Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3797
Gene name
LocationContig_240:3372..6974
Strand-
Gene length (bp)3602
Transcript length (bp)3429
Coding sequence length (bp)3429
Protein length (aa) 1143

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00176 SNF2-rel_dom SNF2-related domain 2.6E-69 429 821
PF08797 HIRAN HIRAN domain 7.1E-25 169 285
PF00271 Helicase_C Helicase conserved C-terminal domain 3.1E-13 984 1087
PF04851 ResIII Type III restriction enzyme, res subunit 1.0E-05 424 686

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IJ84|RAD5_GIBZE DNA repair protein RAD5 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=RAD5 PE=3 SV=1 9 1142 0.0E+00
sp|Q7S1P9|RAD5_NEUCR DNA repair protein rad5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mus-41 PE=3 SV=3 12 1142 0.0E+00
sp|Q4WVM1|RAD5_ASPFU DNA repair protein rad5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rad5 PE=3 SV=2 27 1141 0.0E+00
sp|Q5BHD6|RAD5_EMENI DNA repair protein rad5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rad5 PE=3 SV=1 9 1124 0.0E+00
sp|P36607|RAD5_SCHPO DNA repair protein rad8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rad8 PE=1 SV=1 167 1141 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IJ84|RAD5_GIBZE DNA repair protein RAD5 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=RAD5 PE=3 SV=1 9 1142 0.0E+00
sp|Q7S1P9|RAD5_NEUCR DNA repair protein rad5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mus-41 PE=3 SV=3 12 1142 0.0E+00
sp|Q4WVM1|RAD5_ASPFU DNA repair protein rad5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rad5 PE=3 SV=2 27 1141 0.0E+00
sp|Q5BHD6|RAD5_EMENI DNA repair protein rad5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rad5 PE=3 SV=1 9 1124 0.0E+00
sp|P36607|RAD5_SCHPO DNA repair protein rad8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rad8 PE=1 SV=1 167 1141 0.0E+00
sp|P0CQ66|RAD5_CRYNJ DNA repair protein RAD5 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RAD5 PE=3 SV=1 168 1141 0.0E+00
sp|Q6BIP2|RAD5_DEBHA DNA repair protein RAD5 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RAD5 PE=3 SV=2 166 1141 0.0E+00
sp|P0CQ67|RAD5_CRYNB DNA repair protein RAD5 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RAD5 PE=3 SV=1 168 1141 0.0E+00
sp|Q6C2R8|RAD5_YARLI DNA repair protein RAD5 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RAD5 PE=3 SV=1 62 1141 0.0E+00
sp|Q4PGG5|RAD5_USTMA DNA repair protein RAD5 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=RAD5 PE=3 SV=1 154 1117 0.0E+00
sp|P32849|RAD5_YEAST DNA repair protein RAD5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD5 PE=1 SV=1 115 1141 1.0E-173
sp|Q5ACX1|RAD5_CANAL DNA repair protein RAD5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RAD5 PE=3 SV=1 167 1118 3.0E-173
sp|Q6CJM4|RAD5_KLULA DNA repair protein RAD5 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RAD5 PE=3 SV=1 166 1141 1.0E-168
sp|Q6FY76|RAD5_CANGA DNA repair protein RAD5 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RAD5 PE=3 SV=1 167 1141 6.0E-166
sp|Q753V5|RAD5_ASHGO DNA repair protein RAD5 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RAD5 PE=3 SV=2 105 1128 8.0E-158
sp|Q9FNI6|SM3L2_ARATH Putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 2 OS=Arabidopsis thaliana GN=At5g22750 PE=2 SV=1 168 1142 7.0E-157
sp|Q9FIY7|SM3L3_ARATH Putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 3 OS=Arabidopsis thaliana GN=At5g43530 PE=3 SV=1 221 1141 2.0E-155
sp|Q9FF61|SM3L1_ARATH Putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 1 OS=Arabidopsis thaliana GN=At5g05130 PE=2 SV=1 418 1142 1.0E-96
sp|Q95216|HLTF_RABIT Helicase-like transcription factor OS=Oryctolagus cuniculus GN=HLTF PE=1 SV=1 526 1141 7.0E-91
sp|Q14527|HLTF_HUMAN Helicase-like transcription factor OS=Homo sapiens GN=HLTF PE=1 SV=2 559 1141 6.0E-90
sp|Q6PCN7|HLTF_MOUSE Helicase-like transcription factor OS=Mus musculus GN=Hltf PE=1 SV=1 562 1141 8.0E-90
sp|P31244|RAD16_YEAST DNA repair protein RAD16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD16 PE=1 SV=1 502 1114 4.0E-85
sp|Q10332|YBMA_SCHPO Uncharacterized ATP-dependent helicase C582.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC582.10c PE=1 SV=1 502 1118 4.0E-85
sp|P79051|RHP16_SCHPO ATP-dependent helicase rhp16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp16 PE=3 SV=2 448 1142 2.0E-80
sp|O13762|YF2C_SCHPO Uncharacterized ATP-dependent helicase C17A2.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17A2.12 PE=3 SV=1 496 1141 3.0E-78
sp|O60177|YG42_SCHPO Uncharacterized ATP-dependent helicase C23E6.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC23E6.02 PE=3 SV=1 495 1140 2.0E-73
sp|Q94BR5|CHR28_ARATH Helicase-like transcription factor CHR28 OS=Arabidopsis thaliana GN=CHR28 PE=1 SV=1 499 1122 6.0E-71
sp|Q08562|ULS1_YEAST ATP-dependent helicase ULS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ULS1 PE=1 SV=1 502 1120 9.0E-67
sp|Q9LHE4|CHR27_ARATH Helicase-like transcription factor CHR27 OS=Arabidopsis thaliana GN=CHR27 PE=1 SV=1 499 1122 5.0E-65
sp|Q5NC05|TTF2_MOUSE Transcription termination factor 2 OS=Mus musculus GN=Ttf2 PE=1 SV=2 502 824 5.0E-41
sp|Q9UNY4|TTF2_HUMAN Transcription termination factor 2 OS=Homo sapiens GN=TTF2 PE=1 SV=2 502 824 2.0E-39
sp|P34739|TTF2_DROME Transcription termination factor 2 OS=Drosophila melanogaster GN=lds PE=1 SV=2 502 842 6.0E-34
sp|P41447|GTA_NPVAC Probable global transactivator OS=Autographa californica nuclear polyhedrosis virus GN=GTA PE=3 SV=1 502 821 1.0E-30
sp|O10302|GTA_NPVOP Probable global transactivator OS=Orgyia pseudotsugata multicapsid polyhedrosis virus GN=GTA PE=3 SV=1 502 823 2.0E-30
sp|Q5NC05|TTF2_MOUSE Transcription termination factor 2 OS=Mus musculus GN=Ttf2 PE=1 SV=2 971 1118 5.0E-27
sp|Q9UNY4|TTF2_HUMAN Transcription termination factor 2 OS=Homo sapiens GN=TTF2 PE=1 SV=2 966 1141 2.0E-26
sp|Q4P328|SWR1_USTMA Helicase SWR1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SWR1 PE=3 SV=1 501 828 9.0E-26
sp|Q8TD26|CHD6_HUMAN Chromodomain-helicase-DNA-binding protein 6 OS=Homo sapiens GN=CHD6 PE=1 SV=4 504 826 5.0E-24
sp|A3KFM7|CHD6_MOUSE Chromodomain-helicase-DNA-binding protein 6 OS=Mus musculus GN=Chd6 PE=1 SV=1 504 826 5.0E-24
sp|D3ZA12|CHD6_RAT Chromodomain-helicase-DNA-binding protein 6 OS=Rattus norvegicus GN=Chd6 PE=1 SV=2 504 826 8.0E-24
sp|P94593|YWQA_BACSU Uncharacterized ATP-dependent helicase YwqA OS=Bacillus subtilis (strain 168) GN=ywqA PE=3 SV=2 501 826 1.0E-23
sp|B0R0I6|CHD8_DANRE Chromodomain-helicase-DNA-binding protein 8 OS=Danio rerio GN=chd8 PE=3 SV=2 498 854 2.0E-23
sp|B5DE69|CHD8_XENTR Chromodomain-helicase-DNA-binding protein 8 OS=Xenopus tropicalis GN=chd8 PE=2 SV=2 498 838 2.0E-23
sp|P32333|MOT1_YEAST TATA-binding protein-associated factor MOT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MOT1 PE=1 SV=1 498 995 3.0E-23
sp|Q3L8U1|CHD9_HUMAN Chromodomain-helicase-DNA-binding protein 9 OS=Homo sapiens GN=CHD9 PE=1 SV=2 504 854 3.0E-23
sp|P47264|Y018_MYCGE Uncharacterized ATP-dependent helicase MG018 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG018 PE=3 SV=3 992 1115 4.0E-23
sp|Q8BYH8|CHD9_MOUSE Chromodomain-helicase-DNA-binding protein 9 OS=Mus musculus GN=Chd9 PE=1 SV=2 504 854 5.0E-23
sp|Q9HCK8|CHD8_HUMAN Chromodomain-helicase-DNA-binding protein 8 OS=Homo sapiens GN=CHD8 PE=1 SV=5 498 854 6.0E-23
sp|Q09XV5|CHD8_MOUSE Chromodomain-helicase-DNA-binding protein 8 OS=Mus musculus GN=Chd8 PE=1 SV=1 498 854 7.0E-23
sp|Q9JIX5|CHD8_RAT Chromodomain-helicase-DNA-binding protein 8 OS=Rattus norvegicus GN=Chd8 PE=1 SV=2 498 854 8.0E-23
sp|Q9NEL2|SSL1_CAEEL Helicase ssl-1 OS=Caenorhabditis elegans GN=ssl-1 PE=2 SV=4 501 829 9.0E-23
sp|P75093|Y020_MYCPN Uncharacterized ATP-dependent helicase MPN_020 OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_020 PE=3 SV=1 917 1121 1.0E-22
sp|O13682|SWR1_SCHPO Helicase swr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swr1 PE=3 SV=1 502 829 1.0E-22
sp|Q9M1I1|FB304_ARATH F-box protein At3g54460 OS=Arabidopsis thaliana GN=At3g54460 PE=2 SV=1 562 1112 2.0E-22
sp|P0CO18|SWR1_CRYNJ Helicase SWR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SWR1 PE=3 SV=1 501 825 2.0E-22
sp|P0CO19|SWR1_CRYNB Helicase SWR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SWR1 PE=3 SV=1 501 825 2.0E-22
sp|Q149N8|SHPRH_HUMAN E3 ubiquitin-protein ligase SHPRH OS=Homo sapiens GN=SHPRH PE=1 SV=2 562 823 3.0E-22
sp|Q29KH2|RAD54_DROPS DNA repair and recombination protein RAD54-like OS=Drosophila pseudoobscura pseudoobscura GN=okr PE=3 SV=2 952 1142 2.0E-21
sp|B0R061|SMRDA_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1A OS=Danio rerio GN=smarcad1a PE=3 SV=1 498 823 2.0E-21
sp|B4GS98|RAD54_DROPE DNA repair and recombination protein RAD54-like OS=Drosophila persimilis GN=okr PE=3 SV=1 952 1142 2.0E-21
sp|Q4WAS9|SWR1_ASPFU Helicase swr1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=swr1 PE=3 SV=1 501 827 2.0E-21
sp|Q7TPQ3|SHPRH_MOUSE E3 ubiquitin-protein ligase SHPRH OS=Mus musculus GN=Shprh PE=1 SV=1 562 823 2.0E-21
sp|Q91ZW3|SMCA5_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Mus musculus GN=Smarca5 PE=1 SV=1 498 821 3.0E-21
sp|G5EDG2|SMRCD_CAEEL SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 homolog OS=Caenorhabditis elegans GN=M03C11.8 PE=3 SV=1 501 824 3.0E-21
sp|B4M9A8|RAD54_DROVI DNA repair and recombination protein RAD54-like OS=Drosophila virilis GN=okr PE=3 SV=1 952 1141 3.0E-21
sp|A6QQR4|ERC6L_BOVIN DNA excision repair protein ERCC-6-like OS=Bos taurus GN=ERCC6L PE=2 SV=1 926 1111 3.0E-21
sp|Q5ARK3|SWR1_EMENI Helicase swr1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=swr1 PE=3 SV=2 501 827 3.0E-21
sp|E7F1C4|SMRDB_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1B OS=Danio rerio GN=smarcad1b PE=3 SV=1 971 1114 3.0E-21
sp|B4KHL5|RAD54_DROMO DNA repair and recombination protein RAD54-like OS=Drosophila mojavensis GN=okr PE=3 SV=1 940 1142 5.0E-21
sp|O76460|RAD54_DROME DNA repair and recombination protein RAD54-like OS=Drosophila melanogaster GN=okr PE=1 SV=1 969 1142 5.0E-21
sp|P43610|IRC5_YEAST Uncharacterized ATP-dependent helicase IRC5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRC5 PE=1 SV=2 498 778 6.0E-21
sp|O60264|SMCA5_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Homo sapiens GN=SMARCA5 PE=1 SV=1 498 821 7.0E-21
sp|B3NAN8|RAD54_DROER DNA repair and recombination protein RAD54-like OS=Drosophila erecta GN=okr PE=3 SV=1 940 1142 7.0E-21
sp|Q9P2D1|CHD7_HUMAN Chromodomain-helicase-DNA-binding protein 7 OS=Homo sapiens GN=CHD7 PE=1 SV=3 504 826 9.0E-21
sp|A2AJK6|CHD7_MOUSE Chromodomain-helicase-DNA-binding protein 7 OS=Mus musculus GN=Chd7 PE=1 SV=1 504 826 9.0E-21
sp|Q4P328|SWR1_USTMA Helicase SWR1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SWR1 PE=3 SV=1 990 1117 1.0E-20
sp|P0CO18|SWR1_CRYNJ Helicase SWR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SWR1 PE=3 SV=1 972 1117 1.0E-20
sp|P0CO19|SWR1_CRYNB Helicase SWR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SWR1 PE=3 SV=1 972 1117 1.0E-20
sp|C0H4W3|HEPF1_PLAF7 Probable ATP-dependent helicase PF08_0048 OS=Plasmodium falciparum (isolate 3D7) GN=PF08_0048 PE=3 SV=1 971 1115 1.0E-20
sp|Q9NDJ2|DOM_DROME Helicase domino OS=Drosophila melanogaster GN=dom PE=1 SV=2 501 851 1.0E-20
sp|B4NXB8|RAD54_DROYA DNA repair and recombination protein RAD54-like OS=Drosophila yakuba GN=okr PE=3 SV=2 969 1142 1.0E-20
sp|B4JCS7|RAD54_DROGR DNA repair and recombination protein RAD54-like OS=Drosophila grimshawi GN=okr PE=3 SV=1 952 1142 1.0E-20
sp|Q9S775|PKL_ARATH CHD3-type chromatin-remodeling factor PICKLE OS=Arabidopsis thaliana GN=PKL PE=1 SV=1 464 834 1.0E-20
sp|Q2NKX8|ERC6L_HUMAN DNA excision repair protein ERCC-6-like OS=Homo sapiens GN=ERCC6L PE=1 SV=1 969 1111 2.0E-20
sp|Q03468|ERCC6_HUMAN DNA excision repair protein ERCC-6 OS=Homo sapiens GN=ERCC6 PE=1 SV=1 497 821 2.0E-20
sp|Q4IAK7|SWR1_GIBZE Helicase SWR1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SWR1 PE=3 SV=1 499 828 2.0E-20
sp|Q06A37|CHD7_CHICK Chromodomain-helicase-DNA-binding protein 7 OS=Gallus gallus GN=CHD7 PE=2 SV=1 504 826 2.0E-20
sp|Q8BHK9|ERC6L_MOUSE DNA excision repair protein ERCC-6-like OS=Mus musculus GN=Ercc6l PE=1 SV=1 969 1142 2.0E-20
sp|B4MX21|RAD54_DROWI DNA repair and recombination protein RAD54-like OS=Drosophila willistoni GN=okr PE=3 SV=1 940 1142 3.0E-20
sp|A2BGR3|ERC6L_DANRE DNA excision repair protein ERCC-6-like OS=Danio rerio GN=ercc6l PE=1 SV=1 502 828 3.0E-20
sp|B3MMA5|RAD54_DROAN DNA repair and recombination protein RAD54-like OS=Drosophila ananassae GN=okr PE=3 SV=1 969 1142 4.0E-20
sp|A6ZU34|INO80_YEAS7 Putative DNA helicase INO80 OS=Saccharomyces cerevisiae (strain YJM789) GN=INO80 PE=3 SV=1 971 1135 5.0E-20
sp|P38144|ISW1_YEAST ISWI chromatin-remodeling complex ATPase ISW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ISW1 PE=1 SV=2 457 821 5.0E-20
sp|P53115|INO80_YEAST Putative DNA helicase INO80 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=INO80 PE=1 SV=1 971 1135 5.0E-20
sp|Q6PGB8|SMCA1_MOUSE Probable global transcription activator SNF2L1 OS=Mus musculus GN=Smarca1 PE=1 SV=1 498 821 6.0E-20
sp|P28370|SMCA1_HUMAN Probable global transcription activator SNF2L1 OS=Homo sapiens GN=SMARCA1 PE=1 SV=2 498 821 6.0E-20
sp|P34739|TTF2_DROME Transcription termination factor 2 OS=Drosophila melanogaster GN=lds PE=1 SV=2 971 1141 7.0E-20
sp|A7TJI3|INO80_VANPO Putative DNA helicase INO80 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=INO80 PE=3 SV=1 971 1107 8.0E-20
sp|Q6CJ38|SWR1_KLULA Helicase SWR1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SWR1 PE=3 SV=1 502 829 9.0E-20
sp|A2BGR3|ERC6L_DANRE DNA excision repair protein ERCC-6-like OS=Danio rerio GN=ercc6l PE=1 SV=1 969 1111 1.0E-19
sp|Q8RWY3|ISW2_ARATH ISWI chromatin-remodeling complex ATPase CHR11 OS=Arabidopsis thaliana GN=CHR11 PE=1 SV=4 498 826 1.0E-19
sp|O14148|INO80_SCHPO Putative DNA helicase ino80 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ino80 PE=1 SV=4 972 1115 1.0E-19
sp|P41877|ISW1_CAEEL Chromatin-remodeling complex ATPase chain isw-1 OS=Caenorhabditis elegans GN=isw-1 PE=1 SV=2 463 821 1.0E-19
sp|P31380|FUN30_YEAST ATP-dependent helicase FUN30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FUN30 PE=1 SV=1 498 824 1.0E-19
sp|Q6ZRS2|SRCAP_HUMAN Helicase SRCAP OS=Homo sapiens GN=SRCAP PE=1 SV=3 501 829 1.0E-19
sp|Q9VDY1|INO80_DROME Putative DNA helicase Ino80 OS=Drosophila melanogaster GN=Ino80 PE=1 SV=2 990 1109 1.0E-19
sp|O94421|SNF22_SCHPO SWI/SNF chromatin-remodeling complex subunit snf22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snf22 PE=1 SV=2 990 1108 1.0E-19
sp|Q7X9V2|PIE1_ARATH Protein PHOTOPERIOD-INDEPENDENT EARLY FLOWERING 1 OS=Arabidopsis thaliana GN=PIE1 PE=1 SV=1 501 858 2.0E-19
sp|Q9ULG1|INO80_HUMAN DNA helicase INO80 OS=Homo sapiens GN=INO80 PE=1 SV=2 971 1117 2.0E-19
sp|O74842|FFT2_SCHPO ATP-dependent helicase fft2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fft2 PE=1 SV=1 971 1126 2.0E-19
sp|A4IHD2|ARIP4_XENTR Helicase ARIP4 OS=Xenopus tropicalis GN=rad54l2 PE=2 SV=1 652 1118 2.0E-19
sp|Q6FV37|INO80_CANGA Putative DNA helicase INO80 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=INO80 PE=3 SV=1 971 1107 2.0E-19
sp|Q8RXS6|INO80_ARATH DNA helicase INO80 OS=Arabidopsis thaliana GN=INO80 PE=2 SV=2 971 1117 2.0E-19
sp|B5BT18|BTAF1_ARATH TATA-binding protein-associated factor BTAF1 OS=Arabidopsis thaliana GN=BTAF1 PE=1 SV=1 501 850 2.0E-19
sp|O14647|CHD2_HUMAN Chromodomain-helicase-DNA-binding protein 2 OS=Homo sapiens GN=CHD2 PE=1 SV=2 504 835 2.0E-19
sp|C7GQI8|RDH54_YEAS2 DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain JAY291) GN=RDH54 PE=3 SV=1 970 1142 2.0E-19
sp|O42861|FFT3_SCHPO ATP-dependent helicase fft3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fft3 PE=1 SV=1 501 823 2.0E-19
sp|Q8BHK9|ERC6L_MOUSE DNA excision repair protein ERCC-6-like OS=Mus musculus GN=Ercc6l PE=1 SV=1 502 825 3.0E-19
sp|G5EBZ4|LE418_CAEEL Protein let-418 OS=Caenorhabditis elegans GN=let-418 PE=1 SV=1 498 841 3.0E-19
sp|Q7S133|SWR1_NEUCR Helicase swr-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=crf1-1 PE=3 SV=1 502 828 3.0E-19
sp|A6ZL17|RDH54_YEAS7 DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain YJM789) GN=RDH54 PE=3 SV=1 970 1142 3.0E-19
sp|B5VE38|RDH54_YEAS6 DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=RDH54 PE=3 SV=1 970 1142 3.0E-19
sp|B3LN76|RDH54_YEAS1 DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=RDH54 PE=3 SV=1 970 1142 3.0E-19
sp|Q6ZPV2|INO80_MOUSE DNA helicase INO80 OS=Mus musculus GN=Ino80 PE=1 SV=2 971 1117 3.0E-19
sp|Q7G8Y3|ISW2_ORYSJ Probable chromatin-remodeling complex ATPase chain OS=Oryza sativa subsp. japonica GN=Os01g0367900 PE=2 SV=2 498 826 3.0E-19
sp|Q74Z27|INO80_ASHGO Putative DNA helicase INO80 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=INO80 PE=3 SV=2 973 1134 3.0E-19
sp|P38086|RDH54_YEAST DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RDH54 PE=1 SV=4 970 1142 3.0E-19
sp|Q59KI4|INO80_CANAL Putative DNA helicase INO80 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=INO80 PE=3 SV=1 971 1124 3.0E-19
sp|Q6BKC2|SWR1_DEBHA Helicase SWR1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SWR1 PE=3 SV=2 502 843 3.0E-19
sp|O14981|BTAF1_HUMAN TATA-binding protein-associated factor 172 OS=Homo sapiens GN=BTAF1 PE=1 SV=2 501 822 4.0E-19
sp|E9PZM4|CHD2_MOUSE Chromodomain-helicase-DNA-binding protein 2 OS=Mus musculus GN=Chd2 PE=1 SV=1 504 835 4.0E-19
sp|Q04692|SMRCD_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Mus musculus GN=Smarcad1 PE=1 SV=2 498 823 4.0E-19
sp|Q6CNY4|INO80_KLULA Putative DNA helicase INO80 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=INO80 PE=3 SV=1 971 1139 5.0E-19
sp|F4JY24|CHR17_ARATH ISWI chromatin-remodeling complex ATPase CHR17 OS=Arabidopsis thaliana GN=CHR17 PE=1 SV=1 498 826 5.0E-19
sp|D3Z9Z9|SMRCD_RAT SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Rattus norvegicus GN=Smarcad1 PE=1 SV=1 498 823 6.0E-19
sp|Q04692|SMRCD_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Mus musculus GN=Smarcad1 PE=1 SV=2 971 1114 7.0E-19
sp|P87114|FFT1_SCHPO ATP-dependent helicase fft1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fft1 PE=3 SV=1 971 1129 7.0E-19
sp|Q9P793|MIT1_SCHPO Chromatin remodeling factor mit1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mit1 PE=1 SV=1 952 1134 7.0E-19
sp|Q8W103|CHR24_ARATH Protein CHROMATIN REMODELING 24 OS=Arabidopsis thaliana GN=CHR24 PE=2 SV=1 502 861 8.0E-19
sp|Q872I5|INO80_NEUCR Putative DNA helicase ino80 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=crf2-1 PE=3 SV=3 971 1107 8.0E-19
sp|Q59U81|SWR1_CANAL Helicase SWR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SWR1 PE=3 SV=1 502 829 9.0E-19
sp|D3Z9Z9|SMRCD_RAT SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Rattus norvegicus GN=Smarcad1 PE=1 SV=1 987 1114 1.0E-18
sp|E1B7X9|SMRCD_BOVIN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Bos taurus GN=SMARCAD1 PE=3 SV=2 498 823 1.0E-18
sp|Q9UTL9|YIV5_SCHPO Uncharacterized ATP-dependent helicase C144.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC144.05 PE=3 SV=1 879 1123 1.0E-18
sp|A7EQA8|INO80_SCLS1 Putative DNA helicase INO80 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=INO80 PE=3 SV=1 972 1107 1.0E-18
sp|D3ZD32|CHD5_RAT Chromodomain-helicase-DNA-binding protein 5 OS=Rattus norvegicus GN=Chd5 PE=1 SV=1 969 1137 1.0E-18
sp|Q1DUF9|INO80_COCIM Putative DNA helicase INO80 OS=Coccidioides immitis (strain RS) GN=INO80 PE=3 SV=1 971 1107 1.0E-18
sp|F4JTF6|CHR7_ARATH CHD3-type chromatin-remodeling factor CHR7 OS=Arabidopsis thaliana GN=CHR7 PE=2 SV=1 504 826 1.0E-18
sp|Q8TDI0|CHD5_HUMAN Chromodomain-helicase-DNA-binding protein 5 OS=Homo sapiens GN=CHD5 PE=1 SV=1 969 1137 1.0E-18
sp|E1B7X9|SMRCD_BOVIN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Bos taurus GN=SMARCAD1 PE=3 SV=2 987 1114 2.0E-18
sp|F4IV99|CHR5_ARATH Protein CHROMATIN REMODELING 5 OS=Arabidopsis thaliana GN=CHR5 PE=3 SV=1 504 841 2.0E-18
sp|Q759G7|SWR1_ASHGO Helicase SWR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SWR1 PE=3 SV=2 502 829 2.0E-18
sp|Q9UR24|RHP26_SCHPO DNA repair protein rhp26 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp26 PE=3 SV=1 966 1142 2.0E-18
sp|A2A8L1|CHD5_MOUSE Chromodomain-helicase-DNA-binding protein 5 OS=Mus musculus GN=Chd5 PE=1 SV=1 969 1137 2.0E-18
sp|Q5FWR0|SMRCD_XENTR SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Xenopus tropicalis GN=smarcad1 PE=2 SV=1 989 1114 2.0E-18
sp|Q9H4L7|SMRCD_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Homo sapiens GN=SMARCAD1 PE=1 SV=2 987 1114 2.0E-18
sp|A5E0W5|INO80_LODEL Putative DNA helicase ino80 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=INO80 PE=3 SV=1 971 1107 2.0E-18
sp|Q5BAZ5|INO80_EMENI Putative DNA helicase ino80 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ino80 PE=3 SV=1 971 1107 2.0E-18
sp|P40352|RAD26_YEAST DNA repair and recombination protein RAD26 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD26 PE=1 SV=1 874 1142 2.0E-18
sp|F4J9M5|CHR12_ARATH Probable ATP-dependent DNA helicase CHR12 OS=Arabidopsis thaliana GN=CHR12 PE=2 SV=1 501 821 2.0E-18
sp|Q9UTN6|SNF21_SCHPO Chromatin structure-remodeling complex subunit snf21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snf21 PE=1 SV=1 501 830 2.0E-18
sp|Q22516|CHD3_CAEEL Chromodomain-helicase-DNA-binding protein 3 homolog OS=Caenorhabditis elegans GN=chd-3 PE=2 SV=2 498 821 2.0E-18
sp|Q4IL82|INO80_GIBZE Putative DNA helicase INO80 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=INO80 PE=3 SV=1 961 1107 2.0E-18
sp|B0R061|SMRDA_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1A OS=Danio rerio GN=smarcad1a PE=3 SV=1 971 1141 3.0E-18
sp|Q12873|CHD3_HUMAN Chromodomain-helicase-DNA-binding protein 3 OS=Homo sapiens GN=CHD3 PE=1 SV=3 969 1128 3.0E-18
sp|P0CO16|INO80_CRYNJ Putative DNA helicase INO80 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=INO80 PE=3 SV=1 498 829 3.0E-18
sp|P0CO17|INO80_CRYNB Putative DNA helicase INO80 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=INO80 PE=3 SV=1 498 829 3.0E-18
sp|A1C9W6|INO80_ASPCL Putative DNA helicase ino80 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ino80 PE=3 SV=1 971 1107 3.0E-18
sp|O14646|CHD1_HUMAN Chromodomain-helicase-DNA-binding protein 1 OS=Homo sapiens GN=CHD1 PE=1 SV=2 500 834 3.0E-18
sp|E7F1C4|SMRDB_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1B OS=Danio rerio GN=smarcad1b PE=3 SV=1 478 823 4.0E-18
sp|Q9H4L7|SMRCD_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Homo sapiens GN=SMARCAD1 PE=1 SV=2 498 823 4.0E-18
sp|O16102|CHD3_DROME Chromodomain-helicase-DNA-binding protein 3 OS=Drosophila melanogaster GN=Chd3 PE=2 SV=3 849 1118 4.0E-18
sp|P40201|CHD1_MOUSE Chromodomain-helicase-DNA-binding protein 1 OS=Mus musculus GN=Chd1 PE=1 SV=3 500 834 4.0E-18
sp|Q05471|SWR1_YEAST Helicase SWR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWR1 PE=1 SV=1 502 829 4.0E-18
sp|Q7KU24|CHD1_DROME Chromodomain-helicase-DNA-binding protein 1 OS=Drosophila melanogaster GN=Chd1 PE=1 SV=1 504 827 4.0E-18
sp|B6ZLK2|CHD1_CHICK Chromodomain-helicase-DNA-binding protein 1 OS=Gallus gallus GN=CHD1 PE=1 SV=1 500 823 4.0E-18
sp|A1CZE5|INO80_NEOFI Putative DNA helicase ino80 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ino80 PE=3 SV=1 971 1107 4.0E-18
sp|Q7X9V2|PIE1_ARATH Protein PHOTOPERIOD-INDEPENDENT EARLY FLOWERING 1 OS=Arabidopsis thaliana GN=PIE1 PE=1 SV=1 972 1117 5.0E-18
sp|Q4WTV7|INO80_ASPFU Putative DNA helicase ino80 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ino80 PE=3 SV=1 971 1107 5.0E-18
sp|A2R9H9|INO80_ASPNC Putative DNA helicase ino80 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=ino80 PE=3 SV=1 971 1107 5.0E-18
sp|A4R227|INO80_MAGO7 Putative DNA helicase INO80 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=INO80 PE=3 SV=1 972 1107 5.0E-18
sp|A6QQR4|ERC6L_BOVIN DNA excision repair protein ERCC-6-like OS=Bos taurus GN=ERCC6L PE=2 SV=1 502 825 6.0E-18
sp|P25439|BRM_DROME ATP-dependent helicase brm OS=Drosophila melanogaster GN=brm PE=1 SV=2 501 826 6.0E-18
sp|Q0CA78|INO80_ASPTN Putative DNA helicase ino80 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ino80 PE=3 SV=1 971 1107 6.0E-18
sp|Q6CA87|SWR1_YARLI Helicase SWR1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SWR1 PE=3 SV=1 502 829 6.0E-18
sp|Q22516|CHD3_CAEEL Chromodomain-helicase-DNA-binding protein 3 homolog OS=Caenorhabditis elegans GN=chd-3 PE=2 SV=2 850 1118 7.0E-18
sp|Q9NRZ9|HELLS_HUMAN Lymphoid-specific helicase OS=Homo sapiens GN=HELLS PE=1 SV=1 498 798 7.0E-18
sp|Q2UTQ9|INO80_ASPOR Putative DNA helicase ino80 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ino80 PE=3 SV=1 971 1107 7.0E-18
sp|Q6FK48|SWR1_CANGA Helicase SWR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SWR1 PE=3 SV=1 502 827 7.0E-18
sp|O97159|CHDM_DROME Chromodomain-helicase-DNA-binding protein Mi-2 homolog OS=Drosophila melanogaster GN=Mi-2 PE=1 SV=2 967 1117 8.0E-18
sp|Q4PGL2|INO80_USTMA Putative DNA helicase INO80 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=INO80 PE=3 SV=1 971 1141 8.0E-18
sp|P75093|Y020_MYCPN Uncharacterized ATP-dependent helicase MPN_020 OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_020 PE=3 SV=1 497 819 9.0E-18
sp|Q6BGY8|INO80_DEBHA Putative DNA helicase INO80 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=INO80 PE=3 SV=2 972 1107 9.0E-18
sp|P47264|Y018_MYCGE Uncharacterized ATP-dependent helicase MG018 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG018 PE=3 SV=3 497 844 1.0E-17
sp|Q6ZRS2|SRCAP_HUMAN Helicase SRCAP OS=Homo sapiens GN=SRCAP PE=1 SV=3 974 1118 1.0E-17
sp|Q12873|CHD3_HUMAN Chromodomain-helicase-DNA-binding protein 3 OS=Homo sapiens GN=CHD3 PE=1 SV=3 504 841 1.0E-17
sp|P0CO16|INO80_CRYNJ Putative DNA helicase INO80 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=INO80 PE=3 SV=1 963 1117 1.0E-17
sp|P0CO17|INO80_CRYNB Putative DNA helicase INO80 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=INO80 PE=3 SV=1 963 1117 1.0E-17
sp|Q6DIC0|SMCA2_MOUSE Probable global transcription activator SNF2L2 OS=Mus musculus GN=Smarca2 PE=1 SV=1 994 1108 1.0E-17
sp|P51531|SMCA2_HUMAN Probable global transcription activator SNF2L2 OS=Homo sapiens GN=SMARCA2 PE=1 SV=2 994 1108 1.0E-17
sp|P51532|SMCA4_HUMAN Transcription activator BRG1 OS=Homo sapiens GN=SMARCA4 PE=1 SV=2 962 1108 1.0E-17
sp|A7Z019|SMCA4_BOVIN Transcription activator BRG1 OS=Bos taurus GN=SMARCA4 PE=2 SV=1 962 1108 1.0E-17
sp|O42861|FFT3_SCHPO ATP-dependent helicase fft3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fft3 PE=1 SV=1 990 1122 2.0E-17
sp|Q759G7|SWR1_ASHGO Helicase SWR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SWR1 PE=3 SV=2 972 1115 2.0E-17
sp|Q6FK48|SWR1_CANGA Helicase SWR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SWR1 PE=3 SV=1 973 1115 2.0E-17
sp|P51531|SMCA2_HUMAN Probable global transcription activator SNF2L2 OS=Homo sapiens GN=SMARCA2 PE=1 SV=2 501 826 2.0E-17
sp|Q9ZV43|CHR8_ARATH Protein CHROMATIN REMODELING 8 OS=Arabidopsis thaliana GN=CHR8 PE=2 SV=1 932 1141 2.0E-17
sp|F4KBP5|CHR4_ARATH Protein CHROMATIN REMODELING 4 OS=Arabidopsis thaliana GN=CHR4 PE=2 SV=1 969 1134 2.0E-17
sp|Q7ZU90|CHD1L_DANRE Chromodomain-helicase-DNA-binding protein 1-like OS=Danio rerio GN=chd1l PE=2 SV=1 462 821 2.0E-17
sp|Q3TKT4|SMCA4_MOUSE Transcription activator BRG1 OS=Mus musculus GN=Smarca4 PE=1 SV=1 962 1108 2.0E-17
sp|Q8K1P7|SMCA4_RAT Transcription activator BRG1 OS=Rattus norvegicus GN=Smarca4 PE=1 SV=1 962 1108 2.0E-17
sp|P32863|RAD54_YEAST DNA repair and recombination protein RAD54 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD54 PE=1 SV=1 971 1141 2.0E-17
sp|P22082|SNF2_YEAST Transcription regulatory protein SNF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF2 PE=1 SV=1 501 821 2.0E-17
sp|O13682|SWR1_SCHPO Helicase swr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swr1 PE=3 SV=1 990 1117 3.0E-17
sp|O94421|SNF22_SCHPO SWI/SNF chromatin-remodeling complex subunit snf22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snf22 PE=1 SV=2 501 830 3.0E-17
sp|Q05471|SWR1_YEAST Helicase SWR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWR1 PE=1 SV=1 973 1115 3.0E-17
sp|Q6DIC0|SMCA2_MOUSE Probable global transcription activator SNF2L2 OS=Mus musculus GN=Smarca2 PE=1 SV=1 501 826 3.0E-17
sp|Q08773|ISW2_YEAST ISWI chromatin-remodeling complex ATPase ISW2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ISW2 PE=1 SV=1 486 826 3.0E-17
sp|O12944|RAD54_CHICK DNA repair and recombination protein RAD54-like (Fragment) OS=Gallus gallus GN=RAD54L PE=2 SV=1 971 1142 3.0E-17
sp|G5EDG2|SMRCD_CAEEL SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 homolog OS=Caenorhabditis elegans GN=M03C11.8 PE=3 SV=1 987 1114 4.0E-17
sp|B5BT18|BTAF1_ARATH TATA-binding protein-associated factor BTAF1 OS=Arabidopsis thaliana GN=BTAF1 PE=1 SV=1 992 1121 4.0E-17
sp|Q6BKC2|SWR1_DEBHA Helicase SWR1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SWR1 PE=3 SV=2 973 1115 4.0E-17
sp|P22082|SNF2_YEAST Transcription regulatory protein SNF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF2 PE=1 SV=1 875 1108 4.0E-17
sp|O43065|MOT1_SCHPO Probable helicase mot1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mot1 PE=1 SV=4 962 1121 4.0E-17
sp|Q6PDQ2|CHD4_MOUSE Chromodomain-helicase-DNA-binding protein 4 OS=Mus musculus GN=Chd4 PE=1 SV=1 990 1128 4.0E-17
sp|Q14839|CHD4_HUMAN Chromodomain-helicase-DNA-binding protein 4 OS=Homo sapiens GN=CHD4 PE=1 SV=2 990 1128 4.0E-17
sp|Q14839|CHD4_HUMAN Chromodomain-helicase-DNA-binding protein 4 OS=Homo sapiens GN=CHD4 PE=1 SV=2 504 821 4.0E-17
sp|P32333|MOT1_YEAST TATA-binding protein-associated factor MOT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MOT1 PE=1 SV=1 987 1121 5.0E-17
sp|O14981|BTAF1_HUMAN TATA-binding protein-associated factor 172 OS=Homo sapiens GN=BTAF1 PE=1 SV=2 994 1134 5.0E-17
sp|D3ZD32|CHD5_RAT Chromodomain-helicase-DNA-binding protein 5 OS=Rattus norvegicus GN=Chd5 PE=1 SV=1 504 821 5.0E-17
sp|A2A8L1|CHD5_MOUSE Chromodomain-helicase-DNA-binding protein 5 OS=Mus musculus GN=Chd5 PE=1 SV=1 504 821 5.0E-17
sp|P51532|SMCA4_HUMAN Transcription activator BRG1 OS=Homo sapiens GN=SMARCA4 PE=1 SV=2 501 826 5.0E-17
sp|A7Z019|SMCA4_BOVIN Transcription activator BRG1 OS=Bos taurus GN=SMARCA4 PE=2 SV=1 501 933 5.0E-17
sp|Q3TKT4|SMCA4_MOUSE Transcription activator BRG1 OS=Mus musculus GN=Smarca4 PE=1 SV=1 501 933 5.0E-17
sp|Q8K1P7|SMCA4_RAT Transcription activator BRG1 OS=Rattus norvegicus GN=Smarca4 PE=1 SV=1 501 933 5.0E-17
sp|Q6PDQ2|CHD4_MOUSE Chromodomain-helicase-DNA-binding protein 4 OS=Mus musculus GN=Chd4 PE=1 SV=1 504 821 5.0E-17
sp|P32597|STH1_YEAST Nuclear protein STH1/NPS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STH1 PE=1 SV=1 990 1108 5.0E-17
sp|Q5A310|ISW2_CANAL ISWI chromatin-remodeling complex ATPase ISW2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ISW2 PE=2 SV=1 970 1108 5.0E-17
sp|Q0PCS3|CHR25_ARATH Protein CHROMATIN REMODELING 25 OS=Arabidopsis thaliana GN=CHR25 PE=1 SV=1 502 822 5.0E-17
sp|Q6CJ38|SWR1_KLULA Helicase SWR1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SWR1 PE=3 SV=1 973 1117 6.0E-17
sp|P41877|ISW1_CAEEL Chromatin-remodeling complex ATPase chain isw-1 OS=Caenorhabditis elegans GN=isw-1 PE=1 SV=2 984 1131 6.0E-17
sp|Q8TDI0|CHD5_HUMAN Chromodomain-helicase-DNA-binding protein 5 OS=Homo sapiens GN=CHD5 PE=1 SV=1 504 821 6.0E-17
sp|Q9UTN6|SNF21_SCHPO Chromatin structure-remodeling complex subunit snf21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snf21 PE=1 SV=1 990 1108 6.0E-17
sp|Q92698|RAD54_HUMAN DNA repair and recombination protein RAD54-like OS=Homo sapiens GN=RAD54L PE=1 SV=2 971 1141 6.0E-17
sp|P25439|BRM_DROME ATP-dependent helicase brm OS=Drosophila melanogaster GN=brm PE=1 SV=2 994 1108 7.0E-17
sp|O43065|MOT1_SCHPO Probable helicase mot1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mot1 PE=1 SV=4 501 822 7.0E-17
sp|G5EBZ4|LE418_CAEEL Protein let-418 OS=Caenorhabditis elegans GN=let-418 PE=1 SV=1 850 1117 8.0E-17
sp|F4K128|CHR23_ARATH Probable ATP-dependent DNA helicase CHR23 OS=Arabidopsis thaliana GN=CHR23 PE=2 SV=1 990 1142 8.0E-17
sp|Q24368|ISWI_DROME Chromatin-remodeling complex ATPase chain Iswi OS=Drosophila melanogaster GN=Iswi PE=1 SV=1 498 821 8.0E-17
sp|Q24368|ISWI_DROME Chromatin-remodeling complex ATPase chain Iswi OS=Drosophila melanogaster GN=Iswi PE=1 SV=1 970 1114 9.0E-17
sp|Q9US25|HRP1_SCHPO Chromodomain helicase hrp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hrp1 PE=1 SV=1 966 1140 9.0E-17
sp|A4PBL4|RAD54_ORYSJ DNA repair and recombination protein RAD54 OS=Oryza sativa subsp. japonica GN=RAD54 PE=1 SV=1 502 822 9.0E-17
sp|Q4WAS9|SWR1_ASPFU Helicase swr1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=swr1 PE=3 SV=1 990 1117 1.0E-16
sp|Q03468|ERCC6_HUMAN DNA excision repair protein ERCC-6 OS=Homo sapiens GN=ERCC6 PE=1 SV=1 989 1142 1.0E-16
sp|P38144|ISW1_YEAST ISWI chromatin-remodeling complex ATPase ISW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ISW1 PE=1 SV=2 990 1108 1.0E-16
sp|P40352|RAD26_YEAST DNA repair and recombination protein RAD26 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD26 PE=1 SV=1 493 822 1.0E-16
sp|P70270|RAD54_MOUSE DNA repair and recombination protein RAD54-like OS=Mus musculus GN=Rad54l PE=1 SV=2 971 1142 1.0E-16
sp|Q9JIM3|ER6L2_MOUSE DNA excision repair protein ERCC-6-like 2 OS=Mus musculus GN=Ercc6l2 PE=1 SV=3 945 1107 1.0E-16
sp|A3KMX0|ER6L2_BOVIN DNA excision repair protein ERCC-6-like 2 OS=Bos taurus GN=ERCC6L2 PE=2 SV=3 945 1107 1.0E-16
sp|Q5T890|ER6L2_HUMAN DNA excision repair protein ERCC-6-like 2 OS=Homo sapiens GN=ERCC6L2 PE=1 SV=2 945 1107 1.0E-16
sp|Q5FWR0|SMRCD_XENTR SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Xenopus tropicalis GN=smarcad1 PE=2 SV=1 498 823 2.0E-16
sp|F4IHS2|SYD_ARATH Chromatin structure-remodeling complex protein SYD OS=Arabidopsis thaliana GN=SYD PE=1 SV=1 501 821 2.0E-16
sp|A9X4T1|CHD1_BOMMO Chromodomain-helicase-DNA-binding protein 1 OS=Bombyx mori GN=CHD1 PE=1 SV=1 504 823 2.0E-16
sp|Q60848|HELLS_MOUSE Lymphocyte-specific helicase OS=Mus musculus GN=Hells PE=1 SV=2 498 798 2.0E-16
sp|Q0UG82|INO80_PHANO Putative DNA helicase INO80 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=INO80 PE=3 SV=2 971 1107 2.0E-16
sp|Q9NDJ2|DOM_DROME Helicase domino OS=Drosophila melanogaster GN=dom PE=1 SV=2 990 1118 3.0E-16
sp|O16102|CHD3_DROME Chromodomain-helicase-DNA-binding protein 3 OS=Drosophila melanogaster GN=Chd3 PE=2 SV=3 462 821 3.0E-16
sp|F4IHS2|SYD_ARATH Chromatin structure-remodeling complex protein SYD OS=Arabidopsis thaliana GN=SYD PE=1 SV=1 903 1119 3.0E-16
sp|P41410|RAD54_SCHPO DNA repair protein rhp54 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp54 PE=1 SV=2 971 1141 3.0E-16
sp|O10302|GTA_NPVOP Probable global transactivator OS=Orgyia pseudotsugata multicapsid polyhedrosis virus GN=GTA PE=3 SV=1 992 1142 4.0E-16
sp|P31380|FUN30_YEAST ATP-dependent helicase FUN30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FUN30 PE=1 SV=1 971 1134 4.0E-16
sp|Q9Y620|RA54B_HUMAN DNA repair and recombination protein RAD54B OS=Homo sapiens GN=RAD54B PE=1 SV=1 502 839 4.0E-16
sp|P87114|FFT1_SCHPO ATP-dependent helicase fft1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fft1 PE=3 SV=1 501 761 5.0E-16
sp|Q8W103|CHR24_ARATH Protein CHROMATIN REMODELING 24 OS=Arabidopsis thaliana GN=CHR24 PE=2 SV=1 990 1142 5.0E-16
sp|Q59U81|SWR1_CANAL Helicase SWR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SWR1 PE=3 SV=1 973 1115 5.0E-16
sp|Q9ZUL5|CHR19_ARATH Protein CHROMATIN REMODELING 19 OS=Arabidopsis thaliana GN=ETL1 PE=1 SV=1 971 1114 5.0E-16
sp|Q9NEL2|SSL1_CAEEL Helicase ssl-1 OS=Caenorhabditis elegans GN=ssl-1 PE=2 SV=4 974 1115 6.0E-16
sp|O74842|FFT2_SCHPO ATP-dependent helicase fft2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fft2 PE=1 SV=1 498 823 6.0E-16
sp|F4J9M5|CHR12_ARATH Probable ATP-dependent DNA helicase CHR12 OS=Arabidopsis thaliana GN=CHR12 PE=2 SV=1 990 1141 7.0E-16
sp|Q08773|ISW2_YEAST ISWI chromatin-remodeling complex ATPase ISW2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ISW2 PE=1 SV=1 985 1108 7.0E-16
sp|F4IV45|CHR10_ARATH Probable helicase CHR10 OS=Arabidopsis thaliana GN=CHR10 PE=3 SV=1 984 1114 7.0E-16
sp|Q5ARK3|SWR1_EMENI Helicase swr1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=swr1 PE=3 SV=2 990 1117 8.0E-16
sp|P94593|YWQA_BACSU Uncharacterized ATP-dependent helicase YwqA OS=Bacillus subtilis (strain 168) GN=ywqA PE=3 SV=2 971 1115 9.0E-16
sp|Q91ZW3|SMCA5_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Mus musculus GN=Smarca5 PE=1 SV=1 970 1114 1.0E-15
sp|O60264|SMCA5_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Homo sapiens GN=SMARCA5 PE=1 SV=1 970 1114 1.0E-15
sp|Q9UTL9|YIV5_SCHPO Uncharacterized ATP-dependent helicase C144.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC144.05 PE=3 SV=1 426 819 1.0E-15
sp|Q6CA87|SWR1_YARLI Helicase SWR1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SWR1 PE=3 SV=1 990 1117 1.0E-15
sp|P32597|STH1_YEAST Nuclear protein STH1/NPS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STH1 PE=1 SV=1 501 821 1.0E-15
sp|F4I2H2|CHR9_ARATH Switch 2 OS=Arabidopsis thaliana GN=SWI2 PE=3 SV=1 502 783 1.0E-15
sp|Q9DG67|RA54B_CHICK DNA repair and recombination protein RAD54B OS=Gallus gallus GN=RAD54B PE=2 SV=1 501 822 1.0E-15
sp|Q9S775|PKL_ARATH CHD3-type chromatin-remodeling factor PICKLE OS=Arabidopsis thaliana GN=PKL PE=1 SV=1 969 1137 2.0E-15
sp|F4K128|CHR23_ARATH Probable ATP-dependent DNA helicase CHR23 OS=Arabidopsis thaliana GN=CHR23 PE=2 SV=1 502 821 2.0E-15
sp|Q3B7N1|CHD1L_BOVIN Chromodomain-helicase-DNA-binding protein 1-like OS=Bos taurus GN=CHD1L PE=2 SV=1 989 1109 2.0E-15
sp|Q9XFH4|DDM1_ARATH ATP-dependent DNA helicase DDM1 OS=Arabidopsis thaliana GN=DDM1 PE=1 SV=1 498 823 2.0E-15
sp|Q09772|RDH54_SCHPO Meiotic recombination protein rdh54 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rdh54 PE=1 SV=3 970 1142 2.0E-15
sp|Q149N8|SHPRH_HUMAN E3 ubiquitin-protein ligase SHPRH OS=Homo sapiens GN=SHPRH PE=1 SV=2 887 1113 3.0E-15
sp|C0H4W3|HEPF1_PLAF7 Probable ATP-dependent helicase PF08_0048 OS=Plasmodium falciparum (isolate 3D7) GN=PF08_0048 PE=3 SV=1 501 827 3.0E-15
sp|Q2NKX8|ERC6L_HUMAN DNA excision repair protein ERCC-6-like OS=Homo sapiens GN=ERCC6L PE=1 SV=1 502 825 3.0E-15
sp|B4MX21|RAD54_DROWI DNA repair and recombination protein RAD54-like OS=Drosophila willistoni GN=okr PE=3 SV=1 502 831 3.0E-15
sp|F4JTF6|CHR7_ARATH CHD3-type chromatin-remodeling factor CHR7 OS=Arabidopsis thaliana GN=CHR7 PE=2 SV=1 969 1117 3.0E-15
sp|Q9VL72|SMRCD_DROME SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 homolog OS=Drosophila melanogaster GN=Etl1 PE=1 SV=1 990 1131 3.0E-15
sp|Q4IAK7|SWR1_GIBZE Helicase SWR1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SWR1 PE=3 SV=1 990 1117 4.0E-15
sp|Q6PGB8|SMCA1_MOUSE Probable global transcription activator SNF2L1 OS=Mus musculus GN=Smarca1 PE=1 SV=1 970 1114 4.0E-15
sp|Q7S133|SWR1_NEUCR Helicase swr-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=crf1-1 PE=3 SV=1 972 1117 4.0E-15
sp|O97159|CHDM_DROME Chromodomain-helicase-DNA-binding protein Mi-2 homolog OS=Drosophila melanogaster GN=Mi-2 PE=1 SV=2 504 821 4.0E-15
sp|P32657|CHD1_YEAST Chromo domain-containing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHD1 PE=1 SV=1 966 1117 4.0E-15
sp|P43610|IRC5_YEAST Uncharacterized ATP-dependent helicase IRC5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRC5 PE=1 SV=2 990 1108 5.0E-15
sp|Q9CXF7|CHD1L_MOUSE Chromodomain-helicase-DNA-binding protein 1-like OS=Mus musculus GN=Chd1l PE=1 SV=1 990 1109 5.0E-15
sp|O14139|HRP3_SCHPO Chromodomain helicase hrp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hrp3 PE=1 SV=1 966 1129 7.0E-15
sp|Q86WJ1|CHD1L_HUMAN Chromodomain-helicase-DNA-binding protein 1-like OS=Homo sapiens GN=CHD1L PE=1 SV=2 990 1109 7.0E-15
sp|Q9NRZ9|HELLS_HUMAN Lymphoid-specific helicase OS=Homo sapiens GN=HELLS PE=1 SV=1 970 1108 8.0E-15
sp|F4I2H2|CHR9_ARATH Switch 2 OS=Arabidopsis thaliana GN=SWI2 PE=3 SV=1 989 1140 9.0E-15
sp|Q9ZV43|CHR8_ARATH Protein CHROMATIN REMODELING 8 OS=Arabidopsis thaliana GN=CHR8 PE=2 SV=1 497 822 1.0E-14
sp|Q9XFH4|DDM1_ARATH ATP-dependent DNA helicase DDM1 OS=Arabidopsis thaliana GN=DDM1 PE=1 SV=1 992 1109 1.0E-14
sp|Q86WJ1|CHD1L_HUMAN Chromodomain-helicase-DNA-binding protein 1-like OS=Homo sapiens GN=CHD1L PE=1 SV=2 466 821 1.0E-14
sp|Q8RWY3|ISW2_ARATH ISWI chromatin-remodeling complex ATPase CHR11 OS=Arabidopsis thaliana GN=CHR11 PE=1 SV=4 989 1108 2.0E-14
sp|O14148|INO80_SCHPO Putative DNA helicase ino80 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ino80 PE=1 SV=4 501 821 2.0E-14
sp|Q7G8Y3|ISW2_ORYSJ Probable chromatin-remodeling complex ATPase chain OS=Oryza sativa subsp. japonica GN=Os01g0367900 PE=2 SV=2 989 1108 2.0E-14
sp|Q60848|HELLS_MOUSE Lymphocyte-specific helicase OS=Mus musculus GN=Hells PE=1 SV=2 970 1108 2.0E-14
sp|Q6PFE3|RA54B_MOUSE DNA repair and recombination protein RAD54B OS=Mus musculus GN=Rad54b PE=2 SV=1 502 720 2.0E-14
sp|A7TJI3|INO80_VANPO Putative DNA helicase INO80 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=INO80 PE=3 SV=1 501 821 3.0E-14
sp|F4JY24|CHR17_ARATH ISWI chromatin-remodeling complex ATPase CHR17 OS=Arabidopsis thaliana GN=CHR17 PE=1 SV=1 989 1108 3.0E-14
sp|Q4IL82|INO80_GIBZE Putative DNA helicase INO80 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=INO80 PE=3 SV=1 498 827 3.0E-14
sp|Q4PGL2|INO80_USTMA Putative DNA helicase INO80 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=INO80 PE=3 SV=1 460 838 3.0E-14
sp|Q3B7N1|CHD1L_BOVIN Chromodomain-helicase-DNA-binding protein 1-like OS=Bos taurus GN=CHD1L PE=2 SV=1 462 821 3.0E-14
sp|Q9VL72|SMRCD_DROME SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 homolog OS=Drosophila melanogaster GN=Etl1 PE=1 SV=1 493 824 3.0E-14
sp|Q5A310|ISW2_CANAL ISWI chromatin-remodeling complex ATPase ISW2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ISW2 PE=2 SV=1 501 821 4.0E-14
sp|Q9UR24|RHP26_SCHPO DNA repair protein rhp26 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp26 PE=3 SV=1 502 831 5.0E-14
sp|Q7TPQ3|SHPRH_MOUSE E3 ubiquitin-protein ligase SHPRH OS=Mus musculus GN=Shprh PE=1 SV=1 887 1113 6.0E-14
sp|Q7TPQ3|SHPRH_MOUSE E3 ubiquitin-protein ligase SHPRH OS=Mus musculus GN=Shprh PE=1 SV=1 425 531 6.0E-14
sp|Q9Y620|RA54B_HUMAN DNA repair and recombination protein RAD54B OS=Homo sapiens GN=RAD54B PE=1 SV=1 972 1142 6.0E-14
sp|Q1DUF9|INO80_COCIM Putative DNA helicase INO80 OS=Coccidioides immitis (strain RS) GN=INO80 PE=3 SV=1 498 829 7.0E-14
sp|A9X4T1|CHD1_BOMMO Chromodomain-helicase-DNA-binding protein 1 OS=Bombyx mori GN=CHD1 PE=1 SV=1 990 1114 7.0E-14
sp|Q06554|IRC20_YEAST Uncharacterized ATP-dependent helicase IRC20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRC20 PE=1 SV=1 435 821 8.0E-14
sp|Q6FV37|INO80_CANGA Putative DNA helicase INO80 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=INO80 PE=3 SV=1 501 821 9.0E-14
sp|B4KHL5|RAD54_DROMO DNA repair and recombination protein RAD54-like OS=Drosophila mojavensis GN=okr PE=3 SV=1 502 822 1.0E-13
sp|P28370|SMCA1_HUMAN Probable global transcription activator SNF2L1 OS=Homo sapiens GN=SMARCA1 PE=1 SV=2 970 1114 1.0E-13
sp|Q8RXS6|INO80_ARATH DNA helicase INO80 OS=Arabidopsis thaliana GN=INO80 PE=2 SV=2 498 826 1.0E-13
sp|A7EQA8|INO80_SCLS1 Putative DNA helicase INO80 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=INO80 PE=3 SV=1 498 829 1.0E-13
sp|Q5BAZ5|INO80_EMENI Putative DNA helicase ino80 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ino80 PE=3 SV=1 498 826 1.0E-13
sp|A4R227|INO80_MAGO7 Putative DNA helicase INO80 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=INO80 PE=3 SV=1 498 821 1.0E-13
sp|Q2UTQ9|INO80_ASPOR Putative DNA helicase ino80 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ino80 PE=3 SV=1 498 821 1.0E-13
sp|Q7ZU90|CHD1L_DANRE Chromodomain-helicase-DNA-binding protein 1-like OS=Danio rerio GN=chd1l PE=2 SV=1 969 1105 1.0E-13
sp|Q9CXF7|CHD1L_MOUSE Chromodomain-helicase-DNA-binding protein 1-like OS=Mus musculus GN=Chd1l PE=1 SV=1 466 821 1.0E-13
sp|Q9GQN5|ATRX_DROME Transcriptional regulator ATRX homolog OS=Drosophila melanogaster GN=XNP PE=1 SV=2 496 873 1.0E-13
sp|B4NXB8|RAD54_DROYA DNA repair and recombination protein RAD54-like OS=Drosophila yakuba GN=okr PE=3 SV=2 502 822 2.0E-13
sp|O14647|CHD2_HUMAN Chromodomain-helicase-DNA-binding protein 2 OS=Homo sapiens GN=CHD2 PE=1 SV=2 965 1121 2.0E-13
sp|Q59KI4|INO80_CANAL Putative DNA helicase INO80 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=INO80 PE=3 SV=1 498 821 2.0E-13
sp|A1C9W6|INO80_ASPCL Putative DNA helicase ino80 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ino80 PE=3 SV=1 498 821 2.0E-13
sp|O14646|CHD1_HUMAN Chromodomain-helicase-DNA-binding protein 1 OS=Homo sapiens GN=CHD1 PE=1 SV=2 989 1121 2.0E-13
sp|P40201|CHD1_MOUSE Chromodomain-helicase-DNA-binding protein 1 OS=Mus musculus GN=Chd1 PE=1 SV=3 989 1121 2.0E-13
sp|B6ZLK2|CHD1_CHICK Chromodomain-helicase-DNA-binding protein 1 OS=Gallus gallus GN=CHD1 PE=1 SV=1 989 1121 2.0E-13
sp|A2R9H9|INO80_ASPNC Putative DNA helicase ino80 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=ino80 PE=3 SV=1 498 826 2.0E-13
sp|F4KBP5|CHR4_ARATH Protein CHROMATIN REMODELING 4 OS=Arabidopsis thaliana GN=CHR4 PE=2 SV=1 504 826 2.0E-13
sp|Q0PCS3|CHR25_ARATH Protein CHROMATIN REMODELING 25 OS=Arabidopsis thaliana GN=CHR25 PE=1 SV=1 969 1142 2.0E-13
sp|Q0UG82|INO80_PHANO Putative DNA helicase INO80 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=INO80 PE=3 SV=2 498 821 2.0E-13
sp|B3NAN8|RAD54_DROER DNA repair and recombination protein RAD54-like OS=Drosophila erecta GN=okr PE=3 SV=1 502 822 3.0E-13
sp|A6ZU34|INO80_YEAS7 Putative DNA helicase INO80 OS=Saccharomyces cerevisiae (strain YJM789) GN=INO80 PE=3 SV=1 501 821 3.0E-13
sp|Q872I5|INO80_NEUCR Putative DNA helicase ino80 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=crf2-1 PE=3 SV=3 498 844 3.0E-13
sp|Q7KU24|CHD1_DROME Chromodomain-helicase-DNA-binding protein 1 OS=Drosophila melanogaster GN=Chd1 PE=1 SV=1 985 1114 3.0E-13
sp|Q4WTV7|INO80_ASPFU Putative DNA helicase ino80 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ino80 PE=3 SV=1 498 826 3.0E-13
sp|E9PZM4|CHD2_MOUSE Chromodomain-helicase-DNA-binding protein 2 OS=Mus musculus GN=Chd2 PE=1 SV=1 970 1121 4.0E-13
sp|F4IV99|CHR5_ARATH Protein CHROMATIN REMODELING 5 OS=Arabidopsis thaliana GN=CHR5 PE=3 SV=1 970 1138 4.0E-13
sp|Q6BGY8|INO80_DEBHA Putative DNA helicase INO80 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=INO80 PE=3 SV=2 498 821 4.0E-13
sp|A4PBL4|RAD54_ORYSJ DNA repair and recombination protein RAD54 OS=Oryza sativa subsp. japonica GN=RAD54 PE=1 SV=1 974 1115 4.0E-13
sp|A5E0W5|INO80_LODEL Putative DNA helicase ino80 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=INO80 PE=3 SV=1 498 745 5.0E-13
sp|A1CZE5|INO80_NEOFI Putative DNA helicase ino80 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ino80 PE=3 SV=1 498 821 5.0E-13
sp|Q9US25|HRP1_SCHPO Chromodomain helicase hrp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hrp1 PE=1 SV=1 502 821 5.0E-13
sp|O55764|172L_IIV6 Putative helicase 172L OS=Invertebrate iridescent virus 6 GN=IIV6-172L PE=3 SV=1 992 1120 5.0E-13
sp|B3MMA5|RAD54_DROAN DNA repair and recombination protein RAD54-like OS=Drosophila ananassae GN=okr PE=3 SV=1 502 825 6.0E-13
sp|P53115|INO80_YEAST Putative DNA helicase INO80 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=INO80 PE=1 SV=1 501 821 6.0E-13
sp|O12944|RAD54_CHICK DNA repair and recombination protein RAD54-like (Fragment) OS=Gallus gallus GN=RAD54L PE=2 SV=1 502 843 6.0E-13
sp|B4M9A8|RAD54_DROVI DNA repair and recombination protein RAD54-like OS=Drosophila virilis GN=okr PE=3 SV=1 502 822 7.0E-13
sp|Q0CA78|INO80_ASPTN Putative DNA helicase ino80 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ino80 PE=3 SV=1 498 826 7.0E-13
sp|Q7YQM3|ATRX_PONPY Transcriptional regulator ATRX OS=Pongo pygmaeus GN=ATRX PE=2 SV=1 967 1118 7.0E-13
sp|Q7YQM4|ATRX_PANTR Transcriptional regulator ATRX OS=Pan troglodytes GN=ATRX PE=2 SV=1 967 1118 8.0E-13
sp|P46100|ATRX_HUMAN Transcriptional regulator ATRX OS=Homo sapiens GN=ATRX PE=1 SV=5 967 1118 8.0E-13
sp|Q29KH2|RAD54_DROPS DNA repair and recombination protein RAD54-like OS=Drosophila pseudoobscura pseudoobscura GN=okr PE=3 SV=2 502 822 1.0E-12
sp|B4GS98|RAD54_DROPE DNA repair and recombination protein RAD54-like OS=Drosophila persimilis GN=okr PE=3 SV=1 502 822 1.0E-12
sp|Q74Z27|INO80_ASHGO Putative DNA helicase INO80 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=INO80 PE=3 SV=2 501 821 1.0E-12
sp|F4IV45|CHR10_ARATH Probable helicase CHR10 OS=Arabidopsis thaliana GN=CHR10 PE=3 SV=1 507 821 1.0E-12
sp|Q06554|IRC20_YEAST Uncharacterized ATP-dependent helicase IRC20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRC20 PE=1 SV=1 887 1111 1.0E-12
sp|B4F769|SMAL1_RAT SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Rattus norvegicus GN=Smarcal1 PE=2 SV=1 992 1118 1.0E-12
sp|Q61687|ATRX_MOUSE Transcriptional regulator ATRX OS=Mus musculus GN=Atrx PE=1 SV=3 967 1118 1.0E-12
sp|Q8TD26|CHD6_HUMAN Chromodomain-helicase-DNA-binding protein 6 OS=Homo sapiens GN=CHD6 PE=1 SV=4 990 1108 2.0E-12
sp|A3KFM7|CHD6_MOUSE Chromodomain-helicase-DNA-binding protein 6 OS=Mus musculus GN=Chd6 PE=1 SV=1 990 1108 2.0E-12
sp|D3ZA12|CHD6_RAT Chromodomain-helicase-DNA-binding protein 6 OS=Rattus norvegicus GN=Chd6 PE=1 SV=2 990 1108 2.0E-12
sp|B0R0I6|CHD8_DANRE Chromodomain-helicase-DNA-binding protein 8 OS=Danio rerio GN=chd8 PE=3 SV=2 990 1108 2.0E-12
sp|Q149N8|SHPRH_HUMAN E3 ubiquitin-protein ligase SHPRH OS=Homo sapiens GN=SHPRH PE=1 SV=2 425 531 2.0E-12
sp|O76460|RAD54_DROME DNA repair and recombination protein RAD54-like OS=Drosophila melanogaster GN=okr PE=1 SV=1 502 822 2.0E-12
sp|Q8BJL0|SMAL1_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Mus musculus GN=Smarcal1 PE=1 SV=1 992 1118 2.0E-12
sp|Q3L8U1|CHD9_HUMAN Chromodomain-helicase-DNA-binding protein 9 OS=Homo sapiens GN=CHD9 PE=1 SV=2 990 1108 3.0E-12
sp|Q8BYH8|CHD9_MOUSE Chromodomain-helicase-DNA-binding protein 9 OS=Mus musculus GN=Chd9 PE=1 SV=2 990 1108 3.0E-12
sp|Q9HCK8|CHD8_HUMAN Chromodomain-helicase-DNA-binding protein 8 OS=Homo sapiens GN=CHD8 PE=1 SV=5 990 1108 3.0E-12
sp|Q09XV5|CHD8_MOUSE Chromodomain-helicase-DNA-binding protein 8 OS=Mus musculus GN=Chd8 PE=1 SV=1 990 1108 3.0E-12
sp|Q9JIX5|CHD8_RAT Chromodomain-helicase-DNA-binding protein 8 OS=Rattus norvegicus GN=Chd8 PE=1 SV=2 990 1108 3.0E-12
sp|B4JCS7|RAD54_DROGR DNA repair and recombination protein RAD54-like OS=Drosophila grimshawi GN=okr PE=3 SV=1 502 822 3.0E-12
sp|Q9DG67|RA54B_CHICK DNA repair and recombination protein RAD54B OS=Gallus gallus GN=RAD54B PE=2 SV=1 971 1142 3.0E-12
sp|Q6PFE3|RA54B_MOUSE DNA repair and recombination protein RAD54B OS=Mus musculus GN=Rad54b PE=2 SV=1 969 1142 3.0E-12
sp|Q99NG0|ARIP4_MOUSE Helicase ARIP4 OS=Mus musculus GN=Rad54l2 PE=1 SV=1 966 1118 3.0E-12
sp|B5DE69|CHD8_XENTR Chromodomain-helicase-DNA-binding protein 8 OS=Xenopus tropicalis GN=chd8 PE=2 SV=2 990 1108 4.0E-12
sp|Q06A37|CHD7_CHICK Chromodomain-helicase-DNA-binding protein 7 OS=Gallus gallus GN=CHD7 PE=2 SV=1 990 1108 4.0E-12
sp|Q6CNY4|INO80_KLULA Putative DNA helicase INO80 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=INO80 PE=3 SV=1 481 829 4.0E-12
sp|Q9P2D1|CHD7_HUMAN Chromodomain-helicase-DNA-binding protein 7 OS=Homo sapiens GN=CHD7 PE=1 SV=3 990 1108 5.0E-12
sp|A2AJK6|CHD7_MOUSE Chromodomain-helicase-DNA-binding protein 7 OS=Mus musculus GN=Chd7 PE=1 SV=1 990 1108 6.0E-12
sp|Q9VDY1|INO80_DROME Putative DNA helicase Ino80 OS=Drosophila melanogaster GN=Ino80 PE=1 SV=2 501 745 7.0E-12
sp|Q6EVK6|BRM_ARATH ATP-dependent helicase BRM OS=Arabidopsis thaliana GN=BRM PE=1 SV=1 501 821 7.0E-12
sp|F4HW51|CHR20_ARATH Protein CHROMATIN REMODELING 20 OS=Arabidopsis thaliana GN=ATRX PE=2 SV=2 990 1119 8.0E-12
sp|O14139|HRP3_SCHPO Chromodomain helicase hrp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hrp3 PE=1 SV=1 502 821 1.0E-11
sp|Q9Y4B4|ARIP4_HUMAN Helicase ARIP4 OS=Homo sapiens GN=RAD54L2 PE=1 SV=4 966 1115 1.0E-11
sp|Q6NZP1|ZRAB3_MOUSE DNA annealing helicase and endonuclease ZRANB3 OS=Mus musculus GN=Zranb3 PE=1 SV=1 987 1139 1.0E-11
sp|P41447|GTA_NPVAC Probable global transactivator OS=Autographa californica nuclear polyhedrosis virus GN=GTA PE=3 SV=1 992 1142 2.0E-11
sp|Q9ULG1|INO80_HUMAN DNA helicase INO80 OS=Homo sapiens GN=INO80 PE=1 SV=2 501 826 2.0E-11
sp|P70270|RAD54_MOUSE DNA repair and recombination protein RAD54-like OS=Mus musculus GN=Rad54l PE=1 SV=2 502 831 2.0E-11
sp|Q9NZC9|SMAL1_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Homo sapiens GN=SMARCAL1 PE=1 SV=1 972 1118 2.0E-11
sp|Q6ZPV2|INO80_MOUSE DNA helicase INO80 OS=Mus musculus GN=Ino80 PE=1 SV=2 501 826 3.0E-11
sp|Q92698|RAD54_HUMAN DNA repair and recombination protein RAD54-like OS=Homo sapiens GN=RAD54L PE=1 SV=2 502 837 3.0E-11
sp|Q9ZUL5|CHR19_ARATH Protein CHROMATIN REMODELING 19 OS=Arabidopsis thaliana GN=ETL1 PE=1 SV=1 502 823 3.0E-11
sp|P32657|CHD1_YEAST Chromo domain-containing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHD1 PE=1 SV=1 502 826 3.0E-11
sp|Q57X81|JBP2_TRYB2 Bifunctional helicase and thymine dioxygenase JBP2 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=JBP2 PE=1 SV=1 971 1121 4.0E-11
sp|Q9U7E0|ATRX_CAEEL Transcriptional regulator ATRX homolog OS=Caenorhabditis elegans GN=xnp-1 PE=1 SV=1 987 1133 7.0E-11
sp|Q4QFY1|JBP2_LEIMA Bifunctional helicase and thymine dioxygenase JBP2 OS=Leishmania major GN=JBP2 PE=3 SV=2 983 1114 1.0E-10
sp|A4HVU6|JBP2_LEIIN Bifunctional helicase and thymine dioxygenase JBP2 OS=Leishmania infantum GN=JBP2 PE=3 SV=2 983 1114 1.0E-10
sp|Q9P793|MIT1_SCHPO Chromatin remodeling factor mit1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mit1 PE=1 SV=1 504 821 2.0E-10
sp|Q5T890|ER6L2_HUMAN DNA excision repair protein ERCC-6-like 2 OS=Homo sapiens GN=ERCC6L2 PE=1 SV=2 499 818 2.0E-10
sp|Q9GQN5|ATRX_DROME Transcriptional regulator ATRX homolog OS=Drosophila melanogaster GN=XNP PE=1 SV=2 990 1118 2.0E-10
sp|E1BB03|ZRAB3_BOVIN DNA annealing helicase and endonuclease ZRANB3 OS=Bos taurus GN=ZRANB3 PE=3 SV=3 504 808 2.0E-10
sp|Q9VMX6|SMAL1_DROME SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Drosophila melanogaster GN=Marcal1 PE=1 SV=2 947 1130 2.0E-10
sp|Q6EVK6|BRM_ARATH ATP-dependent helicase BRM OS=Arabidopsis thaliana GN=BRM PE=1 SV=1 984 1107 3.0E-10
sp|F4HW51|CHR20_ARATH Protein CHROMATIN REMODELING 20 OS=Arabidopsis thaliana GN=ATRX PE=2 SV=2 501 869 4.0E-10
sp|Q5FWF4|ZRAB3_HUMAN DNA annealing helicase and endonuclease ZRANB3 OS=Homo sapiens GN=ZRANB3 PE=1 SV=2 504 808 4.0E-10
sp|Q5FWF4|ZRAB3_HUMAN DNA annealing helicase and endonuclease ZRANB3 OS=Homo sapiens GN=ZRANB3 PE=1 SV=2 987 1139 5.0E-10
sp|B6EU02|JBP2_LEITA Bifunctional helicase and thymine dioxygenase JBP2 OS=Leishmania tarentolae GN=JBP2 PE=1 SV=1 983 1098 5.0E-10
sp|E1BB03|ZRAB3_BOVIN DNA annealing helicase and endonuclease ZRANB3 OS=Bos taurus GN=ZRANB3 PE=3 SV=3 987 1139 6.0E-10
sp|Q4DCH3|JBP2_TRYCC Bifunctional helicase and thymine dioxygenase JBP2 OS=Trypanosoma cruzi (strain CL Brener) GN=JBP2 PE=3 SV=1 971 1114 6.0E-10
sp|A4H7G5|JBP2_LEIBR Bifunctional helicase and thymine dioxygenase JBP2 OS=Leishmania braziliensis GN=JBP2 PE=3 SV=1 983 1114 7.0E-10
sp|Q9JIM3|ER6L2_MOUSE DNA excision repair protein ERCC-6-like 2 OS=Mus musculus GN=Ercc6l2 PE=1 SV=3 502 783 9.0E-10
sp|Q8MNV7|SMAL1_CAEEL Putative SMARCAL1-like protein OS=Caenorhabditis elegans GN=C16A3.1 PE=3 SV=1 992 1126 1.0E-09
sp|P41410|RAD54_SCHPO DNA repair protein rhp54 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp54 PE=1 SV=2 502 822 2.0E-09
sp|A3KMX0|ER6L2_BOVIN DNA excision repair protein ERCC-6-like 2 OS=Bos taurus GN=ERCC6L2 PE=2 SV=3 502 818 4.0E-09
sp|Q09772|RDH54_SCHPO Meiotic recombination protein rdh54 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rdh54 PE=1 SV=3 502 826 5.0E-09
sp|Q9TTA5|SMAL1_BOVIN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Bos taurus GN=SMARCAL1 PE=2 SV=2 972 1118 2.0E-08
sp|F4I8S3|CLSY3_ARATH SNF2 domain-containing protein CLASSY 3 OS=Arabidopsis thaliana GN=CLSY3 PE=1 SV=1 992 1104 3.0E-08
sp|Q498E7|SMAL1_XENLA SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Xenopus laevis GN=smarcal1 PE=2 SV=1 992 1120 5.0E-08
sp|Q9LK10|CLSY4_ARATH SNF2 domain-containing protein CLASSY 4 OS=Arabidopsis thaliana GN=CLSY4 PE=1 SV=1 992 1130 5.0E-08
sp|B2ZFP3|SMAL1_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Danio rerio GN=smarcal1 PE=2 SV=1 992 1123 7.0E-08
sp|Q0P4U8|SMAL1_XENTR SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Xenopus tropicalis GN=smarcal1 PE=2 SV=1 992 1118 8.0E-08
sp|Q14527|HLTF_HUMAN Helicase-like transcription factor OS=Homo sapiens GN=HLTF PE=1 SV=2 410 524 4.0E-07
sp|Q9M297|CLSY1_ARATH SNF2 domain-containing protein CLASSY 1 OS=Arabidopsis thaliana GN=CLSY1 PE=1 SV=1 981 1121 8.0E-07
sp|Q95216|HLTF_RABIT Helicase-like transcription factor OS=Oryctolagus cuniculus GN=HLTF PE=1 SV=1 410 524 2.0E-06
sp|Q9Y4B4|ARIP4_HUMAN Helicase ARIP4 OS=Homo sapiens GN=RAD54L2 PE=1 SV=4 652 858 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0008270 zinc ion binding Yes
GO:0003676 nucleic acid binding Yes
GO:0005524 ATP binding Yes
GO:0140658 ATP-dependent chromatin remodeler activity Yes
GO:0016787 hydrolase activity Yes
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides Yes
GO:0003674 molecular_function No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0097367 carbohydrate derivative binding No
GO:0032553 ribonucleotide binding No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0046872 metal ion binding No
GO:0005488 binding No
GO:0140097 catalytic activity, acting on DNA No
GO:0046914 transition metal ion binding No
GO:0043169 cation binding No
GO:0043168 anion binding No
GO:0003824 catalytic activity No
GO:0017076 purine nucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0140657 ATP-dependent activity No
GO:0008094 ATP-dependent activity, acting on DNA No
GO:0030554 adenyl nucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4502
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5321
Ophiocordyceps australis map64 (Brazil) OphauB2|3797 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|01702
Ophiocordyceps camponoti-rufipedis Ophun1|6336
Ophiocordyceps kimflemingae Ophio5|4293
Ophiocordyceps subramaniannii Hirsu2|9387

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3797
MENDSFQTPASKRPRLFKDTPRDTLHPEPLLKSSPSREKQALKDEDAPREVLTEIAENGSLPDQSSGLLPESESS
DAKNDESTVAFNQEMFESFVGDKVSRHILAVIQDHCGNSLERAVNMYFDGTFKTLKRKIPSAAKAGRLSCVDALP
QAETLQAQLCHRIPDSRYIGAFGVEGWATRSGTNVIQHGDLVRIERQKIQPPKPPGAKGKLGLSASGGRVNSAAA
RRIDVIVRFTNQSGTEIGRLAKDAANWVSTLIDQKICTFEGTCVFAPERLRTNDTIFLQLRCFLQRSAFDSRSIR
LADDRSTRFFEQEETTEEKDLRLRQVALARLLQEINLQPVKANAAAKGGREGLLRAAEMEEQKQKTAHTASSNTN
AHTAECQGNSSDGEEGQELEQDQLDALYKKAQCFDFDTPEAEPASTFAMTLRPYQKQSLYWMMAKEKDQRGNREP
SLHPLWEEYAWPVKDVDEKDLPQVHGQSRFYVNPYSGELTLDFPVQEQHCLGGILADEMGLGKTIQMLSLIHTHK
SETARQFRPSGGGMSRVKQLPRLVSSSRGVVAAPCTTLVVAPMSLLSQWQSEAEKASKQGSIKIELYYGSEKTSS
LQSLCCAANASSAPDVVITSYGIVLSEFGSIAAKNGDGTFHDGLFSLKFFRVILDEAHHIKNRASKTARACYEIG
AEHRWVLTGTPIVNRLEDLFSLVRFLGVEPWNNFSYWKTFITVPFESGDFMRALNVVQTVLEPLVMRRTKDMKMP
NGEALVRLPPKQIDIVNVELSKAEREVYNYIFQRAKRTFSDSVEAGTVMKAYTTIFAQILRLRQSCCHPVLVRNR
ELVADEQEAGAVADAAAGIGDDMDLESLVAQFTAVTQEAAKESNAFGAHVLEEIRSEAGKECPLCLEEPMQHQLV
TGCWHSACKKCLLGYMEHQRERGVVAKCFNCRGRLNGRDLFEVVRHDDEVDETKDKACPISLQRLGVNESSAKVA
ALIWQLRALRREHRGIKSVVFSQFTSFLSLIEPALERAKMHHLRLDGSMAQRARAAVLQQFGDRQGFTVLLISLR
AGGVGLNLTSAGRVFMMDPWWSFAVEAQAIDRVHRLGQEDEVRVVRFIVRESVEERMLRVQERKKFIASSLGMMS
DEEKKLQRIEDIKELLS*
Coding >OphauB2|3797
ATGGAAAATGACTCCTTTCAGACGCCTGCGTCAAAGAGGCCGAGGCTTTTCAAGGATACGCCCAGGGACACGTTG
CATCCTGAACCGTTGCTGAAATCCTCTCCATCCCGCGAGAAGCAGGCGCTCAAGGACGAGGACGCGCCTCGCGAA
GTCCTGACCGAGATTGCAGAGAATGGATCCTTGCCCGACCAAAGCTCAGGCCTGTTACCAGAGTCAGAATCCTCA
GACGCCAAAAACGATGAGTCGACCGTCGCATTCAACCAGGAGATGTTTGAGAGCTTCGTTGGCGACAAGGTCAGT
CGCCATATCCTGGCTGTCATACAAGATCATTGTGGCAATAGCTTGGAGCGCGCTGTAAACATGTATTTCGACGGC
ACGTTCAAGACGCTCAAGAGAAAGATTCCATCTGCTGCCAAGGCCGGCCGGTTGTCTTGCGTGGACGCTTTGCCA
CAGGCCGAAACGCTCCAGGCTCAGCTGTGCCACAGGATTCCCGACTCGAGATACATTGGCGCCTTTGGTGTTGAA
GGCTGGGCGACGCGGAGCGGCACCAATGTTATCCAGCACGGCGACCTTGTCAGGATTGAGCGCCAGAAAATCCAG
CCTCCTAAGCCGCCTGGGGCCAAAGGTAAGCTTGGTCTGTCTGCTTCAGGAGGTCGAGTCAACAGCGCAGCGGCG
CGACGAATCGATGTAATTGTACGGTTTACCAACCAGTCGGGCACTGAAATCGGACGACTGGCAAAAGACGCGGCG
AATTGGGTCTCGACACTTATTGATCAGAAGATTTGCACCTTTGAGGGCACATGCGTATTTGCACCGGAGCGTCTC
CGCACAAATGACACTATTTTCTTGCAGTTACGCTGTTTCCTGCAACGGTCAGCCTTTGACAGCCGCAGCATCAGA
CTTGCCGACGACCGGTCAACCAGATTCTTCGAACAAGAAGAAACCACAGAAGAGAAGGACTTGCGACTGCGTCAG
GTTGCCTTGGCCAGACTGTTGCAGGAGATCAATCTACAGCCAGTAAAGGCCAATGCCGCAGCCAAGGGCGGGCGA
GAAGGACTCCTCCGGGCTGCTGAGATGGAGGAGCAGAAGCAAAAGACAGCCCACACGGCTTCTTCCAACACCAAT
GCGCACACGGCTGAGTGTCAGGGAAATTCTTCTGATGGGGAAGAGGGCCAGGAGCTTGAACAGGACCAGCTCGAC
GCCCTGTACAAAAAGGCTCAATGCTTTGACTTTGACACTCCGGAAGCCGAGCCGGCATCGACGTTTGCCATGACG
CTCCGCCCCTACCAGAAACAGTCGCTGTATTGGATGATGGCCAAGGAGAAAGACCAACGGGGCAACAGGGAGCCA
TCATTGCACCCTCTCTGGGAAGAATACGCTTGGCCCGTCAAGGATGTTGACGAAAAGGACCTGCCCCAGGTACAC
GGCCAATCAAGGTTTTATGTCAACCCGTACTCGGGAGAGCTGACGCTCGACTTTCCCGTTCAAGAGCAGCACTGC
CTGGGGGGCATCTTGGCCGATGAAATGGGGCTGGGCAAGACAATTCAGATGCTCAGTCTCATCCACACTCACAAG
TCAGAGACGGCTCGTCAATTCCGACCCTCTGGTGGGGGCATGTCGAGGGTGAAGCAGTTGCCGAGGCTAGTAAGC
AGCTCAAGGGGCGTTGTTGCAGCTCCCTGTACAACTCTAGTCGTTGCGCCCATGTCTCTGCTGTCACAATGGCAA
AGCGAGGCGGAAAAGGCGTCCAAGCAGGGTAGCATCAAGATTGAGCTATACTATGGCAGCGAAAAAACTAGCAGC
CTCCAGTCGTTGTGCTGTGCTGCCAATGCCTCGAGCGCTCCCGATGTCGTCATTACAAGCTACGGCATCGTGCTG
TCAGAGTTTGGCAGCATTGCAGCCAAGAATGGCGATGGAACGTTTCACGACGGGCTTTTCTCGCTCAAGTTTTTT
CGCGTGATTCTCGACGAGGCCCATCACATCAAGAACCGAGCATCCAAGACGGCCCGGGCATGCTACGAGATTGGG
GCGGAGCATAGATGGGTACTTACAGGGACGCCCATTGTCAACAGGCTTGAGGACCTGTTCAGCTTGGTGCGCTTT
CTCGGAGTTGAGCCGTGGAACAACTTTTCCTATTGGAAGACATTCATCACGGTGCCGTTTGAGTCGGGGGATTTT
ATGCGTGCCCTCAATGTTGTTCAGACGGTTCTAGAGCCGTTGGTGATGCGGCGGACCAAGGACATGAAGATGCCC
AATGGCGAAGCATTGGTGCGGCTGCCACCAAAGCAGATTGACATTGTCAACGTGGAGCTGTCCAAGGCGGAGCGA
GAAGTATACAACTACATCTTTCAGCGAGCGAAGCGGACCTTTTCGGACAGTGTGGAGGCCGGGACTGTCATGAAG
GCCTACACCACCATTTTTGCGCAGATTCTGCGGCTGCGGCAGTCGTGTTGCCATCCCGTCTTGGTGCGCAACAGG
GAACTGGTGGCGGATGAGCAAGAGGCGGGAGCAGTAGCCGACGCAGCAGCGGGGATCGGGGACGACATGGATCTC
GAGTCGCTGGTGGCGCAGTTCACGGCAGTGACGCAAGAAGCAGCCAAGGAAAGCAATGCCTTTGGGGCGCACGTG
CTCGAGGAGATTCGCAGCGAGGCGGGCAAGGAGTGTCCGCTGTGCTTGGAGGAGCCGATGCAGCATCAGCTGGTG
ACGGGCTGCTGGCACTCGGCGTGCAAGAAGTGTCTGCTGGGCTACATGGAGCATCAGAGGGAGCGGGGCGTCGTG
GCCAAGTGCTTCAACTGCCGAGGGCGGCTCAACGGCAGGGACCTGTTTGAGGTGGTGAGACACGACGACGAGGTG
GACGAGACCAAGGACAAGGCCTGCCCCATCAGCCTGCAGCGGCTGGGAGTCAATGAGTCGTCGGCCAAGGTGGCA
GCGCTGATATGGCAGCTGCGGGCGCTGCGGCGGGAGCACCGGGGCATCAAGTCGGTCGTCTTTTCGCAGTTTACA
TCGTTCCTGTCGCTCATTGAGCCGGCGCTGGAGCGAGCCAAGATGCACCACCTGCGACTCGACGGCAGCATGGCG
CAGCGGGCGCGGGCTGCTGTGCTGCAACAATTTGGCGACCGACAGGGCTTTACCGTGCTGCTCATTAGTCTGAGG
GCAGGAGGCGTGGGACTCAACCTGACTAGCGCAGGGCGCGTCTTCATGATGGATCCGTGGTGGAGTTTTGCCGTT
GAGGCGCAGGCCATTGACCGGGTGCATCGCCTGGGGCAGGAGGATGAGGTGCGCGTGGTGCGATTTATTGTCAGG
GAGAGCGTCGAGGAGCGCATGTTGCGAGTTCAGGAGCGCAAAAAGTTTATAGCATCGTCTCTGGGCATGATGAGC
GACGAGGAAAAGAAACTGCAGCGCATCGAGGATATCAAGGAGCTGCTAAGCTAA
Transcript >OphauB2|3797
ATGGAAAATGACTCCTTTCAGACGCCTGCGTCAAAGAGGCCGAGGCTTTTCAAGGATACGCCCAGGGACACGTTG
CATCCTGAACCGTTGCTGAAATCCTCTCCATCCCGCGAGAAGCAGGCGCTCAAGGACGAGGACGCGCCTCGCGAA
GTCCTGACCGAGATTGCAGAGAATGGATCCTTGCCCGACCAAAGCTCAGGCCTGTTACCAGAGTCAGAATCCTCA
GACGCCAAAAACGATGAGTCGACCGTCGCATTCAACCAGGAGATGTTTGAGAGCTTCGTTGGCGACAAGGTCAGT
CGCCATATCCTGGCTGTCATACAAGATCATTGTGGCAATAGCTTGGAGCGCGCTGTAAACATGTATTTCGACGGC
ACGTTCAAGACGCTCAAGAGAAAGATTCCATCTGCTGCCAAGGCCGGCCGGTTGTCTTGCGTGGACGCTTTGCCA
CAGGCCGAAACGCTCCAGGCTCAGCTGTGCCACAGGATTCCCGACTCGAGATACATTGGCGCCTTTGGTGTTGAA
GGCTGGGCGACGCGGAGCGGCACCAATGTTATCCAGCACGGCGACCTTGTCAGGATTGAGCGCCAGAAAATCCAG
CCTCCTAAGCCGCCTGGGGCCAAAGGTAAGCTTGGTCTGTCTGCTTCAGGAGGTCGAGTCAACAGCGCAGCGGCG
CGACGAATCGATGTAATTGTACGGTTTACCAACCAGTCGGGCACTGAAATCGGACGACTGGCAAAAGACGCGGCG
AATTGGGTCTCGACACTTATTGATCAGAAGATTTGCACCTTTGAGGGCACATGCGTATTTGCACCGGAGCGTCTC
CGCACAAATGACACTATTTTCTTGCAGTTACGCTGTTTCCTGCAACGGTCAGCCTTTGACAGCCGCAGCATCAGA
CTTGCCGACGACCGGTCAACCAGATTCTTCGAACAAGAAGAAACCACAGAAGAGAAGGACTTGCGACTGCGTCAG
GTTGCCTTGGCCAGACTGTTGCAGGAGATCAATCTACAGCCAGTAAAGGCCAATGCCGCAGCCAAGGGCGGGCGA
GAAGGACTCCTCCGGGCTGCTGAGATGGAGGAGCAGAAGCAAAAGACAGCCCACACGGCTTCTTCCAACACCAAT
GCGCACACGGCTGAGTGTCAGGGAAATTCTTCTGATGGGGAAGAGGGCCAGGAGCTTGAACAGGACCAGCTCGAC
GCCCTGTACAAAAAGGCTCAATGCTTTGACTTTGACACTCCGGAAGCCGAGCCGGCATCGACGTTTGCCATGACG
CTCCGCCCCTACCAGAAACAGTCGCTGTATTGGATGATGGCCAAGGAGAAAGACCAACGGGGCAACAGGGAGCCA
TCATTGCACCCTCTCTGGGAAGAATACGCTTGGCCCGTCAAGGATGTTGACGAAAAGGACCTGCCCCAGGTACAC
GGCCAATCAAGGTTTTATGTCAACCCGTACTCGGGAGAGCTGACGCTCGACTTTCCCGTTCAAGAGCAGCACTGC
CTGGGGGGCATCTTGGCCGATGAAATGGGGCTGGGCAAGACAATTCAGATGCTCAGTCTCATCCACACTCACAAG
TCAGAGACGGCTCGTCAATTCCGACCCTCTGGTGGGGGCATGTCGAGGGTGAAGCAGTTGCCGAGGCTAGTAAGC
AGCTCAAGGGGCGTTGTTGCAGCTCCCTGTACAACTCTAGTCGTTGCGCCCATGTCTCTGCTGTCACAATGGCAA
AGCGAGGCGGAAAAGGCGTCCAAGCAGGGTAGCATCAAGATTGAGCTATACTATGGCAGCGAAAAAACTAGCAGC
CTCCAGTCGTTGTGCTGTGCTGCCAATGCCTCGAGCGCTCCCGATGTCGTCATTACAAGCTACGGCATCGTGCTG
TCAGAGTTTGGCAGCATTGCAGCCAAGAATGGCGATGGAACGTTTCACGACGGGCTTTTCTCGCTCAAGTTTTTT
CGCGTGATTCTCGACGAGGCCCATCACATCAAGAACCGAGCATCCAAGACGGCCCGGGCATGCTACGAGATTGGG
GCGGAGCATAGATGGGTACTTACAGGGACGCCCATTGTCAACAGGCTTGAGGACCTGTTCAGCTTGGTGCGCTTT
CTCGGAGTTGAGCCGTGGAACAACTTTTCCTATTGGAAGACATTCATCACGGTGCCGTTTGAGTCGGGGGATTTT
ATGCGTGCCCTCAATGTTGTTCAGACGGTTCTAGAGCCGTTGGTGATGCGGCGGACCAAGGACATGAAGATGCCC
AATGGCGAAGCATTGGTGCGGCTGCCACCAAAGCAGATTGACATTGTCAACGTGGAGCTGTCCAAGGCGGAGCGA
GAAGTATACAACTACATCTTTCAGCGAGCGAAGCGGACCTTTTCGGACAGTGTGGAGGCCGGGACTGTCATGAAG
GCCTACACCACCATTTTTGCGCAGATTCTGCGGCTGCGGCAGTCGTGTTGCCATCCCGTCTTGGTGCGCAACAGG
GAACTGGTGGCGGATGAGCAAGAGGCGGGAGCAGTAGCCGACGCAGCAGCGGGGATCGGGGACGACATGGATCTC
GAGTCGCTGGTGGCGCAGTTCACGGCAGTGACGCAAGAAGCAGCCAAGGAAAGCAATGCCTTTGGGGCGCACGTG
CTCGAGGAGATTCGCAGCGAGGCGGGCAAGGAGTGTCCGCTGTGCTTGGAGGAGCCGATGCAGCATCAGCTGGTG
ACGGGCTGCTGGCACTCGGCGTGCAAGAAGTGTCTGCTGGGCTACATGGAGCATCAGAGGGAGCGGGGCGTCGTG
GCCAAGTGCTTCAACTGCCGAGGGCGGCTCAACGGCAGGGACCTGTTTGAGGTGGTGAGACACGACGACGAGGTG
GACGAGACCAAGGACAAGGCCTGCCCCATCAGCCTGCAGCGGCTGGGAGTCAATGAGTCGTCGGCCAAGGTGGCA
GCGCTGATATGGCAGCTGCGGGCGCTGCGGCGGGAGCACCGGGGCATCAAGTCGGTCGTCTTTTCGCAGTTTACA
TCGTTCCTGTCGCTCATTGAGCCGGCGCTGGAGCGAGCCAAGATGCACCACCTGCGACTCGACGGCAGCATGGCG
CAGCGGGCGCGGGCTGCTGTGCTGCAACAATTTGGCGACCGACAGGGCTTTACCGTGCTGCTCATTAGTCTGAGG
GCAGGAGGCGTGGGACTCAACCTGACTAGCGCAGGGCGCGTCTTCATGATGGATCCGTGGTGGAGTTTTGCCGTT
GAGGCGCAGGCCATTGACCGGGTGCATCGCCTGGGGCAGGAGGATGAGGTGCGCGTGGTGCGATTTATTGTCAGG
GAGAGCGTCGAGGAGCGCATGTTGCGAGTTCAGGAGCGCAAAAAGTTTATAGCATCGTCTCTGGGCATGATGAGC
GACGAGGAAAAGAAACTGCAGCGCATCGAGGATATCAAGGAGCTGCTAAGCTAA
Gene >OphauB2|3797
ATGGAAAATGACTCCTTTCAGACGCCTGCGTCAAAGAGGCCGAGGCTTTTCAAGGATACGCCCAGGGACACGTTG
CATCCTGAACCGTTGCTGAAATCCTCTCCATCCCGCGAGAAGCAGGCGCTCAAGGACGAGGACGCGCCTCGCGAA
GTCCTGACCGAGATTGCAGAGAATGGATCCTTGCCCGACCAAAGCTCAGGCCTGTTACCAGAGTCAGAATCCTCA
GACGCCAAAAACGATGAGTCGACCGTCGCATTCAACCAGGAGATGTTTGAGAGCTTCGTTGGCGACAAGGTCAGT
CGCCATATCCTGGCTGTCATACAAGATCATTGTGGCAATAGCTTGGAGCGCGCTGTAAACATGTATTTCGACGGC
ACGTTCAAGACGCTCAAGAGAAAGATTCCATCTGCTGCCAAGGCCGGCCGGTTGTCTTGCGTGGACGCTTTGCCA
CAGGCCGAAACGCTCCAGGCTCAGCTGTGCCACAGGATTCCCGACTCGAGATACATTGGCGCCTTTGGTGTTGAA
GGCTGGGCGACGCGGAGCGGCACCAATGTTATCCAGCACGGCGACCTTGTCAGGATTGAGCGCCAGAAAATCCAG
CCTCCTAAGCCGCCTGGGGCCAAAGGTAAGCTTGGTCTGTCTGCTTCAGGAGGTCGAGTCAACAGCGCAGCGGCG
CGACGAATCGATGTAATTGTACGGTTTACCAACCAGTCGGGCACTGAAATCGGACGACTGGCAAAAGACGCGGCG
AATTGGGTCTCGACACTTATTGATCAGAAGATTTGCACCTTTGAGGGCACATGCGTATTTGCACCGGAGCGTCTC
CGCACAAATGACACTATTTTCTTGCAGTTACGCTGTTTCCTGCAACGGTCAGCCTTTGACAGCCGCAGCATCAGA
CTTGCCGACGACCGGTCAACCAGATTCTTCGAACAAGAAGAAACCACAGAAGAGAAGGACTTGCGACTGCGTCAG
GTTGCCTTGGCCAGACTGTTGCAGGAGATCAATCTACAGCCAGTAAAGGCCAATGCCGCAGCCAAGGGCGGGCGA
GAAGGACTCCTCCGGGCTGCTGAGATGGAGGAGCAGAAGCAAAAGACAGCCCACACGGCTTCTTCCAACACCAAT
GCGCACACGGCTGAGTGTCAGGGAAATTCTTCTGATGGGGAAGAGGGCCAGGAGCTTGAACAGGACCAGCTCGAC
GCCCTGTACAAAAAGGCTCAATGCTTTGACTTTGACACTCCGGAAGCCGAGCCGGCATCGACGTTTGCCATGACG
CTCCGCCCCTACCAGAAACAGTCGCTGTATTGGATGATGGCCAAGGAGAAAGACCAACGGGGCAACAGGGAGCCA
TCATTGCACCCTCTCTGGGAAGAATACGCTTGGCCCGTCAAGGATGTTGACGAAAAGGACCTGCCCCAGGTACAC
GGCCAATCAAGGTTTTATGTCAACCCGTACTCGGGAGAGCTGACGCTCGACTTTCCCGTTCAAGAGCAGCACTGC
CTGGGGGGCATCTTGGCCGATGAAATGGGGCTGGGCAAGACAATTCAGATGCTCAGTCTCATCCACACTCACAAG
TCAGAGACGGCTCGTCAATTCCGACCCTCTGGTGGGGGCATGTCGAGGGTGAAGCAGTTGCCGAGGCTAGTAAGC
AGCTCAAGGGGCGTTGTTGCAGCTCCCTGTACAACTCTAGTCGTTGCGCCCATGTCTCTGCTGTCACAATGGCAA
AGCGAGGCGGAAAAGGCGTCCAAGCAGGGTAGCATCAAGATTGAGCTATACTATGGCAGCGAAAAAACTAGCAGC
CTCCAGTCGTTGTGCTGTGCTGCCAATGCCTCGAGCGCTCCCGATGTCGTCATTACAAGCTACGGCATCGTGCTG
TCAGAGTTTGGCAGCATTGCAGCCAAGAATGGCGATGGAACGTTTCACGACGGGCTTTTCTCGCTCAAGTTTTTT
CGCGTGATTCTCGACGAGGCCCATCACATCAAGAACCGAGCATCCAAGACGGCCCGGGCATGCTACGAGATTGGG
GCGGAGCATAGATGGGTACTTACAGGGACGCCCATTGTCAACAGGCTTGAGGACCTGTTCAGCTTGGTGCGCTTT
CTCGGAGTTGAGCCGTGGAACAACTTTTCCTATTGGAAGACATTCATCACGGTGCCGTTTGAGTCGGGGGATTTT
ATGCGTGCCCTCAATGTTGTTCAGACGGTTCTAGAGCCGTTGGTGATGCGGCGGACCAAGGACATGAAGATGCCC
AATGGCGAAGCATTGGTGCGGCTGCCACCAAAGCAGATTGACATTGTCAACGTGGAGCTGTCCAAGGCGGAGCGA
GAAGTATACAACTACATCTTTCAGCGAGCGAAGCGGACCTTTTCGGACAGTGTGGAGGCCGGGACTGTCATGAAG
GCCTACACCACCATTTTTGCGCAGATTCTGCGGCTGCGGCAGTCGTGTTGCCATCCCGTCTTGGTGCGCAACAGG
GAACTGGTGGCGGATGAGCAAGAGGCGGGAGCAGTAGCCGACGCAGCAGCGGGGATCGGGGACGACATGGATCTC
GAGTCGCTGGTGGCGCAGTTCACGGCAGTGACGCAAGAAGCAGCCAAGGAAAGCAATGCCTTTGGGGCGCACGTG
CTCGAGGAGATTCGCAGCGAGGCGGGCAAGGAGTGTCCGCTGTGCTTGGAGGAGCCGATGCAGCATCAGCTGGTG
ACGGGCTGCTGGCACTCGGCGTGCAAGAAGTGTCTGCTGGGCTACATGGAGCATCAGAGGGAGCGGGGCGTCGTG
GCCAAGTGCTTCAACTGCCGAGGGCGGCTCAACGGCAGGGACCTGTTTGAGGTGGTGAGACACGACGACGAGGTG
GACGAGACCAAGGACAAGGCCTGCCCCATCAGCCTGCAGCGGCTGGGAGTCAATGAGTCGTCGGCCAAGGTGGCA
GCGCTGATATGGCAGCTGCGGGCGCTGCGGCGGGAGCACCGGGGCATCAAGTCGGTCGTCTTTTCGCAGTTTACA
TCGTTCCTGTCGCTCATTGAGCCGGCGCTGGAGCGAGCCAAGATGCACCACCTGCGACTCGACGGCAGCATGGCG
CAGCGGGCGCGGGCTGCTGTGCTGCAACAATTTGGCGACCGACAGGGCTTTACCGTGCTGCTCATTAGTCTGAGG
GCAGGAGGCGTGGGACTCAACCTGACTAGCGCAGGGCGCGTCTTCATGATGGATCCGTGGTGGAGTTTTGCCGTT
GAGGCGCAGGCCATTGACCGGGTGCATCGCCTGGGGCAGGAGGATGAGGTGCGCGTGGTGCGATTTATTGTCAGG
GAGAGCGTCGAGGAGCGCATGTTGCGAGTTCAGGAGCGCAAAAAGTTTATGTGAGTCGTCGTCGTCTTCGTCGTC
TTTCTTTCTTTTTTTTTTTTCCTTTTTCTTTTTTCTTTCTTTTTTCTTCTTTTTTCTTTCTTCTTTTTCCCTTTT
CTCATCTCGACACGACGCATGCCAAGTACCGAGATTGGGATGGGCGGGCTGACCCCTTCTTGTTGTCTTGCAGAG
CATCGTCTCTGGGCATGATGAGCGACGAGGAAAAGAAACTGCAGCGCATCGAGGATATCAAGGAGCTGCTAAGCT
AA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail