Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3825
Gene name
LocationContig_244:8953..11587
Strand+
Gene length (bp)2634
Transcript length (bp)2481
Coding sequence length (bp)2481
Protein length (aa) 827

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13589 HATPase_c_3 Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 1.0E-14 24 126
PF08676 MutL_C MutL C terminal dimerisation domain 9.0E-06 602 672

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12083|MLH3_YEAST DNA mismatch repair protein MLH3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MLH3 PE=1 SV=1 560 800 3.0E-30
sp|Q9UHC1|MLH3_HUMAN DNA mismatch repair protein Mlh3 OS=Homo sapiens GN=MLH3 PE=1 SV=3 503 800 4.0E-26
sp|F4JN26|MLH3_ARATH DNA mismatch repair protein MLH3 OS=Arabidopsis thaliana GN=MLH3 PE=2 SV=2 538 808 2.0E-19
sp|P54279|PMS2_MOUSE Mismatch repair endonuclease PMS2 OS=Mus musculus GN=Pms2 PE=2 SV=1 2 202 2.0E-13
sp|P54278|PMS2_HUMAN Mismatch repair endonuclease PMS2 OS=Homo sapiens GN=PMS2 PE=1 SV=2 2 202 1.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12083|MLH3_YEAST DNA mismatch repair protein MLH3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MLH3 PE=1 SV=1 560 800 3.0E-30
sp|Q9UHC1|MLH3_HUMAN DNA mismatch repair protein Mlh3 OS=Homo sapiens GN=MLH3 PE=1 SV=3 503 800 4.0E-26
sp|F4JN26|MLH3_ARATH DNA mismatch repair protein MLH3 OS=Arabidopsis thaliana GN=MLH3 PE=2 SV=2 538 808 2.0E-19
sp|P54279|PMS2_MOUSE Mismatch repair endonuclease PMS2 OS=Mus musculus GN=Pms2 PE=2 SV=1 2 202 2.0E-13
sp|P54278|PMS2_HUMAN Mismatch repair endonuclease PMS2 OS=Homo sapiens GN=PMS2 PE=1 SV=2 2 202 1.0E-10
sp|Q941I6|PMS1_ARATH DNA mismatch repair protein PMS1 OS=Arabidopsis thaliana GN=PMS1 PE=1 SV=1 3 252 2.0E-10
sp|B5YIZ6|MUTL_THEYD DNA mismatch repair protein MutL OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=mutL PE=3 SV=1 3 290 2.0E-10
sp|Q89DE6|MUTL_BRADU DNA mismatch repair protein MutL OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=mutL PE=3 SV=1 1 200 9.0E-10
sp|Q941I6|PMS1_ARATH DNA mismatch repair protein PMS1 OS=Arabidopsis thaliana GN=PMS1 PE=1 SV=1 569 794 1.0E-09
sp|Q3ACA6|MUTL_CARHZ DNA mismatch repair protein MutL OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=mutL PE=3 SV=1 3 163 3.0E-09
sp|Q5GZ85|MUTL_XANOR DNA mismatch repair protein MutL OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=mutL PE=3 SV=1 1 182 4.0E-09
sp|B2SHP8|MUTL_XANOP DNA mismatch repair protein MutL OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=mutL PE=3 SV=1 1 182 4.0E-09
sp|Q2P295|MUTL_XANOM DNA mismatch repair protein MutL OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=mutL PE=3 SV=1 1 182 4.0E-09
sp|Q8PJX2|MUTL_XANAC DNA mismatch repair protein MutL OS=Xanthomonas axonopodis pv. citri (strain 306) GN=mutL PE=3 SV=1 1 182 5.0E-09
sp|Q8P8E4|MUTL_XANCP DNA mismatch repair protein MutL OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=mutL PE=3 SV=1 1 182 5.0E-09
sp|B0RRZ8|MUTL_XANCB DNA mismatch repair protein MutL OS=Xanthomonas campestris pv. campestris (strain B100) GN=mutL PE=3 SV=1 1 182 5.0E-09
sp|Q4UVP3|MUTL_XANC8 DNA mismatch repair protein MutL OS=Xanthomonas campestris pv. campestris (strain 8004) GN=mutL PE=3 SV=1 1 182 5.0E-09
sp|Q219I5|MUTL_RHOPB DNA mismatch repair protein MutL OS=Rhodopseudomonas palustris (strain BisB18) GN=mutL PE=3 SV=1 1 182 7.0E-09
sp|Q3BSD0|MUTL_XANC5 DNA mismatch repair protein MutL OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=mutL PE=3 SV=1 1 182 8.0E-09
sp|A6VN10|MUTL_ACTSZ DNA mismatch repair protein MutL OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=mutL PE=3 SV=1 1 182 9.0E-09
sp|B7LC24|MUTL_ECO55 DNA mismatch repair protein MutL OS=Escherichia coli (strain 55989 / EAEC) GN=mutL PE=3 SV=1 1 242 2.0E-08
sp|A1SA23|MUTL_SHEAM DNA mismatch repair protein MutL OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=mutL PE=3 SV=1 1 179 3.0E-08
sp|Q9PFB8|MUTL_XYLFA DNA mismatch repair protein MutL OS=Xylella fastidiosa (strain 9a5c) GN=mutL PE=3 SV=1 1 182 3.0E-08
sp|Q045Q4|MUTL_LACGA DNA mismatch repair protein MutL OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=mutL PE=3 SV=1 3 232 3.0E-08
sp|Q11Z58|MUTL_CYTH3 DNA mismatch repair protein MutL OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=mutL PE=3 SV=1 3 228 3.0E-08
sp|Q92RP4|MUTL_RHIME DNA mismatch repair protein MutL OS=Rhizobium meliloti (strain 1021) GN=mutL PE=3 SV=1 1 182 3.0E-08
sp|F4JN26|MLH3_ARATH DNA mismatch repair protein MLH3 OS=Arabidopsis thaliana GN=MLH3 PE=2 SV=2 2 164 4.0E-08
sp|B6I274|MUTL_ECOSE DNA mismatch repair protein MutL OS=Escherichia coli (strain SE11) GN=mutL PE=3 SV=1 1 242 4.0E-08
sp|A8A7R4|MUTL_ECOHS DNA mismatch repair protein MutL OS=Escherichia coli O9:H4 (strain HS) GN=mutL PE=3 SV=1 1 242 4.0E-08
sp|A7ZV39|MUTL_ECO24 DNA mismatch repair protein MutL OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=mutL PE=3 SV=1 1 242 4.0E-08
sp|A6U6K5|MUTL_SINMW DNA mismatch repair protein MutL OS=Sinorhizobium medicae (strain WSM419) GN=mutL PE=3 SV=1 1 182 4.0E-08
sp|Q3SIQ5|MUTL_THIDA DNA mismatch repair protein MutL OS=Thiobacillus denitrificans (strain ATCC 25259) GN=mutL PE=3 SV=1 1 214 4.0E-08
sp|P23367|MUTL_ECOLI DNA mismatch repair protein MutL OS=Escherichia coli (strain K12) GN=mutL PE=1 SV=2 1 242 4.0E-08
sp|B1XDS1|MUTL_ECODH DNA mismatch repair protein MutL OS=Escherichia coli (strain K12 / DH10B) GN=mutL PE=3 SV=1 1 242 4.0E-08
sp|C5A1G1|MUTL_ECOBW DNA mismatch repair protein MutL OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=mutL PE=3 SV=1 1 242 4.0E-08
sp|Q3YUH3|MUTL_SHISS DNA mismatch repair protein MutL OS=Shigella sonnei (strain Ss046) GN=mutL PE=3 SV=1 1 242 4.0E-08
sp|B2TY45|MUTL_SHIB3 DNA mismatch repair protein MutL OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=mutL PE=3 SV=1 1 242 4.0E-08
sp|B7M8T0|MUTL_ECO8A DNA mismatch repair protein MutL OS=Escherichia coli O8 (strain IAI1) GN=mutL PE=3 SV=1 1 242 4.0E-08
sp|Q74KW0|MUTL_LACJO DNA mismatch repair protein MutL OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=mutL PE=3 SV=1 3 228 5.0E-08
sp|Q2GJE2|MUTL_ANAPZ DNA mismatch repair protein MutL OS=Anaplasma phagocytophilum (strain HZ) GN=mutL PE=3 SV=1 1 175 5.0E-08
sp|Q6N1N4|MUTL_RHOPA DNA mismatch repair protein MutL OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=mutL PE=3 SV=1 1 200 5.0E-08
sp|A8GQA9|MUTL_RICAH DNA mismatch repair protein MutL OS=Rickettsia akari (strain Hartford) GN=mutL PE=3 SV=1 1 202 6.0E-08
sp|Q0SXB2|MUTL_SHIF8 DNA mismatch repair protein MutL OS=Shigella flexneri serotype 5b (strain 8401) GN=mutL PE=3 SV=1 1 242 7.0E-08
sp|P54277|PMS1_HUMAN PMS1 protein homolog 1 OS=Homo sapiens GN=PMS1 PE=1 SV=1 3 193 7.0E-08
sp|Q0T9M3|MUTL_ECOL5 DNA mismatch repair protein MutL OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=mutL PE=3 SV=1 1 242 7.0E-08
sp|A1AJ76|MUTL_ECOK1 DNA mismatch repair protein MutL OS=Escherichia coli O1:K1 / APEC GN=mutL PE=3 SV=1 1 242 7.0E-08
sp|B7MKX4|MUTL_ECO45 DNA mismatch repair protein MutL OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=mutL PE=3 SV=1 1 242 7.0E-08
sp|B6JIV1|MUTL_OLICO DNA mismatch repair protein MutL OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=mutL PE=3 SV=1 1 200 7.0E-08
sp|Q83P35|MUTL_SHIFL DNA mismatch repair protein MutL OS=Shigella flexneri GN=mutL PE=3 SV=4 1 242 7.0E-08
sp|Q31TA0|MUTL_SHIBS DNA mismatch repair protein MutL OS=Shigella boydii serotype 4 (strain Sb227) GN=mutL PE=3 SV=1 1 242 7.0E-08
sp|Q0I463|MUTL_HAES1 DNA mismatch repair protein MutL OS=Haemophilus somnus (strain 129Pt) GN=mutL PE=3 SV=1 1 202 7.0E-08
sp|B0UUU5|MUTL_HISS2 DNA mismatch repair protein MutL OS=Histophilus somni (strain 2336) GN=mutL PE=3 SV=1 1 202 7.0E-08
sp|P57886|MUTL_PASMU DNA mismatch repair protein MutL OS=Pasteurella multocida (strain Pm70) GN=mutL PE=3 SV=1 1 182 8.0E-08
sp|A3QAD8|MUTL_SHELP DNA mismatch repair protein MutL OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=mutL PE=3 SV=1 1 179 8.0E-08
sp|Q328E9|MUTL_SHIDS DNA mismatch repair protein MutL OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=mutL PE=3 SV=1 1 259 8.0E-08
sp|P73349|MUTL_SYNY3 DNA mismatch repair protein MutL OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=mutL PE=3 SV=2 3 194 9.0E-08
sp|A8YTI0|MUTL_LACH4 DNA mismatch repair protein MutL OS=Lactobacillus helveticus (strain DPC 4571) GN=mutL PE=3 SV=1 3 205 9.0E-08
sp|Q1QIP3|MUTL_NITHX DNA mismatch repair protein MutL OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=mutL PE=3 SV=1 1 202 9.0E-08
sp|A0KSR5|MUTL_SHESA DNA mismatch repair protein MutL OS=Shewanella sp. (strain ANA-3) GN=mutL PE=3 SV=1 1 179 1.0E-07
sp|B2VCU8|MUTL_ERWT9 DNA mismatch repair protein MutL OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=mutL PE=3 SV=1 1 191 1.0E-07
sp|C3LR77|MUTL_VIBCM DNA mismatch repair protein MutL OS=Vibrio cholerae serotype O1 (strain M66-2) GN=mutL PE=3 SV=1 1 177 1.0E-07
sp|Q9KV13|MUTL_VIBCH DNA mismatch repair protein MutL OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=mutL PE=3 SV=1 1 177 1.0E-07
sp|A5F3L5|MUTL_VIBC3 DNA mismatch repair protein MutL OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=mutL PE=3 SV=1 1 177 1.0E-07
sp|Q3SPJ0|MUTL_NITWN DNA mismatch repair protein MutL OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=mutL PE=3 SV=1 1 202 1.0E-07
sp|B0U5C6|MUTL_XYLFM DNA mismatch repair protein MutL OS=Xylella fastidiosa (strain M12) GN=mutL PE=3 SV=1 1 182 1.0E-07
sp|Q87AC9|MUTL_XYLFT DNA mismatch repair protein MutL OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=mutL PE=3 SV=1 1 182 1.0E-07
sp|B2I9E6|MUTL_XYLF2 DNA mismatch repair protein MutL OS=Xylella fastidiosa (strain M23) GN=mutL PE=3 SV=1 1 182 1.0E-07
sp|B5Z2H6|MUTL_ECO5E DNA mismatch repair protein MutL OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=mutL PE=3 SV=1 1 242 1.0E-07
sp|Q8XDN4|MUTL_ECO57 DNA mismatch repair protein MutL OS=Escherichia coli O157:H7 GN=mutL PE=3 SV=1 1 242 1.0E-07
sp|B1LQJ0|MUTL_ECOSM DNA mismatch repair protein MutL OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=mutL PE=3 SV=1 1 242 1.0E-07
sp|B7MSY3|MUTL_ECO81 DNA mismatch repair protein MutL OS=Escherichia coli O81 (strain ED1a) GN=mutL PE=3 SV=1 1 242 1.0E-07
sp|B1IT36|MUTL_ECOLC DNA mismatch repair protein MutL OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=mutL PE=3 SV=1 1 242 2.0E-07
sp|Q8FAK9|MUTL_ECOL6 DNA mismatch repair protein MutL OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=mutL PE=3 SV=2 1 242 2.0E-07
sp|Q2RQ52|MUTL_RHORT DNA mismatch repair protein MutL OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=mutL PE=3 SV=1 1 280 2.0E-07
sp|A4Z0Q5|MUTL_BRASO DNA mismatch repair protein MutL OS=Bradyrhizobium sp. (strain ORS278) GN=mutL PE=3 SV=1 1 182 2.0E-07
sp|B7UQH9|MUTL_ECO27 DNA mismatch repair protein MutL OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=mutL PE=3 SV=1 1 242 2.0E-07
sp|Q983L2|MUTL_RHILO DNA mismatch repair protein MutL OS=Rhizobium loti (strain MAFF303099) GN=mutL PE=3 SV=1 1 163 2.0E-07
sp|B3Q7Y9|MUTL_RHOPT DNA mismatch repair protein MutL OS=Rhodopseudomonas palustris (strain TIE-1) GN=mutL PE=3 SV=1 1 200 2.0E-07
sp|Q7MH01|MUTL_VIBVY DNA mismatch repair protein MutL OS=Vibrio vulnificus (strain YJ016) GN=mutL PE=3 SV=1 1 290 2.0E-07
sp|Q87L05|MUTL_VIBPA DNA mismatch repair protein MutL OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=mutL PE=3 SV=1 1 177 2.0E-07
sp|B7NGA4|MUTL_ECOLU DNA mismatch repair protein MutL OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=mutL PE=3 SV=1 1 242 2.0E-07
sp|Q3IDU0|MUTL_PSEHT DNA mismatch repair protein MutL OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=mutL PE=3 SV=1 1 231 2.0E-07
sp|B5BKH9|MUTL_SALPK DNA mismatch repair protein MutL OS=Salmonella paratyphi A (strain AKU_12601) GN=mutL PE=3 SV=1 1 182 2.0E-07
sp|Q5PL49|MUTL_SALPA DNA mismatch repair protein MutL OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=mutL PE=3 SV=1 1 182 2.0E-07
sp|P14161|MUTL_SALTY DNA mismatch repair protein MutL OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mutL PE=3 SV=1 1 182 2.0E-07
sp|B4T2R5|MUTL_SALNS DNA mismatch repair protein MutL OS=Salmonella newport (strain SL254) GN=mutL PE=3 SV=1 1 182 2.0E-07
sp|B5F385|MUTL_SALA4 DNA mismatch repair protein MutL OS=Salmonella agona (strain SL483) GN=mutL PE=3 SV=1 1 182 2.0E-07
sp|B5R0N7|MUTL_SALEP DNA mismatch repair protein MutL OS=Salmonella enteritidis PT4 (strain P125109) GN=mutL PE=3 SV=1 1 182 2.0E-07
sp|B5FRM6|MUTL_SALDC DNA mismatch repair protein MutL OS=Salmonella dublin (strain CT_02021853) GN=mutL PE=3 SV=1 1 182 2.0E-07
sp|B4TSF0|MUTL_SALSV DNA mismatch repair protein MutL OS=Salmonella schwarzengrund (strain CVM19633) GN=mutL PE=3 SV=1 1 182 2.0E-07
sp|B5R9B7|MUTL_SALG2 DNA mismatch repair protein MutL OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=mutL PE=3 SV=1 1 182 2.0E-07
sp|Q12083|MLH3_YEAST DNA mismatch repair protein MLH3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MLH3 PE=1 SV=1 3 161 3.0E-07
sp|C0Q6C7|MUTL_SALPC DNA mismatch repair protein MutL OS=Salmonella paratyphi C (strain RKS4594) GN=mutL PE=3 SV=1 1 182 3.0E-07
sp|Q57GM1|MUTL_SALCH DNA mismatch repair protein MutL OS=Salmonella choleraesuis (strain SC-B67) GN=mutL PE=3 SV=1 1 182 3.0E-07
sp|Q0HMP1|MUTL_SHESM DNA mismatch repair protein MutL OS=Shewanella sp. (strain MR-4) GN=mutL PE=3 SV=1 1 179 3.0E-07
sp|Q0HR40|MUTL_SHESR DNA mismatch repair protein MutL OS=Shewanella sp. (strain MR-7) GN=mutL PE=3 SV=1 1 179 3.0E-07
sp|A8AMN1|MUTL_CITK8 DNA mismatch repair protein MutL OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=mutL PE=3 SV=1 1 182 3.0E-07
sp|Q1RGP6|MUTL_RICBR DNA mismatch repair protein MutL OS=Rickettsia bellii (strain RML369-C) GN=mutL PE=3 SV=1 1 280 3.0E-07
sp|A9N4Y4|MUTL_SALPB DNA mismatch repair protein MutL OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=mutL PE=3 SV=1 1 182 3.0E-07
sp|B4TFA4|MUTL_SALHS DNA mismatch repair protein MutL OS=Salmonella heidelberg (strain SL476) GN=mutL PE=3 SV=1 1 182 3.0E-07
sp|A8GY89|MUTL_RICB8 DNA mismatch repair protein MutL OS=Rickettsia bellii (strain OSU 85-389) GN=mutL PE=3 SV=1 1 202 3.0E-07
sp|Q8Z187|MUTL_SALTI DNA mismatch repair protein MutL OS=Salmonella typhi GN=mutL PE=3 SV=1 1 182 3.0E-07
sp|B1KHV0|MUTL_SHEWM DNA mismatch repair protein MutL OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=mutL PE=3 SV=1 1 179 3.0E-07
sp|B9JA11|MUTL_AGRRK DNA mismatch repair protein MutL OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=mutL PE=3 SV=1 1 175 3.0E-07
sp|A4W5R1|MUTL_ENT38 DNA mismatch repair protein MutL OS=Enterobacter sp. (strain 638) GN=mutL PE=3 SV=1 1 182 4.0E-07
sp|Q8UHI3|MUTL_AGRFC DNA mismatch repair protein MutL OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=mutL PE=3 SV=2 1 177 4.0E-07
sp|Q2KX20|MUTL_BORA1 DNA mismatch repair protein MutL OS=Bordetella avium (strain 197N) GN=mutL PE=3 SV=1 3 163 4.0E-07
sp|Q1GSN3|MUTL_SPHAL DNA mismatch repair protein MutL OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=mutL PE=3 SV=1 1 280 4.0E-07
sp|Q07RR2|MUTL_RHOP5 DNA mismatch repair protein MutL OS=Rhodopseudomonas palustris (strain BisA53) GN=mutL PE=3 SV=1 1 200 4.0E-07
sp|Q4UJQ1|MUTL_RICFE DNA mismatch repair protein MutL OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=mutL PE=3 SV=1 1 202 4.0E-07
sp|B0JS91|MUTL_MICAN DNA mismatch repair protein MutL OS=Microcystis aeruginosa (strain NIES-843) GN=mutL PE=3 SV=1 1 161 4.0E-07
sp|B7JY11|MUTL_CYAP8 DNA mismatch repair protein MutL OS=Cyanothece sp. (strain PCC 8801) GN=mutL PE=3 SV=1 3 161 5.0E-07
sp|Q131I8|MUTL_RHOPS DNA mismatch repair protein MutL OS=Rhodopseudomonas palustris (strain BisB5) GN=mutL PE=3 SV=1 1 200 5.0E-07
sp|A5ECL8|MUTL_BRASB DNA mismatch repair protein MutL OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=mutL PE=3 SV=1 1 200 5.0E-07
sp|Q65SD7|MUTL_MANSM DNA mismatch repair protein MutL OS=Mannheimia succiniciproducens (strain MBEL55E) GN=mutL PE=3 SV=1 1 202 5.0E-07
sp|B8CX97|MUTL_HALOH DNA mismatch repair protein MutL OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=mutL PE=3 SV=1 3 194 6.0E-07
sp|B7LLV2|MUTL_ESCF3 DNA mismatch repair protein MutL OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=mutL PE=3 SV=1 1 182 6.0E-07
sp|A9MFP2|MUTL_SALAR DNA mismatch repair protein MutL OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=mutL PE=3 SV=1 1 182 6.0E-07
sp|Q8DCV0|MUTL_VIBVU DNA mismatch repair protein MutL OS=Vibrio vulnificus (strain CMCP6) GN=mutL PE=3 SV=1 1 290 6.0E-07
sp|Q2ISE2|MUTL_RHOP2 DNA mismatch repair protein MutL OS=Rhodopseudomonas palustris (strain HaA2) GN=mutL PE=3 SV=1 1 200 6.0E-07
sp|A8FRD3|MUTL_SHESH DNA mismatch repair protein MutL OS=Shewanella sediminis (strain HAW-EB3) GN=mutL PE=3 SV=1 1 179 6.0E-07
sp|A9L3W1|MUTL_SHEB9 DNA mismatch repair protein MutL OS=Shewanella baltica (strain OS195) GN=mutL PE=3 SV=1 1 191 6.0E-07
sp|A7MMA2|MUTL_CROS8 DNA mismatch repair protein MutL OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=mutL PE=3 SV=1 1 182 7.0E-07
sp|Q2LUR5|MUTL_SYNAS DNA mismatch repair protein MutL OS=Syntrophus aciditrophicus (strain SB) GN=mutL PE=3 SV=1 6 285 7.0E-07
sp|P54280|PMS1_SCHPO DNA mismatch repair protein pms1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pms1 PE=3 SV=1 2 195 9.0E-07
sp|B8CIX3|MUTL_SHEPW DNA mismatch repair protein MutL OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=mutL PE=3 SV=1 1 191 1.0E-06
sp|B1I293|MUTL_DESAP DNA mismatch repair protein MutL OS=Desulforudis audaxviator (strain MP104C) GN=mutL PE=3 SV=1 3 174 1.0E-06
sp|Q8F6X4|MUTL_LEPIN DNA mismatch repair protein MutL OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=mutL PE=3 SV=2 3 183 1.0E-06
sp|Q72PF7|MUTL_LEPIC DNA mismatch repair protein MutL OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=mutL PE=3 SV=2 3 183 1.0E-06
sp|B1ZZY2|MUTL_OPITP DNA mismatch repair protein MutL OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=mutL PE=3 SV=1 3 291 2.0E-06
sp|Q6D065|MUTL_PECAS DNA mismatch repair protein MutL OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=mutL PE=3 SV=1 1 191 2.0E-06
sp|A0B977|MUTL_METTP DNA mismatch repair protein MutL OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=mutL PE=3 SV=1 3 164 2.0E-06
sp|Q83CM9|MUTL_COXBU DNA mismatch repair protein MutL OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=mutL PE=3 SV=1 1 163 2.0E-06
sp|A9NCK3|MUTL_COXBR DNA mismatch repair protein MutL OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=mutL PE=3 SV=1 1 163 2.0E-06
sp|A9KE32|MUTL_COXBN DNA mismatch repair protein MutL OS=Coxiella burnetii (strain Dugway 5J108-111) GN=mutL PE=3 SV=1 1 163 2.0E-06
sp|B6J016|MUTL_COXB2 DNA mismatch repair protein MutL OS=Coxiella burnetii (strain CbuG_Q212) GN=mutL PE=3 SV=1 1 163 2.0E-06
sp|C6DFJ9|MUTL_PECCP DNA mismatch repair protein MutL OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=mutL PE=3 SV=1 1 191 2.0E-06
sp|O84579|MUTL_CHLTR DNA mismatch repair protein MutL OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=mutL PE=3 SV=1 3 161 4.0E-06
sp|Q3KLC2|MUTL_CHLTA DNA mismatch repair protein MutL OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=mutL PE=3 SV=1 3 161 4.0E-06
sp|B0BA28|MUTL_CHLTB DNA mismatch repair protein MutL OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=mutL PE=3 SV=1 3 161 4.0E-06
sp|B0B8E9|MUTL_CHLT2 DNA mismatch repair protein MutL OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=mutL PE=3 SV=1 3 161 4.0E-06
sp|Q2VYV5|MUTL_MAGSA DNA mismatch repair protein MutL OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=mutL PE=3 SV=1 1 163 5.0E-06
sp|A5V3J3|MUTL_SPHWW DNA mismatch repair protein MutL OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=mutL PE=3 SV=1 1 163 8.0E-06
sp|Q1QY28|MUTL_CHRSD DNA mismatch repair protein MutL OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=mutL PE=3 SV=1 3 182 9.0E-06
sp|B3PDC3|MUTL_CELJU DNA mismatch repair protein MutL OS=Cellvibrio japonicus (strain Ueda107) GN=mutL PE=3 SV=1 3 163 9.0E-06
sp|B4F203|MUTL_PROMH DNA mismatch repair protein MutL OS=Proteus mirabilis (strain HI4320) GN=mutL PE=3 SV=1 1 182 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006298 mismatch repair Yes
GO:0005524 ATP binding Yes
GO:0000166 nucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0051716 cellular response to stimulus No
GO:1901360 organic cyclic compound metabolic process No
GO:0097367 carbohydrate derivative binding No
GO:0006807 nitrogen compound metabolic process No
GO:0032553 ribonucleotide binding No
GO:0043167 ion binding No
GO:0033554 cellular response to stress No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0006281 DNA repair No
GO:0006725 cellular aromatic compound metabolic process No
GO:0006950 response to stress No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0008152 metabolic process No
GO:0043168 anion binding No
GO:0046483 heterocycle metabolic process No
GO:0006974 cellular response to DNA damage stimulus No
GO:0030554 adenyl nucleotide binding No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:0050896 response to stimulus No
GO:0036094 small molecule binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0090304 nucleic acid metabolic process No
GO:0044237 cellular metabolic process No
GO:0006259 DNA metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3825
MSIRQLPDHVVDQLESASAITCLNAVVCGLLKNSLDAGCTRANIRIDYVHGNCSVQDDGLGIEPGEFKDGGGLAK
PHHTSRSAASSNCHGSRGDFLASVANLSLLSIVSHHGAYMSHGYLSIHNSNVLTRQMPAPPDKRLEVFSHGTHVS
VRALFGSMPVRVKHRATVFSERSGIDKEWRSLVRQVVALLLAWPSEVSVSLTETAIRRDLRLKSAPYGDLCARTS
RLLTQASLADSADAVSWLPVSLCNCRVRIKGCISTRPVASRRSQLMSLGIRPILDDHNFNVLYESVNHVFTNSGF
GIVQDENDGEATVKSRKGPDKWPMFYLHITLLSPETTLDNSLIGDKALDNITKLLQKVCHDFLQKQHLRPRALNR
LAPTRKAAKWRNSSSDLSQLATPLKSTPPLSGSRLADQAMLKFVSPFEDWHRIKVGAAAPTRETKSPRNSRRMVG
EGGKLLRLPFDNLPDGNSSHELQTRHGTLGDDGPIKPSKRLRIIDNSPKPQPSPWLQNVLKSWENPVFEIAQVSI
PKLHEDFTASNTGTCSHSSRHVNLEANSMSLAGRVSKSALADAEVIGQVDRKFILVKLPLESVAKRTVEANEARV
PALVMVDQHAADERCKLEELMAGYFERKPANGSYEAVVEPLEQPMVFEMADQEGEMLQRYHGYFASWGIHYSVQR
GSREQPTAKMCILQLPTSIVERCRSEPRLMIGLVRKEIWLLHDESKTCGLPCTGDEAGLPPRSRFHGCPAGILDL
LYSRSCRSAIMFNDELSREQCQQLVRQLAQCAFPFQCAHGRPSMVPLADLGPGHDAVSWQLRRGSDLSMWKKWLQ
S*
Coding >OphauB2|3825
ATGTCCATCCGCCAGCTCCCCGACCATGTCGTGGACCAACTCGAGTCGGCATCCGCCATCACTTGTCTCAATGCC
GTCGTCTGTGGGTTGCTCAAAAATTCGCTAGACGCTGGCTGCACAAGGGCCAATATCCGCATCGACTATGTCCAT
GGAAATTGCAGTGTCCAAGACGACGGACTCGGCATTGAGCCCGGCGAGTTCAAGGATGGCGGAGGTCTGGCAAAG
CCGCATCACACGTCACGAAGCGCTGCAAGCTCCAACTGCCATGGCAGCCGCGGCGACTTTCTAGCATCGGTAGCA
AATCTGTCGTTGCTATCCATTGTCTCGCATCATGGCGCATACATGTCCCACGGCTACCTCTCAATCCACAACTCC
AATGTTTTGACCAGGCAGATGCCTGCACCTCCAGACAAGCGCCTCGAAGTATTCAGTCACGGAACACATGTCTCT
GTGCGAGCCTTGTTTGGTTCTATGCCTGTCCGGGTCAAACATCGCGCGACTGTCTTTTCTGAGCGCTCGGGCATC
GACAAGGAATGGCGAAGTCTCGTCCGTCAAGTTGTCGCCTTGCTTCTGGCATGGCCATCTGAGGTGTCGGTTTCT
TTGACCGAGACAGCCATCCGTCGTGACTTGCGCCTCAAGTCTGCGCCATATGGCGACTTGTGCGCGCGTACCTCG
AGGCTCTTGACTCAAGCCTCTCTAGCTGATTCAGCCGACGCTGTCTCTTGGCTCCCGGTTTCCCTCTGTAATTGC
CGGGTCCGCATCAAGGGCTGTATTTCGACGAGGCCGGTAGCCTCACGTCGCTCCCAGCTCATGAGCTTGGGCATA
CGTCCCATTCTTGACGACCATAATTTCAATGTGCTTTATGAGTCTGTCAACCACGTCTTTACCAACTCTGGCTTT
GGCATCGTCCAAGATGAAAATGATGGAGAAGCAACTGTAAAGTCCCGCAAGGGACCCGACAAATGGCCAATGTTT
TATCTTCACATTACACTCCTGAGCCCAGAAACCACTCTGGACAATTCATTGATTGGTGACAAGGCCCTGGACAAT
ATCACAAAGCTTCTTCAAAAAGTCTGCCACGACTTTCTTCAGAAACAGCACCTGCGACCACGGGCCTTGAATCGA
TTGGCTCCCACTCGAAAAGCTGCAAAATGGCGCAACAGCTCTTCTGACCTGTCGCAATTGGCTACGCCGCTCAAG
TCGACACCGCCTCTCTCTGGCAGCCGACTGGCTGATCAAGCCATGCTGAAGTTTGTCAGTCCCTTTGAGGATTGG
CATCGTATCAAGGTCGGGGCAGCGGCTCCGACAAGAGAGACCAAGTCTCCGCGCAATAGCCGCCGTATGGTTGGA
GAGGGGGGCAAACTGCTTCGCCTACCATTCGACAATCTACCAGATGGAAACAGCAGCCATGAGCTTCAGACACGA
CATGGAACCCTGGGGGACGACGGCCCCATCAAGCCCTCCAAGAGGTTGCGAATCATTGACAATTCACCCAAGCCT
CAGCCAAGTCCCTGGCTTCAAAATGTCCTCAAATCGTGGGAGAACCCTGTGTTCGAAATAGCACAAGTATCAATT
CCAAAGCTGCACGAGGATTTTACAGCCTCCAACACTGGCACATGTAGCCACAGCAGTCGGCACGTCAATCTCGAA
GCGAATTCAATGAGCCTGGCTGGGCGTGTCTCGAAATCTGCCTTGGCTGATGCCGAGGTGATTGGCCAGGTGGAT
CGCAAATTTATCCTTGTCAAGTTGCCGCTTGAGAGTGTCGCCAAACGCACCGTTGAAGCCAATGAAGCAAGAGTT
CCGGCCTTGGTCATGGTTGATCAGCATGCTGCTGACGAGCGGTGCAAGCTGGAGGAGCTGATGGCAGGCTACTTT
GAAAGAAAGCCAGCCAATGGCTCGTATGAAGCAGTCGTTGAACCATTAGAGCAGCCCATGGTTTTCGAGATGGCC
GATCAAGAGGGAGAGATGCTGCAGCGATATCATGGATATTTTGCATCATGGGGTATACACTACAGCGTCCAAAGA
GGGAGTCGGGAGCAGCCCACGGCCAAGATGTGCATTCTGCAACTACCCACGAGCATTGTCGAGCGCTGTCGCAGC
GAGCCGCGTTTGATGATAGGTCTTGTGCGAAAGGAGATATGGTTGCTCCACGATGAGAGCAAGACATGTGGCCTA
CCCTGCACTGGTGATGAGGCTGGTCTGCCACCAAGGTCGCGCTTCCACGGCTGTCCGGCAGGTATTCTGGACCTT
TTGTACTCCCGGTCCTGTCGCAGCGCCATCATGTTCAATGACGAGCTGTCGAGAGAGCAATGCCAGCAGCTGGTG
CGGCAACTGGCCCAGTGCGCATTTCCCTTTCAATGCGCCCATGGTCGACCGAGCATGGTGCCCCTTGCTGACCTT
GGACCTGGCCACGATGCCGTGTCATGGCAGCTTCGACGTGGTTCGGACCTGTCCATGTGGAAGAAATGGCTGCAA
AGCTAG
Transcript >OphauB2|3825
ATGTCCATCCGCCAGCTCCCCGACCATGTCGTGGACCAACTCGAGTCGGCATCCGCCATCACTTGTCTCAATGCC
GTCGTCTGTGGGTTGCTCAAAAATTCGCTAGACGCTGGCTGCACAAGGGCCAATATCCGCATCGACTATGTCCAT
GGAAATTGCAGTGTCCAAGACGACGGACTCGGCATTGAGCCCGGCGAGTTCAAGGATGGCGGAGGTCTGGCAAAG
CCGCATCACACGTCACGAAGCGCTGCAAGCTCCAACTGCCATGGCAGCCGCGGCGACTTTCTAGCATCGGTAGCA
AATCTGTCGTTGCTATCCATTGTCTCGCATCATGGCGCATACATGTCCCACGGCTACCTCTCAATCCACAACTCC
AATGTTTTGACCAGGCAGATGCCTGCACCTCCAGACAAGCGCCTCGAAGTATTCAGTCACGGAACACATGTCTCT
GTGCGAGCCTTGTTTGGTTCTATGCCTGTCCGGGTCAAACATCGCGCGACTGTCTTTTCTGAGCGCTCGGGCATC
GACAAGGAATGGCGAAGTCTCGTCCGTCAAGTTGTCGCCTTGCTTCTGGCATGGCCATCTGAGGTGTCGGTTTCT
TTGACCGAGACAGCCATCCGTCGTGACTTGCGCCTCAAGTCTGCGCCATATGGCGACTTGTGCGCGCGTACCTCG
AGGCTCTTGACTCAAGCCTCTCTAGCTGATTCAGCCGACGCTGTCTCTTGGCTCCCGGTTTCCCTCTGTAATTGC
CGGGTCCGCATCAAGGGCTGTATTTCGACGAGGCCGGTAGCCTCACGTCGCTCCCAGCTCATGAGCTTGGGCATA
CGTCCCATTCTTGACGACCATAATTTCAATGTGCTTTATGAGTCTGTCAACCACGTCTTTACCAACTCTGGCTTT
GGCATCGTCCAAGATGAAAATGATGGAGAAGCAACTGTAAAGTCCCGCAAGGGACCCGACAAATGGCCAATGTTT
TATCTTCACATTACACTCCTGAGCCCAGAAACCACTCTGGACAATTCATTGATTGGTGACAAGGCCCTGGACAAT
ATCACAAAGCTTCTTCAAAAAGTCTGCCACGACTTTCTTCAGAAACAGCACCTGCGACCACGGGCCTTGAATCGA
TTGGCTCCCACTCGAAAAGCTGCAAAATGGCGCAACAGCTCTTCTGACCTGTCGCAATTGGCTACGCCGCTCAAG
TCGACACCGCCTCTCTCTGGCAGCCGACTGGCTGATCAAGCCATGCTGAAGTTTGTCAGTCCCTTTGAGGATTGG
CATCGTATCAAGGTCGGGGCAGCGGCTCCGACAAGAGAGACCAAGTCTCCGCGCAATAGCCGCCGTATGGTTGGA
GAGGGGGGCAAACTGCTTCGCCTACCATTCGACAATCTACCAGATGGAAACAGCAGCCATGAGCTTCAGACACGA
CATGGAACCCTGGGGGACGACGGCCCCATCAAGCCCTCCAAGAGGTTGCGAATCATTGACAATTCACCCAAGCCT
CAGCCAAGTCCCTGGCTTCAAAATGTCCTCAAATCGTGGGAGAACCCTGTGTTCGAAATAGCACAAGTATCAATT
CCAAAGCTGCACGAGGATTTTACAGCCTCCAACACTGGCACATGTAGCCACAGCAGTCGGCACGTCAATCTCGAA
GCGAATTCAATGAGCCTGGCTGGGCGTGTCTCGAAATCTGCCTTGGCTGATGCCGAGGTGATTGGCCAGGTGGAT
CGCAAATTTATCCTTGTCAAGTTGCCGCTTGAGAGTGTCGCCAAACGCACCGTTGAAGCCAATGAAGCAAGAGTT
CCGGCCTTGGTCATGGTTGATCAGCATGCTGCTGACGAGCGGTGCAAGCTGGAGGAGCTGATGGCAGGCTACTTT
GAAAGAAAGCCAGCCAATGGCTCGTATGAAGCAGTCGTTGAACCATTAGAGCAGCCCATGGTTTTCGAGATGGCC
GATCAAGAGGGAGAGATGCTGCAGCGATATCATGGATATTTTGCATCATGGGGTATACACTACAGCGTCCAAAGA
GGGAGTCGGGAGCAGCCCACGGCCAAGATGTGCATTCTGCAACTACCCACGAGCATTGTCGAGCGCTGTCGCAGC
GAGCCGCGTTTGATGATAGGTCTTGTGCGAAAGGAGATATGGTTGCTCCACGATGAGAGCAAGACATGTGGCCTA
CCCTGCACTGGTGATGAGGCTGGTCTGCCACCAAGGTCGCGCTTCCACGGCTGTCCGGCAGGTATTCTGGACCTT
TTGTACTCCCGGTCCTGTCGCAGCGCCATCATGTTCAATGACGAGCTGTCGAGAGAGCAATGCCAGCAGCTGGTG
CGGCAACTGGCCCAGTGCGCATTTCCCTTTCAATGCGCCCATGGTCGACCGAGCATGGTGCCCCTTGCTGACCTT
GGACCTGGCCACGATGCCGTGTCATGGCAGCTTCGACGTGGTTCGGACCTGTCCATGTGGAAGAAATGGCTGCAA
AGCTAG
Gene >OphauB2|3825
ATGTCCATCCGCCAGCTCCCCGACCATGTCGTGGACCAACTCGAGTCGGCATCCGCCATCACTTGTCTCAATGCC
GTCGTCTGTGGGTTGCTCAAAAATTCGCTAGACGCTGGCTGCACAAGGGCCAATATCCGCATCGACTATGTCCAT
GGAAATTGCAGTGTCCAAGACGACGGACTCGGCATTGAGCCCGGCGAGTTCAAGGATGGCGGAGGTCTGGCAAAG
CCGCATCGTGAGCCAAGACGCCCCGTCCATGCCCCCCTTTAATGACCCCTTCTCATGGCCCCTTTAATGGCCCCT
TGCAAGCTGACGTGCAAAGTCAGACACGTCACGAAGCGCTGCAAGCTCCAACTGCCATGGCAGCCGCGGCGACTT
TCTAGCATCGGTAGCAAATCTGTCGTTGCTATCCATTGTCTCGCATCATGGCGCATACATGTCCCACGGCTACCT
CTCAATCCACAACTCCAATGTTTTGACCAGGCAGATGCCTGCACCTCCAGACAAGCGCCTCGAAGTATTCAGTCA
CGGAACACATGTCTCTGTGCGAGCCTTGTTTGGTTCTATGCCTGTCCGGGTCAAACATCGCGCGACTGTCTTTTC
TGAGCGCTCGGGCATCGACAAGGAATGGCGAAGTCTCGTCCGTCAAGTTGTCGCCTTGCTTCTGGCATGGCCATC
TGAGGTGTCGGTTTCTTTGACCGAGACAGCCATCCGTCGTGACTTGCGCCTCAAGTCTGCGCCATATGGCGACTT
GTGCGCGCGTACCTCGAGGCTCTTGACTCAAGCCTCTCTAGCTGATTCAGCCGACGCTGTCTCTTGGCTCCCGGT
TTCCCTCTGTAATTGCCGGGTCCGCATCAAGGGCTGTATTTCGACGAGGCCGGTAGCCTCACGTCGCTCCCAGCT
CATGAGCTTGGGCATACGTCCCATTCTTGACGACCATAATTTCAATGTGCTTTATGAGTCTGTCAACCACGTCTT
TACCAACTCTGGCTTTGGCATCGTCCAAGATGAAAATGATGGAGAAGCAACTGTAAAGTCCCGCAAGGGACCCGA
CAAATGGCCAATGTTTTATCTTCACATTACACTCCTGAGCCCAGAAACCACTCTGGACAATTCATTGATTGGTGA
CAAGGCCCTGGACAATATCACAAAGCTTCTTCAAAAAGTCTGCCACGACTTTCTTCAGAAACAGCACCTGCGACC
ACGGGCCTTGAATCGATTGGCTCCCACTCGAAAAGCTGCAAAATGGCGCAACAGCTCTTCTGACCTGTCGCAATT
GGCTACGCCGCTCAAGTCGACACCGCCTCTCTCTGGCAGCCGACTGGCTGATCAAGCCATGCTGAAGTTTGTCAG
TCCCTTTGAGGATTGGCATCGTATCAAGGTCGGGGCAGCGGCTCCGACAAGAGAGACCAAGTCTCCGCGCAATAG
CCGCCGTATGGTTGGAGAGGGGGGCAAACTGCTTCGCCTACCATTCGACAATCTACCAGATGGAAACAGCAGCCA
TGAGCTTCAGACACGACATGGAACCCTGGGGGACGACGGCCCCATCAAGCCCTCCAAGAGGTTGCGAATCATTGA
CAATTCACCCAAGCCTCAGCCAAGTCCCTGGCTTCAAAATGTCCTCAAATCGTGGGAGAACCCTGTGTTCGAAAT
AGCACAAGTATCAATTCCAAAGCTGCACGAGGATTTTACAGCCTCCAACACTGGCACATGTAGCCACAGCAGTCG
GCACGTCAATCTCGAAGCGAATTCAATGAGCCTGGCTGGGCGTGTCTCGAAATCTGCCTTGGCTGATGCCGAGGT
GATTGGCCAGGTGGATCGCAAATTTATCCTTGTCAAGTTGCCGCTTGAGAGTGTCGCCAAACGCACCGTTGAAGC
CAATGAAGCAAGAGTTCCGGCCTTGGTCATGGTTGATCAGCATGCTGCTGACGAGCGGTGCAAGCTGGAGGAGCT
GATGGCAGGCTACTTTGAAAGAAAGCCAGCCAATGGCTCGTATGAAGCAGTCGTTGAACCATTAGAGCAGCCCAT
GGTTTTCGAGATGGCCGATCAAGAGGGAGAGATGCTGCAGCGATATCATGGATATTTTGCATCATGGGGTATACA
CTACAGCGTCCAAAGAGGGAGTCGGGAGCAGCCCACGGCCAAGATGTGCATTCTGCAACTACCCACGAGCATTGT
CGAGCGCTGTCGCAGCGAGCCGCGTTTGATGATAGGTCTTGTGCGAAAGGAGATATGGTTGCTCCACGATGAGAG
CAAGACATGTGGCCTACCCTGCACTGGTGATGAGGCTGGTCTGCCACCAAGGTCGCGCTTCCACGGCTGTCCGGC
AGGTATTCTGGACCTTTTGTACTCCCGGTCCTGTCGCAGTAGGCCTGCCCCTAACAAGACACATGACTGATTTGC
GCAACTTGTTGACGGCGGAGTATAGGCGCCATCATGTTCAATGACGAGCTGTCGAGAGAGCAATGCCAGCAGCTG
GTGCGGCAACTGGCCCAGTGCGCATTTCCCTTTCAATGCGCCCATGGTCGACCGAGCATGGTGCCCCTTGCTGAC
CTTGGACCTGGCCACGATGCCGTGTCATGGCAGCTTCGACGTGGTTCGGACCTGTCCATGTGGAAGAAATGGCTG
CAAAGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail