Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3823
Gene name
LocationContig_244:3440..4675
Strand-
Gene length (bp)1235
Transcript length (bp)1059
Coding sequence length (bp)1059
Protein length (aa) 353

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00106 adh_short short chain dehydrogenase 8.2E-11 48 200
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 8.1E-12 54 248

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6RVV4|TIC32_PEA Short-chain dehydrogenase TIC 32, chloroplastic OS=Pisum sativum GN=TIC32 PE=1 SV=1 20 349 6.0E-32
sp|Q9ERI6|RDH14_MOUSE Retinol dehydrogenase 14 OS=Mus musculus GN=Rdh14 PE=1 SV=1 44 347 1.0E-30
sp|A2RVM0|TIC32_ARATH Short-chain dehydrogenase TIC 32, chloroplastic OS=Arabidopsis thaliana GN=TIC32 PE=2 SV=1 21 349 3.0E-30
sp|Q91WL8|WWOX_MOUSE WW domain-containing oxidoreductase OS=Mus musculus GN=Wwox PE=1 SV=1 42 346 4.0E-30
sp|Q9HBH5|RDH14_HUMAN Retinol dehydrogenase 14 OS=Homo sapiens GN=RDH14 PE=1 SV=1 26 347 7.0E-30
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6RVV4|TIC32_PEA Short-chain dehydrogenase TIC 32, chloroplastic OS=Pisum sativum GN=TIC32 PE=1 SV=1 20 349 6.0E-32
sp|Q9ERI6|RDH14_MOUSE Retinol dehydrogenase 14 OS=Mus musculus GN=Rdh14 PE=1 SV=1 44 347 1.0E-30
sp|A2RVM0|TIC32_ARATH Short-chain dehydrogenase TIC 32, chloroplastic OS=Arabidopsis thaliana GN=TIC32 PE=2 SV=1 21 349 3.0E-30
sp|Q91WL8|WWOX_MOUSE WW domain-containing oxidoreductase OS=Mus musculus GN=Wwox PE=1 SV=1 42 346 4.0E-30
sp|Q9HBH5|RDH14_HUMAN Retinol dehydrogenase 14 OS=Homo sapiens GN=RDH14 PE=1 SV=1 26 347 7.0E-30
sp|Q5F389|WWOX_CHICK WW domain-containing oxidoreductase OS=Gallus gallus GN=WWOX PE=2 SV=2 42 350 5.0E-29
sp|Q9NZC7|WWOX_HUMAN WW domain-containing oxidoreductase OS=Homo sapiens GN=WWOX PE=1 SV=1 42 350 3.0E-28
sp|Q5R9W5|WWOX_PONAB WW domain-containing oxidoreductase OS=Pongo abelii GN=WWOX PE=2 SV=1 42 350 4.0E-28
sp|Q8BYK4|RDH12_MOUSE Retinol dehydrogenase 12 OS=Mus musculus GN=Rdh12 PE=2 SV=1 45 347 4.0E-27
sp|Q96NR8|RDH12_HUMAN Retinol dehydrogenase 12 OS=Homo sapiens GN=RDH12 PE=1 SV=3 45 347 1.0E-25
sp|Q9QYF1|RDH11_MOUSE Retinol dehydrogenase 11 OS=Mus musculus GN=Rdh11 PE=1 SV=2 45 347 1.0E-25
sp|O74959|YJCD_SCHPO Uncharacterized oxidoreductase C736.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC736.13 PE=3 SV=1 45 345 2.0E-25
sp|Q8TC12|RDH11_HUMAN Retinol dehydrogenase 11 OS=Homo sapiens GN=RDH11 PE=1 SV=2 45 347 7.0E-25
sp|P59837|RDH12_BOVIN Retinol dehydrogenase 12 OS=Bos taurus GN=RDH12 PE=2 SV=1 47 347 4.0E-24
sp|Q9VLU5|WWOX_DROME WW domain-containing oxidoreductase OS=Drosophila melanogaster GN=Wwox PE=2 SV=1 16 348 3.0E-23
sp|Q803A8|WWOX_DANRE WW domain-containing oxidoreductase OS=Danio rerio GN=wwox PE=2 SV=1 41 348 3.0E-23
sp|Q8NBN7|RDH13_HUMAN Retinol dehydrogenase 13 OS=Homo sapiens GN=RDH13 PE=1 SV=2 45 255 9.0E-22
sp|Q8CEE7|RDH13_MOUSE Retinol dehydrogenase 13 OS=Mus musculus GN=Rdh13 PE=1 SV=1 45 258 1.0E-20
sp|P35320|OXIR_STRLI Probable oxidoreductase OS=Streptomyces lividans PE=3 SV=1 43 339 1.0E-19
sp|Q03326|OXIR_STRAT Probable oxidoreductase OS=Streptomyces antibioticus PE=3 SV=1 43 312 4.0E-19
sp|Q08651|ENV9_YEAST Probable oxidoreductase ENV9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENV9 PE=1 SV=1 75 312 2.0E-18
sp|Q8N5I4|DHRSX_HUMAN Dehydrogenase/reductase SDR family member on chromosome X OS=Homo sapiens GN=DHRSX PE=2 SV=2 76 312 4.0E-18
sp|Q5SS80|DHR13_MOUSE Dehydrogenase/reductase SDR family member 13 OS=Mus musculus GN=Dhrs13 PE=1 SV=1 45 347 2.0E-14
sp|Q17QU7|DHR13_BOVIN Dehydrogenase/reductase SDR family member 13 OS=Bos taurus GN=DHRS13 PE=2 SV=1 45 347 5.0E-13
sp|Q6UX07|DHR13_HUMAN Dehydrogenase/reductase SDR family member 13 OS=Homo sapiens GN=DHRS13 PE=2 SV=1 45 347 6.0E-12
sp|Q42850|PORB_HORVU Protochlorophyllide reductase B, chloroplastic OS=Hordeum vulgare GN=PORB PE=2 SV=1 16 347 2.0E-10
sp|Q8VBZ0|DHRSX_MOUSE Dehydrogenase/reductase SDR family member on chromosome X homolog OS=Mus musculus GN=Dhrsx PE=1 SV=2 47 312 4.0E-10
sp|A0PJE2|DHR12_HUMAN Dehydrogenase/reductase SDR family member 12 OS=Homo sapiens GN=DHRS12 PE=2 SV=2 45 245 3.0E-09
sp|Q53877|DNRU_STRS5 Putative daunorubicin C-13 ketoreductase DnrU OS=Streptomyces sp. (strain C5) PE=3 SV=1 31 347 4.0E-09
sp|Q9ZAU1|DNRU_STRPE Putative daunorubicin C-13 ketoreductase DnrU OS=Streptomyces peucetius GN=dnrU PE=3 SV=1 45 320 7.0E-09
sp|Q8W3D9|PORB_ORYSJ Protochlorophyllide reductase B, chloroplastic OS=Oryza sativa subsp. japonica GN=PORB PE=2 SV=1 32 347 6.0E-08
sp|A6QP05|DHR12_BOVIN Dehydrogenase/reductase SDR family member 12 OS=Bos taurus GN=DHRS12 PE=2 SV=1 45 278 8.0E-08
sp|O88736|DHB7_MOUSE 3-keto-steroid reductase OS=Mus musculus GN=Hsd17b7 PE=1 SV=1 48 247 1.0E-07
sp|Q41578|PORA_WHEAT Protochlorophyllide reductase A, chloroplastic OS=Triticum aestivum GN=PORA PE=3 SV=1 104 347 2.0E-06
sp|Q39617|POR_CHLRE Protochlorophyllide reductase, chloroplastic OS=Chlamydomonas reinhardtii GN=PORA PE=3 SV=1 48 347 4.0E-06
sp|P13653|PORA_HORVU Protochlorophyllide reductase A, chloroplastic OS=Hordeum vulgare GN=PORA PE=1 SV=1 104 347 4.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3823
MVKGYNQEWMGGSKRLQEQAGKMSESGKRPVPTAAEMTAKYGDLIKGKTILTTGVSPASIGAEFVKAVAAASPGL
LILAGRDAGKLKQTQEQILEQHPKTAMRLLLLNLESQAAVRKAADEVKSWDNVPWIDVVVNSAGIMAQPYGVTED
GIERHLGANHIGHFLFVNLIMGKLLAAGEPRIVSVTSDGHRLSAMRWADYNFDEGRTYNRWLAYGQSKTANILFA
VSLAEKLGKRGLRAYSVHPGVIYGTGLGSHLDMSPTGDFAELAALERGQGNAAGWQPFDLISAQQGAATHVYASF
DPDVKRHNGVYLLECRVSDLWTDAVKCWSVNDIEAELLWRLSEKLVGQEFSY*
Coding >OphauB2|3823
ATGGTCAAGGGCTACAATCAAGAATGGATGGGAGGCAGCAAAAGATTGCAAGAGCAGGCAGGCAAAATGTCAGAG
AGTGGAAAGAGGCCAGTCCCCACGGCGGCGGAAATGACGGCCAAGTACGGGGATTTGATCAAGGGCAAGACTATC
CTGACGACAGGAGTGTCACCGGCTAGCATTGGGGCAGAATTTGTCAAGGCGGTGGCAGCAGCATCTCCGGGACTG
CTGATTCTGGCAGGGCGCGACGCGGGCAAGTTGAAGCAGACGCAAGAGCAGATACTGGAGCAGCACCCCAAGACG
GCGATGAGGCTGCTCCTGCTAAACCTGGAATCGCAGGCGGCGGTGCGAAAGGCGGCAGACGAGGTCAAGTCGTGG
GACAATGTGCCATGGATCGACGTGGTGGTGAATAGTGCGGGCATCATGGCGCAGCCGTACGGGGTGACTGAGGAT
GGCATCGAGCGACACTTGGGGGCCAACCACATTGGGCACTTTCTCTTTGTCAACCTCATCATGGGCAAGCTTCTG
GCGGCAGGCGAGCCACGCATCGTGAGCGTTACAAGCGACGGGCATCGGCTCAGCGCCATGCGATGGGCCGACTAC
AACTTTGACGAGGGCCGAACATACAACCGGTGGCTGGCCTATGGACAGTCCAAGACTGCCAATATTCTCTTTGCT
GTGTCGCTGGCTGAAAAGCTGGGCAAAAGAGGCCTGAGGGCATACAGCGTGCATCCAGGCGTCATCTATGGCACC
GGTCTGGGCAGCCACCTCGACATGTCTCCCACTGGCGACTTTGCCGAGTTGGCTGCACTGGAGCGAGGCCAAGGA
AACGCAGCAGGCTGGCAGCCGTTTGATTTGATTTCGGCGCAGCAGGGGGCCGCCACACACGTCTATGCATCCTTT
GACCCTGACGTCAAGAGGCACAATGGCGTCTATCTGCTCGAGTGTAGAGTGTCGGACCTGTGGACCGACGCCGTC
AAGTGCTGGAGCGTCAACGACATTGAAGCCGAGCTGCTGTGGCGCCTCAGTGAGAAGCTGGTGGGCCAGGAGTTT
TCCTACTAG
Transcript >OphauB2|3823
ATGGTCAAGGGCTACAATCAAGAATGGATGGGAGGCAGCAAAAGATTGCAAGAGCAGGCAGGCAAAATGTCAGAG
AGTGGAAAGAGGCCAGTCCCCACGGCGGCGGAAATGACGGCCAAGTACGGGGATTTGATCAAGGGCAAGACTATC
CTGACGACAGGAGTGTCACCGGCTAGCATTGGGGCAGAATTTGTCAAGGCGGTGGCAGCAGCATCTCCGGGACTG
CTGATTCTGGCAGGGCGCGACGCGGGCAAGTTGAAGCAGACGCAAGAGCAGATACTGGAGCAGCACCCCAAGACG
GCGATGAGGCTGCTCCTGCTAAACCTGGAATCGCAGGCGGCGGTGCGAAAGGCGGCAGACGAGGTCAAGTCGTGG
GACAATGTGCCATGGATCGACGTGGTGGTGAATAGTGCGGGCATCATGGCGCAGCCGTACGGGGTGACTGAGGAT
GGCATCGAGCGACACTTGGGGGCCAACCACATTGGGCACTTTCTCTTTGTCAACCTCATCATGGGCAAGCTTCTG
GCGGCAGGCGAGCCACGCATCGTGAGCGTTACAAGCGACGGGCATCGGCTCAGCGCCATGCGATGGGCCGACTAC
AACTTTGACGAGGGCCGAACATACAACCGGTGGCTGGCCTATGGACAGTCCAAGACTGCCAATATTCTCTTTGCT
GTGTCGCTGGCTGAAAAGCTGGGCAAAAGAGGCCTGAGGGCATACAGCGTGCATCCAGGCGTCATCTATGGCACC
GGTCTGGGCAGCCACCTCGACATGTCTCCCACTGGCGACTTTGCCGAGTTGGCTGCACTGGAGCGAGGCCAAGGA
AACGCAGCAGGCTGGCAGCCGTTTGATTTGATTTCGGCGCAGCAGGGGGCCGCCACACACGTCTATGCATCCTTT
GACCCTGACGTCAAGAGGCACAATGGCGTCTATCTGCTCGAGTGTAGAGTGTCGGACCTGTGGACCGACGCCGTC
AAGTGCTGGAGCGTCAACGACATTGAAGCCGAGCTGCTGTGGCGCCTCAGTGAGAAGCTGGTGGGCCAGGAGTTT
TCCTACTAG
Gene >OphauB2|3823
ATGGTCAAGGGCTACAATCAAGAATGGATGGGAGGCAGCAAAAGATTGCAAGAGCAGGCAGGCAAAATGTCAGAG
AGTGGAAAGAGGCCAGTCCCCACGGCGGCGGAAATGACGGCCAAGTACGGGGATTTGATCAAGGGCAAGACTATC
CTGACGACAGGAGTGTCACCGGCTAGCATTGGGGCAGAATTTGTCAAGGCGGTGGCAGCAGCATCTCCGGGACTG
CTGATTCTGGCAGGGCGCGACGCGGGCAAGTTGAAGCAGACGCAAGAGCAGATACTGGAGCAGCACCCCAAGACG
GCGATGAGGCTGCTCCTGCTAAACCTGGAATCGCAGGCGGCGGTGCGAAAGGCGGCAGACGAGGTCAAGTCGTGG
GACAATGTGCCATGGATCGACGTGGTGGTGAATAGTGCGGGCATCATGGCGCAGCCGTACGGGGTGACTGAGGAT
GGCATCGAGCGACACTTGGGGGCCAACCACATTGGGCACTTTCTCTTTGTCAACCTCATCATGGGCAAGCTTCTG
GCGGCAGGCGAGCCACGCATCGTGAGCGTTACAAGCGACGGGCATCGGCTCAGCGCCATGCGATGGGCCGACTAC
AACTTTGACGTGAGGGCTCGCGTGGCTGCGCTGTGTGCGGTGAGCTGACTTGGCTGGATGCAGGAGGGCCGAACA
TACAACCGGTGGCTGGCCTATGGACAGTCCAAGACTGCCAATATTCTCTTTGCTGTGTCGCTGGCTGAAAAGCTG
GGCAAAAGAGGCCTGAGGGCATACAGCGTGCATCCAGGCGTCATCTATGGCACCGGTCTGGGCAGCCACCTCGAC
ATGTCTCCCACTGGCGACTTTGCCGAGTTGGGTATGTCTGCCACGCGGCCCCCGTGTCATGGGTGCTGGGGCCCC
GACTGATTCTACTGGCCTGCAGCTGCACTGGAGCGAGGCCAAGGAAACGCAGCAGGCTGGCAGCCGTTTGATTTG
ATTTCGGCGCAGCAGGGGGCCGCCACACACGTCTATGCATCCTTTGACCCTGACGTCAAGAGTTAGCCATGATGA
AGATGACGACGGGGCTTCTCAAGAGCGCTAATTCCTCTCTAGGGCACAATGGCGTCTATCTGCTCGAGTGTAGAG
TGTCGGACCTGTGGACCGACGCCGTCAAGTGCTGGAGCGTCAACGACATTGAAGCCGAGCTGCTGTGGCGCCTCA
GTGAGAAGCTGGTGGGCCAGGAGTTTTCCTACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail