCGCTAGAGGCCAAGGCCAGCGCCGATTACTATGGGTGGATGAAGAAGAAGAGCTCCAATCTCATGACTACA
TGGAAGCCGCGTCTTTTTGTACTCAGGGGGCGGCGCATGGCGTACTATTACTCGGAGGAGGATGAGCAGGAAAAG
GGCCTCATTGACATATCATTTCACCGCGTCTTGCCGGCGGACAATGAGCGGCTGACTGGCTTCCACGCCACGATT
ACGGGCGCGGGCAATGCCCCTGGCGGAGAGTCTTGGGGCGGGCTGGAAAAGGGAGACGACTCAGTCTTCATCTTC
AAGCTGGTGCCGCCGCGCACCGGGCTGTCCAAGGCTGTCAACTTTACCAAGCCCACGGTGCACTACTTTGCCGTG
CCCAATCTGCAGCAGGGACGCTTGTGGATGGCGGCGCTCATGAAGGCAACGATTGAGCGCGACGATGGGCAGCCC
ATTACAAGCACCTATCAGCAAAAGACGATTTCGCTGGCCAAGGCGAAGCTGATGCGCCACCGGCCGCCTGCGCTC
ATGAACCTTGACGAGGGCAAGGAGGAGGAGCACAAGGCGTCGGGCTCGAAAAAGGTGAATGGGCTGGGCATCTTT
GGCGAGTCGGACAGTGGCGTCTCGGGCATGGACAGGCTGGGCGGGGCCAAGGCGGATGGGCTCGATGCAGCGGCG
GGCGACGACGAGGGCGCTGAAGTGCCGCAGACTGCCTAG
Transcript >OphauB2|3840
ATGGCTTCACGAGGCGCAGGCGAAGCTCAGGCCCGGCCTGACGTGGGTGACACTCTCATCGTCATTCATGACTTC
CAGGCGCGTAGCTCTGATGAGCTGAGCCTTGCCAAGGGAGACCGCGTCGAGCTGATTGAGCGCGACGATGAATTC
GGCGACGGATGGTTTTTGGGTCGCCACCTGGGGAATGGCAATACAGGATTATTCCCTGAAGTTTATACGCGACCG
GCGCCCAAATCTGCCTTGACGTCGTCGAAACCTTTGGCTCCCGTTGCCGAGATAAGCCACAATCGCCATGCATCC
GACGTTGGCAGTGCTCCTAGCAAGCCTGCCAAGGAATCGAGATCCCCCCCAGTGTCACCAACGGCCAGCCACCTG
CCAGAGACGGCGACGACGTTGCCGTTAAACTCGACCAAGACAGACGCGGCAAGTGCATCAAGCTCGCGTCTATCG
TCGTTGGCCTTTGGATCTCTTGGCAGCAGGGGACAGGATAGTCAAGTTTTGAACGAGACGCTTCACGTCATTGAC
GAGCACATTACTCACTTGCGAACCTCTCCGAGCAACGGGGCGCTACGAGCCGCAGCGACAGACTCTGGCAGCGAG
TATAGCGCGACGGTTGACCAAAGAATGTCATATATTCAGGGCGAAGAGACAGACGAAGAGGAGGAGAGACCGCAC
ACGCGCCAGCAGGTGCAAGCCTGGACTCCCGATGAAGTGGCTCAGCACCTCTTCACAGCAGGGGTAGAGAAGCAT
CACTGTGACATTTTCAGGGACCAAGAGATTTCTGGAGAGGTGCTGCTTGGCATGGACCAAAGCTCGCTCTTTATA
AAGGCCTTTGACCTGGGCTCTGTCGGCAGGCGTTTGAAGACTTGGCACAAGATTAAGGAGCTTCAAGACGCCGTT
AGCAGCCAACAGGCGACGACGCGGAGGACAACGGTGACGTACAATGACGAGACTGGCAACGAGGAGAGCAAGCGC
ACGAGGAAACGAACAAGCACCGTTACAAACCCCGTCTCTACCACGAGACCCGTGTCGGTGCAGAGCCGCCGGCTG
TCGGCGACGCAACAGACACCCAAGGCGTCGCCGACAATGATGAATACACCTCCGTCGCCGCAGGCTCTGCGCGAT
AGCCCAACTCGACCCAATTATGTGAAGCGGCCGTCGGCTGCATCCGTCAGGGAGCTGCACCACTCTCGCCGCCAC
TCGTCGACCGACTTTCGGCTGTCGGGCCCTGCTGGCGCGCCGGCTGTCAGTCCCGACGGGAGCACCGAGGGCGTG
CACAAGAAGGTGCCGTCGTTTGACCGGAACTGGACGCTTGGCAGTGCTCTATCACAGCCTCAGGCACCAAGGCCC
CTCTCATCGGCTGGCTTGCATGAGGTGGCGACGGGCACTGAAGCAGACTTGCTCCAAGACTCGGCAGTTGACTTG
GATCGAGGCTACTTCTCGGGCACCGATGCCGACGGCCGGAAGCGCAATGTGCTGAGGAAACGCGACAGCACCAGC
CACTCGCAAAAGTCGAGCTACGCAGACGAACAGCGGGTGCGAAGCGCAACGGCGCTGTCTCGGCACTCGAGGTTT
GGCAGTGTCGACTCGTTTCGCGACATGGTGCCTTCGCCGGCGGTGCAAAAATACTATGGCATCCAGCCGACGCCG
CATAGGAGAACGGCGTCGACAAACACGGCCGAGTCGTCTCGCCATTTGCCCCAGTCCAAGGACGGTCCTCCGCCC
ACGGTTACCAATCTCGATGGCGGATCCGCTTCGGGGCGCTCCCAGGGATCCCCCGTAACTGCCAGGCATCCGGGC
TTCAACTCTGATTGGCTGTCGTCGGTTGTGAACAAGCCCATGGGCCTGGGGCGCCCTGGAATGCGCGCAATTTCG
GACAGGCTGACTATGAATCGCTCCCGAGACGTTGGGACTCCGGATCCCGCCTTTGACTCGCCTGCCAGGACGGGC
TCTAGCACCCCTTCTGCCGGCGCCAGCCTCGATTTGGAGTCTCCTGGCACGGGCAAAACGTCTAGCACGTCAGTC
ATGCCGCCCAACAAGGCGAATCGAAAAAAGGGCAAGAAGGAAACGAGCGCCTACACGAGGGGACTGGAGAAAATT
TCGCCGCTAGAGGCCAAGGCCAGCGCCGATTACTATGGGTGGATGAAGAAGAAGAGCTCCAATCTCATGACTACA
TGGAAGCCGCGTCTTTTTGTACTCAGGGGGCGGCGCATGGCGTACTATTACTCGGAGGAGGATGAGCAGGAAAAG
GGCCTCATTGACATATCATTTCACCGCGTCTTGCCGGCGGACAATGAGCGGCTGACTGGCTTCCACGCCACGATT
ACGGGCGCGGGCAATGCCCCTGGCGGAGAGTCTTGGGGCGGGCTGGAAAAGGGAGACGACTCAGTCTTCATCTTC
AAGCTGGTGCCGCCGCGCACCGGGCTGTCCAAGGCTGTCAACTTTACCAAGCCCACGGTGCACTACTTTGCCGTG
CCCAATCTGCAGCAGGGACGCTTGTGGATGGCGGCGCTCATGAAGGCAACGATTGAGCGCGACGATGGGCAGCCC
ATTACAAGCACCTATCAGCAAAAGACGATTTCGCTGGCCAAGGCGAAGCTGATGCGCCACCGGCCGCCTGCGCTC
ATGAACCTTGACGAGGGCAAGGAGGAGGAGCACAAGGCGTCGGGCTCGAAAAAGGTGAATGGGCTGGGCATCTTT
GGCGAGTCGGACAGTGGCGTCTCGGGCATGGACAGGCTGGGCGGGGCCAAGGCGGATGGGCTCGATGCAGCGGCG
GGCGACGACGAGGGCGCTGAAGTGCCGCAGACTGCCTAG
Gene >OphauB2|3840
ATGGCTTCACGAGGCGCAGGCGAAGCTCAGGCCCGGCCTGACGTGGGTGACACTCTCATCGTCATTCGTGAGTCT
TGGGCACACTCTGGTCACATGCCTCGACGTACTTGAATGGTACACGTGGCCTCGATGTGCTCATGGCTGACAAAC
TCGTTTGCCTCTCTGAACAGATGACTTCCAGGCGCGTAGCTCTGATGAGCTGAGCCTTGCCAAGGGAGACCGCGT
CGAGCTGATTGAGCGCGACGATGAATTCGGCGACGGATGGTTTTTGGGTCGCCACCTGGGGAATGGCAATACAGG
ATTATTCCCTGAAGGTTACTCATCCGTCATGCGCAACTTGCGTCGACTGCTAACTCGACCCAGTTTATACGCGAC
CGGCGCCCAAATCTGCCTTGACGTCGTCGAAACCTTTGGCTCCCGTTGCCGAGATAAGCCACAATCGCCATGCAT
CCGACGTTGGCAGTGCTCCTAGCAAGCCTGCCAAGGAATCGAGATCCCCCCCAGTGTCACCAACGGCCAGCCACC
TGCCAGAGACGGCGACGACGTTGCCGTTAAACTCGACCAAGACAGACGCGGCAAGTGCATCAAGCTCGCGTCTAT
CGTCGTTGGCCTTTGGATCTCTTGGCAGCAGGGGACAGGATAGTCAAGTTTTGAACGAGACGCTTCACGTCATTG
ACGAGCACATTACTCACTTGCGAACCTCTCCGAGCAACGGGGCGCTACGAGCCGCAGCGACAGACTCTGGCAGCG
AGTATAGCGCGACGGTTGACCAAAGAATGTCATATATTCAGGGCGAAGAGACAGACGAAGAGGAGGAGAGACCGC
ACACGCGCCAGCAGGTGCAAGCCTGGACTCCCGATGAAGTGGCTCAGCACCTCTTCACAGCAGGGGTAGAGAAGC
ATCACTGTGACATTTTCAGGGACCAAGAGATTTCTGGAGAGGTGCTGCTTGGCATGGACCAAAGCTCGCTCTTTA
TAAAGGCCTTTGACCTGGGCTCTGTCGGCAGGCGTTTGAAGACTTGGCACAAGATTAAGGAGCTTCAAGACGCCG
TTAGCAGCCAACAGGCGACGACGCGGAGGACAACGGTGACGTACAATGACGAGACTGGCAACGAGGAGAGCAAGC
GCACGAGGAAACGAACAAGCACCGTTACAAACCCCGTCTCTACCACGAGACCCGTGTCGGTGCAGAGCCGCCGGC
TGTCGGCGACGCAACAGACACCCAAGGCGTCGCCGACAATGATGAATACACCTCCGTCGCCGCAGGCTCTGCGCG
ATAGCCCAACTCGACCCAATTATGTGAAGCGGCCGTCGGCTGCATCCGTCAGGGAGCTGCACCACTCTCGCCGCC
ACTCGTCGACCGACTTTCGGCTGTCGGGCCCTGCTGGCGCGCCGGCTGTCAGTCCCGACGGGAGCACCGAGGGCG
TGCACAAGAAGGTGCCGTCGTTTGACCGGAACTGGACGCTTGGCAGTGCTCTATCACAGCCTCAGGCACCAAGGC
CCCTCTCATCGGCTGGCTTGCATGAGGTGGCGACGGGCACTGAAGCAGACTTGCTCCAAGACTCGGCAGTTGACT
TGGATCGAGGCTACTTCTCGGGCACCGATGCCGACGGCCGGAAGCGCAATGTGCTGAGGAAACGCGACAGCACCA
GCCACTCGCAAAAGTCGAGCTACGCAGACGAACAGCGGGTGCGAAGCGCAACGGCGCTGTCTCGGCACTCGAGGT
TTGGCAGTGTCGACTCGTTTCGCGACATGGTGCCTTCGCCGGCGGTGCAAAAATACTATGGCATCCAGCCGACGC
CGCATAGGAGAACGGCGTCGACAAACACGGCCGAGTCGTCTCGCCATTTGCCCCAGTCCAAGGACGGTCCTCCGC
CCACGGTTACCAATCTCGATGGCGGATCCGCTTCGGGGCGCTCCCAGGGATCCCCCGTAACTGCCAGGCATCCGG
GCTTCAACTCTGATTGGCTGTCGTCGGTTGTGAACAAGCCCATGGGCCTGGGGCGCCCTGGAATGCGCGCAATTT
CGGACAGGCTGACTATGAATCGCTCCCGAGACGTTGGGACTCCGGATCCCGCCTTTGACTCGCCTGCCAGGACGG
GCTCTAGCACCCCTTCTGCCGGCGCCAGCCTCGATTTGGAGTCTCCTGGCACGGGCAAAACGTCTAGCACGTCAG
TCATGCCGCCCAACAAGGCGAATCGAAAAAAGGGCAAGAAGGAAACGAGCGCCTACACGAGGGGACTGGAGAAAA
TTTCGCCGCTAGAGGCCAAGGCCAGCGCCGATTACTATGGGTGGATGAAGAAGAAGAGCTCCAATCTCATGACTA
CATGGAAGCCGCGTCTTTTTGTACTCAGGGGGCGGCGCATGGCGTACTATTACTCGGAGGAGGATGAGCAGGAAA
AGGGCCTCATTGACATATCATTTCACCGCGTCTTGCCGGCGGACAATGAGCGGCTGACTGGCTTCCACGCCACGA
TTACGGGCGCGGGCAATGCCCCTGGCGGAGAGTCTTGGGGCGGGCTGGAAAAGGGAGACGACTCAGTCTTCATCT
TCAAGCTGGTGCCGCCGCGCACCGGGCTGTCCAAGGCTGTCAACTTTACCAAGCCCACGGTGCACTACTTTGCCG
TGCCCAATCTGCAGCAGGGACGCTTGTGGATGGCGGCGCTCATGAAGGCAACGATTGAGCGCGACGATGGGCAGC
CCATTACAAGCACCTATCAGCAAAAGACGATTTCGCTGGCCAAGGCGAAGCTGATGCGCCACCGGCCGCCTGCGC
TCATGAACCTTGACGAGGGCAAGGAGGAGGAGCACAAGGCGTCGGGCTCGAAAAAGGTGAATGGGCTGGGCATCT
TTGGCGAGTCGGACAGTGGCGTCTCGGGCATGGACAGGCTGGGCGGGGCCAAGGCGGATGGGCTCGATGCAGCGG
CGGGCGACGACGAGGGCGCTGAAGTGCCGCAGACTGCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail