Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3839
Gene name
LocationContig_246:16045..16933
Strand-
Gene length (bp)888
Transcript length (bp)621
Coding sequence length (bp)621
Protein length (aa) 207

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07510 DUF1524 Protein of unknown function (DUF1524) 4.4E-06 103 202

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4AK18|A4619_ARTBC Uncharacterized secreted protein ARB_06907 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_04619 PE=1 SV=2 28 206 4.0E-79

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3839
MDSKYCKPWWLVTAVIAVGVIAKPVPPGIPSASTAQDLLSGLKVAASSSGEGYSRAEFPHWDTIRGTCNTRELVL
KRDGQNVVVNDACVAESGSWTSPYDGATWTRASDIDIDHMVPLKNAWISGASSWTRDSRRAFANDLTRPQLWAVT
DRVNEAKGDRAPDAWQPPLADFACVYARSWTQVKSHYALTVTEAEGDALAQMLATC*
Coding >OphauB2|3839
ATGGACTCAAAATATTGCAAGCCGTGGTGGCTCGTGACGGCGGTAATTGCTGTAGGCGTCATTGCCAAACCAGTG
CCGCCCGGCATCCCCAGTGCCAGCACGGCCCAAGACTTGCTCAGCGGGCTCAAGGTGGCGGCATCGAGCAGCGGC
GAGGGATACAGTCGAGCCGAGTTTCCGCACTGGGATACTATTAGGGGCACCTGCAACACGCGCGAGCTCGTGTTG
AAGCGCGACGGGCAAAACGTAGTGGTCAATGATGCTTGTGTTGCCGAGTCGGGATCGTGGACCAGTCCCTACGAC
GGGGCCACGTGGACACGGGCGAGCGACATTGACATTGACCACATGGTGCCGCTCAAGAATGCCTGGATTTCGGGC
GCCTCGTCGTGGACAAGAGACAGCCGCAGAGCCTTTGCCAACGACTTGACGCGCCCACAGCTCTGGGCCGTGACA
GACAGAGTCAACGAGGCCAAGGGCGACCGCGCGCCAGACGCATGGCAGCCACCTCTGGCCGACTTTGCCTGTGTC
TATGCGCGCAGCTGGACGCAGGTCAAGAGCCACTACGCGCTGACTGTGACTGAGGCTGAAGGCGATGCGCTGGCG
CAAATGCTTGCCACGTGCTGA
Transcript >OphauB2|3839
ATGGACTCAAAATATTGCAAGCCGTGGTGGCTCGTGACGGCGGTAATTGCTGTAGGCGTCATTGCCAAACCAGTG
CCGCCCGGCATCCCCAGTGCCAGCACGGCCCAAGACTTGCTCAGCGGGCTCAAGGTGGCGGCATCGAGCAGCGGC
GAGGGATACAGTCGAGCCGAGTTTCCGCACTGGGATACTATTAGGGGCACCTGCAACACGCGCGAGCTCGTGTTG
AAGCGCGACGGGCAAAACGTAGTGGTCAATGATGCTTGTGTTGCCGAGTCGGGATCGTGGACCAGTCCCTACGAC
GGGGCCACGTGGACACGGGCGAGCGACATTGACATTGACCACATGGTGCCGCTCAAGAATGCCTGGATTTCGGGC
GCCTCGTCGTGGACAAGAGACAGCCGCAGAGCCTTTGCCAACGACTTGACGCGCCCACAGCTCTGGGCCGTGACA
GACAGAGTCAACGAGGCCAAGGGCGACCGCGCGCCAGACGCATGGCAGCCACCTCTGGCCGACTTTGCCTGTGTC
TATGCGCGCAGCTGGACGCAGGTCAAGAGCCACTACGCGCTGACTGTGACTGAGGCTGAAGGCGATGCGCTGGCG
CAAATGCTTGCCACGTGCTGA
Gene >OphauB2|3839
ATGGACTCAAAATATTGCAAGCCGTGGTGGCTCGTGACGGCGGTAATTGCTGTAGGCGTCATTGCCAAACCAGTG
CCGGTATGACTCTGTGGCCTTGGATGGGTAGTTGGGAGCAGCAAAACTGACAGCCTGGTTGCACAGCCCGGCATC
CCCAGTGCCAGCACGGCCCAAGACTTGCTCAGCGGGCTCAAGGTGGCGGCATCGAGCAGCGGCGAGGGATACAGT
CGAGCCGAGTTTCCGCACTGGGATACTATTAGGGGCACCTGCAACACGCGGTCAGCGACCCAAGGCCAAAGCAAA
GAAGAAGATGATGAAGACGAAGAAGACGAAGAAGATGCAAACCTGGGCTGACGCGATGCAGCGAGCTCGTGTTGA
AGCGCGACGGGCAAAACGTAGTGGTCAATGATGCTTGTGTTGCCGAGTCGGGATCGTGGACCAGTCCCTACGACG
GGGCCACGTGGACACGGGCGAGCGACATTGACATTGACCACATGGTGCCGCTCAAGAATGCCTGGATTGTCAGTT
TACTTTTATTGTTTTTACTTTTTTTTTTTCAACTCTTCCTTCCCTGGTGCGCCTAGACACTATCAACTGGCTACT
CGACATGCTAATACTTGTTTCCCCCTTGACATCCAGTCGGGCGCCTCGTCGTGGACAAGAGACAGCCGCAGAGCC
TTTGCCAACGACTTGACGCGCCCACAGCTCTGGGCCGTGACAGACAGAGTCAACGAGGCCAAGGGCGACCGCGCG
CCAGACGCATGGCAGCCACCTCTGGCCGACTTTGCCTGTGTCTATGCGCGCAGCTGGACGCAGGTCAAGAGCCAC
TACGCGCTGACTGTGACTGAGGCTGAAGGCGATGCGCTGGCGCAAATGCTTGCCACGTGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail