Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3798
Gene name
LocationContig_240:7343..8552
Strand+
Gene length (bp)1209
Transcript length (bp)1155
Coding sequence length (bp)1155
Protein length (aa) 385

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00494 SQS_PSY Squalene/phytoene synthase 1.0E-56 64 377

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D3ZN43|NDUF6_RAT NADH dehydrogenase (ubiquinone) complex I, assembly factor 6 OS=Rattus norvegicus GN=Ndufaf6 PE=3 SV=1 57 362 4.0E-45
sp|A2AIL4|NDUF6_MOUSE NADH dehydrogenase (ubiquinone) complex I, assembly factor 6 OS=Mus musculus GN=Ndufaf6 PE=1 SV=1 57 362 2.0E-44
sp|A7YVD7|NDUF6_BOVIN NADH dehydrogenase (ubiquinone) complex I, assembly factor 6 OS=Bos taurus GN=NDUFAF6 PE=2 SV=1 56 298 3.0E-42
sp|Q330K2|NDUF6_HUMAN NADH dehydrogenase (ubiquinone) complex I, assembly factor 6 OS=Homo sapiens GN=NDUFAF6 PE=1 SV=2 57 362 3.0E-40
sp|Q9VYS5|NDUF6_DROME NADH dehydrogenase (ubiquinone) complex I, assembly factor 6 homolog OS=Drosophila melanogaster GN=sicily PE=2 SV=1 56 359 1.0E-32
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D3ZN43|NDUF6_RAT NADH dehydrogenase (ubiquinone) complex I, assembly factor 6 OS=Rattus norvegicus GN=Ndufaf6 PE=3 SV=1 57 362 4.0E-45
sp|A2AIL4|NDUF6_MOUSE NADH dehydrogenase (ubiquinone) complex I, assembly factor 6 OS=Mus musculus GN=Ndufaf6 PE=1 SV=1 57 362 2.0E-44
sp|A7YVD7|NDUF6_BOVIN NADH dehydrogenase (ubiquinone) complex I, assembly factor 6 OS=Bos taurus GN=NDUFAF6 PE=2 SV=1 56 298 3.0E-42
sp|Q330K2|NDUF6_HUMAN NADH dehydrogenase (ubiquinone) complex I, assembly factor 6 OS=Homo sapiens GN=NDUFAF6 PE=1 SV=2 57 362 3.0E-40
sp|Q9VYS5|NDUF6_DROME NADH dehydrogenase (ubiquinone) complex I, assembly factor 6 homolog OS=Drosophila melanogaster GN=sicily PE=2 SV=1 56 359 1.0E-32
sp|Q54E48|NDUF6_DICDI NADH dehydrogenase (ubiquinone) complex I, assembly factor 6 homolog OS=Dictyostelium discoideum GN=DDB_G0291852 PE=3 SV=1 57 298 4.0E-22
[Show less]

GO

GO Term Description Terminal node
GO:0009058 biosynthetic process Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3798
MSSIGPLQSMRPWPFQRPLLSMHRPRLVRSGLNRLAFARTKCRHFNTDAHVDSARKYCFAQLYKSDYDAYLIRRL
VPRPVQDTYAALRALNLELVRLPEVISNPTIGAMRITFWQDSIDQTFSDKPPREPICLLLHHGLRALEARAGSAT
KASIKFWISRLIKTRAKYMDNRPFPTMASLEDYAENTYSSIMYATLATLPLRSVHMDHMASHIGKACGITAILRG
IPLLAARAQPIKTPSGIEAPVTHEPHFLLPLEVMAEHGVKEEEVFRQGPAAHGLQDAVFTVATRANDHLLTAKDM
LKRLKEGQDAGHQFEHEGEAQHVYGDTNDSAQDLRHGFGVLLEATSAGHYLENLERANFDPFAVRSGGWRLPWKI
WQALSKERL*
Coding >OphauB2|3798
ATGTCTTCGATTGGCCCGCTGCAGTCCATGAGACCTTGGCCCTTTCAAAGGCCTCTCCTTTCCATGCATCGGCCA
CGACTAGTACGCAGTGGCCTCAACAGGCTCGCCTTTGCTCGCACAAAATGTCGCCACTTCAATACCGATGCTCAT
GTCGATTCGGCCAGGAAATACTGCTTTGCCCAACTCTATAAAAGCGACTACGATGCGTACCTTATCCGCCGCCTC
GTCCCTCGCCCTGTACAAGACACTTATGCCGCTCTTCGCGCATTGAATCTCGAGCTTGTCCGGCTTCCCGAAGTC
ATATCCAACCCAACCATTGGCGCCATGCGCATCACCTTCTGGCAAGACTCAATAGACCAAACATTTTCTGACAAG
CCCCCGCGCGAGCCCATATGCCTACTCCTACATCACGGTCTACGGGCACTCGAAGCCAGAGCTGGTAGCGCGACC
AAAGCATCCATCAAGTTTTGGATCTCGCGTCTCATCAAAACACGCGCCAAATACATGGATAATCGTCCCTTTCCG
ACCATGGCCAGCCTCGAAGACTACGCCGAAAACACTTACTCGTCCATCATGTACGCCACGCTGGCTACCCTGCCG
CTTCGCTCCGTGCACATGGACCACATGGCTAGCCACATTGGCAAGGCCTGTGGAATTACTGCCATTTTACGCGGC
ATTCCGCTTCTCGCTGCTCGTGCTCAGCCTATCAAGACGCCCTCTGGCATAGAAGCACCCGTTACTCATGAACCC
CATTTCCTTCTTCCCCTTGAAGTCATGGCCGAACACGGCGTCAAAGAGGAGGAGGTTTTTCGGCAGGGTCCTGCC
GCACATGGCCTTCAAGACGCCGTCTTCACTGTTGCAACACGTGCCAACGACCACCTTTTGACGGCCAAGGACATG
TTGAAGCGATTAAAAGAGGGCCAAGACGCCGGGCACCAGTTTGAACACGAGGGCGAAGCGCAACACGTCTATGGC
GACACAAACGACTCGGCGCAAGATCTGCGGCACGGTTTTGGCGTCTTGCTAGAAGCCACATCTGCAGGCCATTAT
CTCGAAAACTTGGAACGCGCCAACTTTGATCCTTTTGCTGTCAGAAGCGGCGGTTGGAGACTGCCGTGGAAAATA
TGGCAAGCCCTTTCTAAAGAGCGGTTATGA
Transcript >OphauB2|3798
ATGTCTTCGATTGGCCCGCTGCAGTCCATGAGACCTTGGCCCTTTCAAAGGCCTCTCCTTTCCATGCATCGGCCA
CGACTAGTACGCAGTGGCCTCAACAGGCTCGCCTTTGCTCGCACAAAATGTCGCCACTTCAATACCGATGCTCAT
GTCGATTCGGCCAGGAAATACTGCTTTGCCCAACTCTATAAAAGCGACTACGATGCGTACCTTATCCGCCGCCTC
GTCCCTCGCCCTGTACAAGACACTTATGCCGCTCTTCGCGCATTGAATCTCGAGCTTGTCCGGCTTCCCGAAGTC
ATATCCAACCCAACCATTGGCGCCATGCGCATCACCTTCTGGCAAGACTCAATAGACCAAACATTTTCTGACAAG
CCCCCGCGCGAGCCCATATGCCTACTCCTACATCACGGTCTACGGGCACTCGAAGCCAGAGCTGGTAGCGCGACC
AAAGCATCCATCAAGTTTTGGATCTCGCGTCTCATCAAAACACGCGCCAAATACATGGATAATCGTCCCTTTCCG
ACCATGGCCAGCCTCGAAGACTACGCCGAAAACACTTACTCGTCCATCATGTACGCCACGCTGGCTACCCTGCCG
CTTCGCTCCGTGCACATGGACCACATGGCTAGCCACATTGGCAAGGCCTGTGGAATTACTGCCATTTTACGCGGC
ATTCCGCTTCTCGCTGCTCGTGCTCAGCCTATCAAGACGCCCTCTGGCATAGAAGCACCCGTTACTCATGAACCC
CATTTCCTTCTTCCCCTTGAAGTCATGGCCGAACACGGCGTCAAAGAGGAGGAGGTTTTTCGGCAGGGTCCTGCC
GCACATGGCCTTCAAGACGCCGTCTTCACTGTTGCAACACGTGCCAACGACCACCTTTTGACGGCCAAGGACATG
TTGAAGCGATTAAAAGAGGGCCAAGACGCCGGGCACCAGTTTGAACACGAGGGCGAAGCGCAACACGTCTATGGC
GACACAAACGACTCGGCGCAAGATCTGCGGCACGGTTTTGGCGTCTTGCTAGAAGCCACATCTGCAGGCCATTAT
CTCGAAAACTTGGAACGCGCCAACTTTGATCCTTTTGCTGTCAGAAGCGGCGGTTGGAGACTGCCGTGGAAAATA
TGGCAAGCCCTTTCTAAAGAGCGGTTATGA
Gene >OphauB2|3798
ATGTCTTCGATTGGCCCGCTGCAGTCCATGAGACCTTGGCCCTTTCAAAGGCCTCTCCTTTCCATGCATCGGCCA
CGACTAGTACGCAGTGGCCTCAACAGGCTCGCCTTTGCTCGCACAAAATGTCGCCACTTCAATACCGATGCTCAT
GTCGATTCGGCCAGGAAATACTGCTTTGCCCAACTCTAGTCAGTCCTGGTACTGGCCTCTCGCCAAGCGCGTTAT
CCCTGACTGCAGAACAGTAAAAGCGACTACGATGCGTACCTTATCCGCCGCCTCGTCCCTCGCCCTGTACAAGAC
ACTTATGCCGCTCTTCGCGCATTGAATCTCGAGCTTGTCCGGCTTCCCGAAGTCATATCCAACCCAACCATTGGC
GCCATGCGCATCACCTTCTGGCAAGACTCAATAGACCAAACATTTTCTGACAAGCCCCCGCGCGAGCCCATATGC
CTACTCCTACATCACGGTCTACGGGCACTCGAAGCCAGAGCTGGTAGCGCGACCAAAGCATCCATCAAGTTTTGG
ATCTCGCGTCTCATCAAAACACGCGCCAAATACATGGATAATCGTCCCTTTCCGACCATGGCCAGCCTCGAAGAC
TACGCCGAAAACACTTACTCGTCCATCATGTACGCCACGCTGGCTACCCTGCCGCTTCGCTCCGTGCACATGGAC
CACATGGCTAGCCACATTGGCAAGGCCTGTGGAATTACTGCCATTTTACGCGGCATTCCGCTTCTCGCTGCTCGT
GCTCAGCCTATCAAGACGCCCTCTGGCATAGAAGCACCCGTTACTCATGAACCCCATTTCCTTCTTCCCCTTGAA
GTCATGGCCGAACACGGCGTCAAAGAGGAGGAGGTTTTTCGGCAGGGTCCTGCCGCACATGGCCTTCAAGACGCC
GTCTTCACTGTTGCAACACGTGCCAACGACCACCTTTTGACGGCCAAGGACATGTTGAAGCGATTAAAAGAGGGC
CAAGACGCCGGGCACCAGTTTGAACACGAGGGCGAAGCGCAACACGTCTATGGCGACACAAACGACTCGGCGCAA
GATCTGCGGCACGGTTTTGGCGTCTTGCTAGAAGCCACATCTGCAGGCCATTATCTCGAAAACTTGGAACGCGCC
AACTTTGATCCTTTTGCTGTCAGAAGCGGCGGTTGGAGACTGCCGTGGAAAATATGGCAAGCCCTTTCTAAAGAG
CGGTTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail