Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3833
Gene name
LocationContig_245:14633..15680
Strand+
Gene length (bp)1047
Transcript length (bp)993
Coding sequence length (bp)993
Protein length (aa) 331

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00106 adh_short short chain dehydrogenase 3.7E-21 23 164
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 6.2E-16 28 239
PF08659 KR KR domain 1.6E-06 25 116

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q92247|BLI4_NEUCR Putative oxidoreductase bli-4, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=bli-4 PE=1 SV=1 16 320 3.0E-34
sp|Q8N5I4|DHRSX_HUMAN Dehydrogenase/reductase SDR family member on chromosome X OS=Homo sapiens GN=DHRSX PE=2 SV=2 5 315 8.0E-30
sp|O74959|YJCD_SCHPO Uncharacterized oxidoreductase C736.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC736.13 PE=3 SV=1 16 318 3.0E-29
sp|Q6RVV4|TIC32_PEA Short-chain dehydrogenase TIC 32, chloroplastic OS=Pisum sativum GN=TIC32 PE=1 SV=1 21 319 4.0E-28
sp|Q5F389|WWOX_CHICK WW domain-containing oxidoreductase OS=Gallus gallus GN=WWOX PE=2 SV=2 14 321 6.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q92247|BLI4_NEUCR Putative oxidoreductase bli-4, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=bli-4 PE=1 SV=1 16 320 3.0E-34
sp|Q8N5I4|DHRSX_HUMAN Dehydrogenase/reductase SDR family member on chromosome X OS=Homo sapiens GN=DHRSX PE=2 SV=2 5 315 8.0E-30
sp|O74959|YJCD_SCHPO Uncharacterized oxidoreductase C736.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC736.13 PE=3 SV=1 16 318 3.0E-29
sp|Q6RVV4|TIC32_PEA Short-chain dehydrogenase TIC 32, chloroplastic OS=Pisum sativum GN=TIC32 PE=1 SV=1 21 319 4.0E-28
sp|Q5F389|WWOX_CHICK WW domain-containing oxidoreductase OS=Gallus gallus GN=WWOX PE=2 SV=2 14 321 6.0E-27
sp|Q9VLU5|WWOX_DROME WW domain-containing oxidoreductase OS=Drosophila melanogaster GN=Wwox PE=2 SV=1 19 320 1.0E-25
sp|A2RVM0|TIC32_ARATH Short-chain dehydrogenase TIC 32, chloroplastic OS=Arabidopsis thaliana GN=TIC32 PE=2 SV=1 21 321 3.0E-25
sp|Q91WL8|WWOX_MOUSE WW domain-containing oxidoreductase OS=Mus musculus GN=Wwox PE=1 SV=1 14 322 8.0E-25
sp|Q9NZC7|WWOX_HUMAN WW domain-containing oxidoreductase OS=Homo sapiens GN=WWOX PE=1 SV=1 14 324 1.0E-23
sp|Q5R9W5|WWOX_PONAB WW domain-containing oxidoreductase OS=Pongo abelii GN=WWOX PE=2 SV=1 14 324 2.0E-23
sp|Q803A8|WWOX_DANRE WW domain-containing oxidoreductase OS=Danio rerio GN=wwox PE=2 SV=1 19 319 2.0E-21
sp|Q9ERI6|RDH14_MOUSE Retinol dehydrogenase 14 OS=Mus musculus GN=Rdh14 PE=1 SV=1 16 316 5.0E-21
sp|Q9HBH5|RDH14_HUMAN Retinol dehydrogenase 14 OS=Homo sapiens GN=RDH14 PE=1 SV=1 16 316 8.0E-20
sp|Q8BYK4|RDH12_MOUSE Retinol dehydrogenase 12 OS=Mus musculus GN=Rdh12 PE=2 SV=1 9 316 4.0E-17
sp|Q8NBN7|RDH13_HUMAN Retinol dehydrogenase 13 OS=Homo sapiens GN=RDH13 PE=1 SV=2 21 316 6.0E-16
sp|Q96NR8|RDH12_HUMAN Retinol dehydrogenase 12 OS=Homo sapiens GN=RDH12 PE=1 SV=3 9 316 9.0E-16
sp|Q8CEE7|RDH13_MOUSE Retinol dehydrogenase 13 OS=Mus musculus GN=Rdh13 PE=1 SV=1 21 316 9.0E-16
sp|P59837|RDH12_BOVIN Retinol dehydrogenase 12 OS=Bos taurus GN=RDH12 PE=2 SV=1 9 316 2.0E-13
sp|Q9QYF1|RDH11_MOUSE Retinol dehydrogenase 11 OS=Mus musculus GN=Rdh11 PE=1 SV=2 1 316 4.0E-13
sp|Q03326|OXIR_STRAT Probable oxidoreductase OS=Streptomyces antibioticus PE=3 SV=1 19 239 5.0E-13
sp|P35320|OXIR_STRLI Probable oxidoreductase OS=Streptomyces lividans PE=3 SV=1 19 239 6.0E-13
sp|Q8TC12|RDH11_HUMAN Retinol dehydrogenase 11 OS=Homo sapiens GN=RDH11 PE=1 SV=2 19 316 3.0E-12
sp|Q8VBZ0|DHRSX_MOUSE Dehydrogenase/reductase SDR family member on chromosome X homolog OS=Mus musculus GN=Dhrsx PE=1 SV=2 21 309 6.0E-11
sp|Q12634|T4HR_MAGO7 Tetrahydroxynaphthalene reductase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_02252 PE=1 SV=2 2 144 1.0E-10
sp|Q17QU7|DHR13_BOVIN Dehydrogenase/reductase SDR family member 13 OS=Bos taurus GN=DHRS13 PE=2 SV=1 19 327 1.0E-10
sp|Q08651|ENV9_YEAST Probable oxidoreductase ENV9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENV9 PE=1 SV=1 22 319 1.0E-10
sp|A0PJE2|DHR12_HUMAN Dehydrogenase/reductase SDR family member 12 OS=Homo sapiens GN=DHRS12 PE=2 SV=2 6 248 2.0E-10
sp|Q6UX07|DHR13_HUMAN Dehydrogenase/reductase SDR family member 13 OS=Homo sapiens GN=DHRS13 PE=2 SV=1 18 327 1.0E-09
sp|A6QP05|DHR12_BOVIN Dehydrogenase/reductase SDR family member 12 OS=Bos taurus GN=DHRS12 PE=2 SV=1 6 302 8.0E-09
sp|P87025|THR1_COLOR Trihydroxynaphthalene reductase OS=Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422) GN=THR1 PE=3 SV=4 3 144 1.0E-08
sp|O13822|YEE6_SCHPO Uncharacterized oxidoreductase C19A8.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC19A8.06 PE=3 SV=1 10 231 3.0E-08
sp|B2X050|MNR1_CAPAN (+)-neomenthol dehydrogenase OS=Capsicum annuum GN=MNR1 PE=1 SV=1 22 111 3.0E-08
sp|Q53877|DNRU_STRS5 Putative daunorubicin C-13 ketoreductase DnrU OS=Streptomyces sp. (strain C5) PE=3 SV=1 19 318 5.0E-08
sp|Q5SS80|DHR13_MOUSE Dehydrogenase/reductase SDR family member 13 OS=Mus musculus GN=Dhrs13 PE=1 SV=1 19 233 6.0E-08
sp|Q9ZAU1|DNRU_STRPE Putative daunorubicin C-13 ketoreductase DnrU OS=Streptomyces peucetius GN=dnrU PE=3 SV=1 12 318 6.0E-08
sp|Q9ZUH5|SDR2B_ARATH Short-chain dehydrogenase/reductase 2b OS=Arabidopsis thaliana GN=SDR2b PE=2 SV=1 22 233 7.0E-08
sp|Q39617|POR_CHLRE Protochlorophyllide reductase, chloroplastic OS=Chlamydomonas reinhardtii GN=PORA PE=3 SV=1 22 316 9.0E-08
sp|Q9M2E2|SDR1_ARATH (+)-neomenthol dehydrogenase OS=Arabidopsis thaliana GN=SDR1 PE=1 SV=1 22 165 9.0E-08
sp|O48741|PORC_ARATH Protochlorophyllide reductase C, chloroplastic OS=Arabidopsis thaliana GN=PORC PE=1 SV=1 24 316 2.0E-07
sp|Q08632|SDR1_PICAB Short-chain type dehydrogenase/reductase OS=Picea abies PE=2 SV=1 16 134 2.0E-07
sp|P32573|SPS19_YEAST Peroxisomal 2,4-dienoyl-CoA reductase SPS19 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPS19 PE=1 SV=4 15 147 2.0E-07
sp|Q00791|STCU_EMENI Versicolorin reductase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcU PE=3 SV=2 18 233 4.0E-07
sp|P19337|BAIA2_CLOSV Bile acid 7-dehydroxylase 2 OS=Clostridium scindens (strain JCM 10418 / VPI 12708) GN=baiA2 PE=1 SV=1 22 233 5.0E-07
sp|Q9RPT1|RHLG_PSEAE Rhamnolipids biosynthesis 3-oxoacyl-[acyl-carrier-protein] reductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rhlG PE=1 SV=1 19 236 5.0E-07
sp|P07914|BAIA1_CLOSV Bile acid 7-dehydroxylase 1/3 OS=Clostridium scindens (strain JCM 10418 / VPI 12708) GN=baiA1 PE=1 SV=3 22 235 8.0E-07
sp|Q4A054|Y0419_STAS1 Uncharacterized oxidoreductase SSP0419 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP0419 PE=3 SV=1 18 274 1.0E-06
sp|P70684|PGDH_CAVPO 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Cavia porcellus GN=HPGD PE=2 SV=1 18 111 2.0E-06
sp|P15428|PGDH_HUMAN 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Homo sapiens GN=HPGD PE=1 SV=1 18 111 2.0E-06
sp|Q8VCC1|PGDH_MOUSE 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Mus musculus GN=Hpgd PE=1 SV=1 18 111 3.0E-06
sp|Q8MJY8|PGDH_MACFA 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Macaca fascicularis GN=HPGD PE=2 SV=1 18 111 3.0E-06
sp|H9BFQ2|TPRL3_ERYCB Tropinone reductase-like 3 OS=Erythroxylum coca PE=2 SV=1 21 233 3.0E-06
sp|P50165|TRNH_DATST Tropinone reductase homolog OS=Datura stramonium PE=2 SV=1 19 147 5.0E-06
sp|Q00670|ADH_SCACA Alcohol dehydrogenase OS=Scaptomyza crassifemur GN=Adh PE=3 SV=1 19 271 6.0E-06
sp|Q4L8Y1|Y0585_STAHJ Uncharacterized oxidoreductase SH0585 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH0585 PE=3 SV=1 19 236 6.0E-06
sp|Q6AYS8|DHB11_RAT Estradiol 17-beta-dehydrogenase 11 OS=Rattus norvegicus GN=Hsd17b11 PE=2 SV=1 19 148 6.0E-06
sp|O08699|PGDH_RAT 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Rattus norvegicus GN=Hpgd PE=2 SV=2 18 111 8.0E-06
sp|Q3T0C2|PGDH_BOVIN 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Bos taurus GN=HPGD PE=2 SV=1 18 111 8.0E-06
sp|Q9LBG2|LVR_LEIAQ Levodione reductase OS=Leifsonia aquatica GN=lvr PE=1 SV=1 22 146 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3833
MQSALDAVVGPTEVQPDHLGGRIAIVTGGARGIGYETARALASAQCKVIIVNKNEGSSKEAISKIRQEVPDADVD
FKVCNLGNLGQVKTVFSSLRESLERLDFVVLSAGINANQYALDDDGIESVFGINYLGHYYALNQLWPLLRKTSLK
PGVPAPRIVCITSELHKAAPSGIKFQSLEEINDSSMGPAALYGRSKVALLLLLKYGLLERVIKPTSDSIMVLSVH
PGAVNTDMQKQWKDAYPGLTGKLISWAMQSISRDAKQGSYGAIWALTTPESDTKLENGGYYVDPATTGSLSTQAS
DPTLGGNLWELSAKIVRDKVGTDALMDWKA*
Coding >OphauB2|3833
ATGCAATCCGCCCTTGACGCCGTTGTAGGACCAACCGAGGTCCAGCCCGATCATCTCGGAGGCCGCATCGCCATT
GTAACGGGAGGAGCTCGCGGGATTGGCTATGAAACCGCCCGAGCTCTGGCTAGCGCCCAGTGCAAAGTCATTATT
GTCAATAAGAATGAAGGCAGTTCCAAAGAGGCAATTTCCAAGATTCGACAAGAGGTGCCCGATGCAGACGTCGAC
TTCAAGGTGTGCAACCTCGGCAACCTGGGCCAAGTAAAGACTGTCTTTTCCTCCTTGCGGGAGAGCCTTGAGCGG
CTCGACTTTGTTGTGCTGTCTGCCGGTATAAATGCCAATCAATACGCCCTGGACGATGACGGCATTGAGAGTGTC
TTTGGCATCAACTATCTAGGCCACTACTATGCGCTCAACCAGCTCTGGCCGCTGCTTCGCAAAACAAGCCTCAAG
CCGGGCGTCCCAGCTCCTCGCATCGTCTGCATTACCAGCGAGCTCCACAAGGCAGCGCCCTCGGGCATCAAGTTC
CAGAGCCTGGAAGAGATTAACGACTCAAGCATGGGGCCTGCAGCGCTCTACGGTAGATCCAAAGTGGCGCTCTTG
CTCCTCTTAAAGTACGGCTTGCTAGAGCGCGTCATTAAGCCGACGAGCGACTCCATCATGGTCCTCTCGGTGCAT
CCCGGGGCGGTGAATACGGACATGCAGAAACAATGGAAAGACGCGTATCCCGGCCTGACGGGCAAACTCATTTCA
TGGGCCATGCAGTCCATCAGCCGGGATGCAAAACAGGGCTCCTATGGCGCCATTTGGGCCCTGACGACACCCGAG
AGCGACACCAAGCTTGAGAATGGGGGATACTATGTCGATCCGGCAACGACGGGCAGCCTGAGCACGCAGGCATCC
GATCCAACCCTCGGAGGAAACTTGTGGGAGCTGAGCGCAAAGATTGTCAGGGACAAGGTGGGTACAGATGCCTTG
ATGGACTGGAAGGCGTAA
Transcript >OphauB2|3833
ATGCAATCCGCCCTTGACGCCGTTGTAGGACCAACCGAGGTCCAGCCCGATCATCTCGGAGGCCGCATCGCCATT
GTAACGGGAGGAGCTCGCGGGATTGGCTATGAAACCGCCCGAGCTCTGGCTAGCGCCCAGTGCAAAGTCATTATT
GTCAATAAGAATGAAGGCAGTTCCAAAGAGGCAATTTCCAAGATTCGACAAGAGGTGCCCGATGCAGACGTCGAC
TTCAAGGTGTGCAACCTCGGCAACCTGGGCCAAGTAAAGACTGTCTTTTCCTCCTTGCGGGAGAGCCTTGAGCGG
CTCGACTTTGTTGTGCTGTCTGCCGGTATAAATGCCAATCAATACGCCCTGGACGATGACGGCATTGAGAGTGTC
TTTGGCATCAACTATCTAGGCCACTACTATGCGCTCAACCAGCTCTGGCCGCTGCTTCGCAAAACAAGCCTCAAG
CCGGGCGTCCCAGCTCCTCGCATCGTCTGCATTACCAGCGAGCTCCACAAGGCAGCGCCCTCGGGCATCAAGTTC
CAGAGCCTGGAAGAGATTAACGACTCAAGCATGGGGCCTGCAGCGCTCTACGGTAGATCCAAAGTGGCGCTCTTG
CTCCTCTTAAAGTACGGCTTGCTAGAGCGCGTCATTAAGCCGACGAGCGACTCCATCATGGTCCTCTCGGTGCAT
CCCGGGGCGGTGAATACGGACATGCAGAAACAATGGAAAGACGCGTATCCCGGCCTGACGGGCAAACTCATTTCA
TGGGCCATGCAGTCCATCAGCCGGGATGCAAAACAGGGCTCCTATGGCGCCATTTGGGCCCTGACGACACCCGAG
AGCGACACCAAGCTTGAGAATGGGGGATACTATGTCGATCCGGCAACGACGGGCAGCCTGAGCACGCAGGCATCC
GATCCAACCCTCGGAGGAAACTTGTGGGAGCTGAGCGCAAAGATTGTCAGGGACAAGGTGGGTACAGATGCCTTG
ATGGACTGGAAGGCGTAA
Gene >OphauB2|3833
ATGCAATCCGCCCTTGACGCCGTTGTAGGACCAACCGAGGTCCAGCCCGATCATCTCGGAGGCCGCATCGCCATT
GTAACGGGAGGAGCTCGCGGGATTGGCTATGAAACCGCCCGAGCTCTGGCTAGCGCCCAGTGCAAAGTCATTATT
GTCAATAAGAATGAAGGCAGTTCCAAAGAGGCAATTTCCAAGATTCGACAAGAGGTGCCCGATGCAGACGTCGAC
TTCAAGGTGTGCAACCTCGGCAACCTGGGCCAAGTAAAGACTGTCTTTTCCTCCTTGCGGGAGAGCCTTGAGCGG
CTCGACTTTGTTGTGCTGTCTGCCGGTATAAATGCCAATCAATACGCCCTGGACGATGACGGCATTGAGAGTGTC
TTTGGCATCAACTATCTAGGCCACTACTATGCGCTCAACCAGCTCTGGCCGCTGCTTCGCAAAACAAGCCTCAAG
CCGGGCGTCCCAGCTCCTCGCATCGTCTGCATTACCAGCGAGCTCCACAAGGCAGCGCCCTCGGGCATCAAGTTC
CAGAGCCTGGAAGAGATTAACGACTCAAGCATGGGGCCTGCAGCGCTCTACGGTAGATCCAAAGTGGCGCTCTTG
CTCCTCTTAAAGTACGGCTTGCTAGAGCGCGTCATTAAGCCGACGAGCGACTCCATCATGGTCCTCTCGGTGCAT
CCCGGGGCGGTAGGTTGATTCTTTGTCAAGATTACACAAGATGCTGACTAGCAATCCGTGCAGGTGAATACGGAC
ATGCAGAAACAATGGAAAGACGCGTATCCCGGCCTGACGGGCAAACTCATTTCATGGGCCATGCAGTCCATCAGC
CGGGATGCAAAACAGGGCTCCTATGGCGCCATTTGGGCCCTGACGACACCCGAGAGCGACACCAAGCTTGAGAAT
GGGGGATACTATGTCGATCCGGCAACGACGGGCAGCCTGAGCACGCAGGCATCCGATCCAACCCTCGGAGGAAAC
TTGTGGGAGCTGAGCGCAAAGATTGTCAGGGACAAGGTGGGTACAGATGCCTTGATGGACTGGAAGGCGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail