Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3794
Gene name
LocationContig_24:190973..192069
Strand-
Gene length (bp)1096
Transcript length (bp)990
Coding sequence length (bp)990
Protein length (aa) 330

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00106 adh_short short chain dehydrogenase 3.8E-19 29 174
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 1.2E-10 34 245
PF08659 KR KR domain 9.1E-08 29 115

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8BYK4|RDH12_MOUSE Retinol dehydrogenase 12 OS=Mus musculus GN=Rdh12 PE=2 SV=1 27 318 3.0E-21
sp|Q8NBN7|RDH13_HUMAN Retinol dehydrogenase 13 OS=Homo sapiens GN=RDH13 PE=1 SV=2 27 325 2.0E-20
sp|Q8TC12|RDH11_HUMAN Retinol dehydrogenase 11 OS=Homo sapiens GN=RDH11 PE=1 SV=2 27 253 3.0E-20
sp|P59837|RDH12_BOVIN Retinol dehydrogenase 12 OS=Bos taurus GN=RDH12 PE=2 SV=1 27 289 4.0E-20
sp|Q96NR8|RDH12_HUMAN Retinol dehydrogenase 12 OS=Homo sapiens GN=RDH12 PE=1 SV=3 27 294 2.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8BYK4|RDH12_MOUSE Retinol dehydrogenase 12 OS=Mus musculus GN=Rdh12 PE=2 SV=1 27 318 3.0E-21
sp|Q8NBN7|RDH13_HUMAN Retinol dehydrogenase 13 OS=Homo sapiens GN=RDH13 PE=1 SV=2 27 325 2.0E-20
sp|Q8TC12|RDH11_HUMAN Retinol dehydrogenase 11 OS=Homo sapiens GN=RDH11 PE=1 SV=2 27 253 3.0E-20
sp|P59837|RDH12_BOVIN Retinol dehydrogenase 12 OS=Bos taurus GN=RDH12 PE=2 SV=1 27 289 4.0E-20
sp|Q96NR8|RDH12_HUMAN Retinol dehydrogenase 12 OS=Homo sapiens GN=RDH12 PE=1 SV=3 27 294 2.0E-19
sp|Q6RVV4|TIC32_PEA Short-chain dehydrogenase TIC 32, chloroplastic OS=Pisum sativum GN=TIC32 PE=1 SV=1 24 255 4.0E-19
sp|Q8CEE7|RDH13_MOUSE Retinol dehydrogenase 13 OS=Mus musculus GN=Rdh13 PE=1 SV=1 6 313 5.0E-19
sp|O74959|YJCD_SCHPO Uncharacterized oxidoreductase C736.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC736.13 PE=3 SV=1 15 255 3.0E-18
sp|Q9QYF1|RDH11_MOUSE Retinol dehydrogenase 11 OS=Mus musculus GN=Rdh11 PE=1 SV=2 27 290 4.0E-18
sp|Q9ERI6|RDH14_MOUSE Retinol dehydrogenase 14 OS=Mus musculus GN=Rdh14 PE=1 SV=1 27 311 1.0E-16
sp|Q9HBH5|RDH14_HUMAN Retinol dehydrogenase 14 OS=Homo sapiens GN=RDH14 PE=1 SV=1 27 311 3.0E-16
sp|A2RVM0|TIC32_ARATH Short-chain dehydrogenase TIC 32, chloroplastic OS=Arabidopsis thaliana GN=TIC32 PE=2 SV=1 24 311 4.0E-15
sp|Q5SS80|DHR13_MOUSE Dehydrogenase/reductase SDR family member 13 OS=Mus musculus GN=Dhrs13 PE=1 SV=1 27 296 4.0E-14
sp|Q17QU7|DHR13_BOVIN Dehydrogenase/reductase SDR family member 13 OS=Bos taurus GN=DHRS13 PE=2 SV=1 27 296 7.0E-13
sp|Q9VLU5|WWOX_DROME WW domain-containing oxidoreductase OS=Drosophila melanogaster GN=Wwox PE=2 SV=1 23 245 2.0E-12
sp|Q6UX07|DHR13_HUMAN Dehydrogenase/reductase SDR family member 13 OS=Homo sapiens GN=DHRS13 PE=2 SV=1 27 296 2.0E-12
sp|Q91WL8|WWOX_MOUSE WW domain-containing oxidoreductase OS=Mus musculus GN=Wwox PE=1 SV=1 24 232 4.0E-12
sp|Q5F389|WWOX_CHICK WW domain-containing oxidoreductase OS=Gallus gallus GN=WWOX PE=2 SV=2 24 232 6.0E-12
sp|Q9NZC7|WWOX_HUMAN WW domain-containing oxidoreductase OS=Homo sapiens GN=WWOX PE=1 SV=1 24 232 6.0E-12
sp|Q5R9W5|WWOX_PONAB WW domain-containing oxidoreductase OS=Pongo abelii GN=WWOX PE=2 SV=1 24 232 1.0E-11
sp|Q8N5I4|DHRSX_HUMAN Dehydrogenase/reductase SDR family member on chromosome X OS=Homo sapiens GN=DHRSX PE=2 SV=2 19 242 3.0E-11
sp|Q92247|BLI4_NEUCR Putative oxidoreductase bli-4, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=bli-4 PE=1 SV=1 22 260 1.0E-10
sp|A6QP05|DHR12_BOVIN Dehydrogenase/reductase SDR family member 12 OS=Bos taurus GN=DHRS12 PE=2 SV=1 27 240 2.0E-10
sp|O75828|CBR3_HUMAN Carbonyl reductase [NADPH] 3 OS=Homo sapiens GN=CBR3 PE=1 SV=3 28 238 2.0E-10
sp|O80333|POR_MARPA Protochlorophyllide reductase, chloroplastic OS=Marchantia paleacea GN=PORA PE=2 SV=1 19 241 8.0E-10
sp|Q08651|ENV9_YEAST Probable oxidoreductase ENV9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENV9 PE=1 SV=1 18 257 2.0E-09
sp|P35320|OXIR_STRLI Probable oxidoreductase OS=Streptomyces lividans PE=3 SV=1 24 240 2.0E-09
sp|Q071N0|SALR_PAPSO Salutaridine reductase OS=Papaver somniferum GN=SALR PE=1 SV=1 28 238 2.0E-09
sp|Q03326|OXIR_STRAT Probable oxidoreductase OS=Streptomyces antibioticus PE=3 SV=1 24 240 4.0E-09
sp|Q8MI29|CBR1_MACFA Carbonyl reductase [NADPH] 1 OS=Macaca fascicularis GN=CBR1 PE=2 SV=1 28 238 5.0E-09
sp|Q9RPT1|RHLG_PSEAE Rhamnolipids biosynthesis 3-oxoacyl-[acyl-carrier-protein] reductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rhlG PE=1 SV=1 21 246 7.0E-09
sp|Q8K354|CBR3_MOUSE Carbonyl reductase [NADPH] 3 OS=Mus musculus GN=Cbr3 PE=1 SV=1 28 243 7.0E-09
sp|A0PJE2|DHR12_HUMAN Dehydrogenase/reductase SDR family member 12 OS=Homo sapiens GN=DHRS12 PE=2 SV=2 27 240 7.0E-09
sp|Q8VBZ0|DHRSX_MOUSE Dehydrogenase/reductase SDR family member on chromosome X homolog OS=Mus musculus GN=Dhrsx PE=1 SV=2 19 276 1.0E-08
sp|Q28960|CBR1_PIG Carbonyl reductase [NADPH] 1 OS=Sus scrofa GN=CBR1 PE=1 SV=3 28 312 2.0E-08
sp|Q9ZAU1|DNRU_STRPE Putative daunorubicin C-13 ketoreductase DnrU OS=Streptomyces peucetius GN=dnrU PE=3 SV=1 21 311 2.0E-08
sp|Q5RCU5|CBR1_PONAB Carbonyl reductase [NADPH] 1 OS=Pongo abelii GN=CBR1 PE=2 SV=3 31 238 2.0E-08
sp|A4UHT7|SALR_PAPBR Salutaridine reductase OS=Papaver bracteatum GN=SALR PE=1 SV=1 28 238 2.0E-08
sp|Q42536|PORA_ARATH Protochlorophyllide reductase A, chloroplastic OS=Arabidopsis thaliana GN=PORA PE=1 SV=2 29 153 4.0E-08
sp|O66148|POR_LEPBY Light-dependent protochlorophyllide reductase OS=Leptolyngbya boryana GN=por PE=3 SV=2 29 241 4.0E-08
sp|Q803A8|WWOX_DANRE WW domain-containing oxidoreductase OS=Danio rerio GN=wwox PE=2 SV=1 23 254 5.0E-08
sp|Q39617|POR_CHLRE Protochlorophyllide reductase, chloroplastic OS=Chlamydomonas reinhardtii GN=PORA PE=3 SV=1 28 241 5.0E-08
sp|P16152|CBR1_HUMAN Carbonyl reductase [NADPH] 1 OS=Homo sapiens GN=CBR1 PE=1 SV=3 31 238 6.0E-08
sp|P47844|CBR1_RABIT Carbonyl reductase [NADPH] 1 OS=Oryctolagus cuniculus GN=CBR1 PE=2 SV=2 28 238 1.0E-07
sp|P46331|YXBG_BACSU Uncharacterized oxidoreductase YxbG OS=Bacillus subtilis (strain 168) GN=yxbG PE=3 SV=2 28 243 1.0E-07
sp|Q49WS9|Y1627_STAS1 Uncharacterized oxidoreductase SSP1627 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP1627 PE=3 SV=1 28 175 2.0E-07
sp|P28845|DHI1_HUMAN Corticosteroid 11-beta-dehydrogenase isozyme 1 OS=Homo sapiens GN=HSD11B1 PE=1 SV=3 20 203 2.0E-07
sp|Q53877|DNRU_STRS5 Putative daunorubicin C-13 ketoreductase DnrU OS=Streptomyces sp. (strain C5) PE=3 SV=1 21 311 3.0E-07
sp|P37959|YUSZ_BACSU Uncharacterized oxidoreductase YusZ OS=Bacillus subtilis (strain 168) GN=yusZ PE=3 SV=2 28 186 5.0E-07
sp|O48741|PORC_ARATH Protochlorophyllide reductase C, chloroplastic OS=Arabidopsis thaliana GN=PORC PE=1 SV=1 21 116 5.0E-07
sp|Q8W3D9|PORB_ORYSJ Protochlorophyllide reductase B, chloroplastic OS=Oryza sativa subsp. japonica GN=PORB PE=2 SV=1 29 150 5.0E-07
sp|Q8K9J5|FABG_BUCAP 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=fabG PE=3 SV=1 28 246 5.0E-07
sp|Q9Z8P2|FABG_CHLPN 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Chlamydia pneumoniae GN=fabG PE=3 SV=1 27 238 5.0E-07
sp|P66780|Y1570_MYCBO Uncharacterized oxidoreductase Mb1570 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1570 PE=3 SV=1 27 168 8.0E-07
sp|P9WGS1|Y1543_MYCTU Uncharacterized oxidoreductase Rv1543 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1543 PE=1 SV=1 27 168 8.0E-07
sp|P9WGS0|Y1543_MYCTO Uncharacterized oxidoreductase MT1595 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1595 PE=3 SV=1 27 168 8.0E-07
sp|Q7M3I4|DHI1_RABIT Corticosteroid 11-beta-dehydrogenase isozyme 1 OS=Oryctolagus cuniculus GN=HSD11B1 PE=1 SV=2 20 186 8.0E-07
sp|Q42850|PORB_HORVU Protochlorophyllide reductase B, chloroplastic OS=Hordeum vulgare GN=PORB PE=2 SV=1 21 153 1.0E-06
sp|Q41249|PORA_CUCSA Protochlorophyllide reductase, chloroplastic OS=Cucumis sativus GN=PORA PE=2 SV=1 29 135 1.0E-06
sp|Q71R50|DHR11_CHICK Dehydrogenase/reductase SDR family member 11 OS=Gallus gallus GN=DHRS11 PE=2 SV=1 26 138 2.0E-06
sp|Q6F7B8|ACR1_ACIAD Fatty acyl-CoA reductase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=acr1 PE=1 SV=2 23 159 3.0E-06
sp|Q9SDT1|POR_DAUCA Protochlorophyllide reductase, chloroplastic OS=Daucus carota GN=POR1 PE=2 SV=1 29 116 5.0E-06
sp|P21218|PORB_ARATH Protochlorophyllide reductase B, chloroplastic OS=Arabidopsis thaliana GN=PORB PE=1 SV=3 29 135 5.0E-06
sp|Q59987|POR_SYNY3 Light-dependent protochlorophyllide reductase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=por PE=3 SV=2 29 257 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

Domain # Start End Length
1 128 150 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3794
MAMKALWDMAAGQFFSCLPRPTEDCTGRTVIVTGANTSLGLEAARHLVRLNAAKVIIACRTVEKGEAACRDIEAS
TQRQGVVEVWQLDLSSFDSVKDFASRANKLHRLDVLINNASSMLMRYSRHEGYETMITVNVISTLLLSILLLPIL
RQTGSRFNIVPHIVTVSSEAAFLAFFPQRKAKHVLDKLKTDGSFRERYNTSKLLQLMATRKLAEAIDASHKGRVV
VNALSPGLCKTELFRDMSFFPVNVVRWLMLHVCLPRSCEVGSRTLLAAAFAGDETHGWWMSSCKLRRYWPALMSG
PEGAELTDKIWGELVDVLETTAPDVMAHI*
Coding >OphauB2|3794
ATGGCGATGAAGGCGCTATGGGACATGGCTGCTGGCCAATTTTTTTCCTGTCTACCACGTCCGACAGAAGACTGC
ACCGGCCGCACCGTCATTGTGACGGGCGCGAATACCAGCCTGGGACTGGAAGCAGCAAGACACCTTGTGCGTCTC
AATGCCGCCAAGGTGATTATTGCTTGTCGCACCGTTGAAAAGGGCGAGGCGGCGTGTCGAGATATCGAGGCCTCG
ACGCAGCGCCAGGGAGTCGTCGAGGTCTGGCAGCTCGATTTGAGCTCCTTTGACAGCGTCAAGGACTTTGCGAGT
CGCGCCAATAAGCTCCATCGACTCGATGTGCTCATCAACAATGCCAGCTCCATGCTAATGCGGTACTCGAGGCAC
GAGGGCTACGAGACCATGATTACCGTCAACGTCATCTCGACGCTGCTGCTCTCCATCTTGCTGCTTCCCATTCTG
CGGCAGACTGGCTCACGCTTCAACATTGTGCCTCACATTGTCACGGTGTCGTCGGAAGCGGCATTCTTGGCATTT
TTTCCCCAACGAAAAGCCAAGCACGTGCTCGACAAACTCAAGACGGACGGCAGCTTCAGGGAACGCTACAACACC
AGCAAGCTCCTGCAGCTCATGGCGACGCGCAAGCTGGCCGAGGCGATTGACGCGTCGCACAAGGGCCGCGTCGTG
GTCAATGCGCTCAGCCCGGGCTTGTGCAAGACGGAGCTCTTTCGTGACATGTCCTTTTTCCCAGTAAACGTGGTG
CGGTGGTTAATGTTGCACGTCTGTCTTCCTCGCAGCTGCGAAGTGGGATCGCGCACCCTGCTGGCGGCGGCGTTT
GCGGGCGACGAGACGCATGGCTGGTGGATGAGCAGCTGCAAGTTAAGGCGGTACTGGCCAGCGTTGATGAGCGGG
CCAGAGGGGGCGGAGTTGACGGACAAGATTTGGGGCGAACTGGTTGACGTGCTCGAAACAACTGCCCCTGACGTC
ATGGCCCATATCTAG
Transcript >OphauB2|3794
ATGGCGATGAAGGCGCTATGGGACATGGCTGCTGGCCAATTTTTTTCCTGTCTACCACGTCCGACAGAAGACTGC
ACCGGCCGCACCGTCATTGTGACGGGCGCGAATACCAGCCTGGGACTGGAAGCAGCAAGACACCTTGTGCGTCTC
AATGCCGCCAAGGTGATTATTGCTTGTCGCACCGTTGAAAAGGGCGAGGCGGCGTGTCGAGATATCGAGGCCTCG
ACGCAGCGCCAGGGAGTCGTCGAGGTCTGGCAGCTCGATTTGAGCTCCTTTGACAGCGTCAAGGACTTTGCGAGT
CGCGCCAATAAGCTCCATCGACTCGATGTGCTCATCAACAATGCCAGCTCCATGCTAATGCGGTACTCGAGGCAC
GAGGGCTACGAGACCATGATTACCGTCAACGTCATCTCGACGCTGCTGCTCTCCATCTTGCTGCTTCCCATTCTG
CGGCAGACTGGCTCACGCTTCAACATTGTGCCTCACATTGTCACGGTGTCGTCGGAAGCGGCATTCTTGGCATTT
TTTCCCCAACGAAAAGCCAAGCACGTGCTCGACAAACTCAAGACGGACGGCAGCTTCAGGGAACGCTACAACACC
AGCAAGCTCCTGCAGCTCATGGCGACGCGCAAGCTGGCCGAGGCGATTGACGCGTCGCACAAGGGCCGCGTCGTG
GTCAATGCGCTCAGCCCGGGCTTGTGCAAGACGGAGCTCTTTCGTGACATGTCCTTTTTCCCAGTAAACGTGGTG
CGGTGGTTAATGTTGCACGTCTGTCTTCCTCGCAGCTGCGAAGTGGGATCGCGCACCCTGCTGGCGGCGGCGTTT
GCGGGCGACGAGACGCATGGCTGGTGGATGAGCAGCTGCAAGTTAAGGCGGTACTGGCCAGCGTTGATGAGCGGG
CCAGAGGGGGCGGAGTTGACGGACAAGATTTGGGGCGAACTGGTTGACGTGCTCGAAACAACTGCCCCTGACGTC
ATGGCCCATATCTAG
Gene >OphauB2|3794
ATGGCGATGAAGGCGCTATGGGACATGGCTGCTGGCCAATTTTTTTCCTGTCTACCACGTCCGACAGAAGACTGC
ACCGGCCGCACCGTCATTGTGACGGGCGCGAATACCAGTAGGTTAATGGCAGAGCAACGAGGCCAGTCGAGCTCT
AACTAGCATCAGGCCTGGGACTGGAAGCAGCAAGACACCTTGTGCGTCTCAATGCCGCCAAGGTGATTATTGCTT
GTCGCACCGTTGAAAAGGGCGAGGCGGCGTGTCGAGATATCGAGGCCTCGACGCAGCGCCAGGGAGTCGTCGAGG
TCTGGCAGCTCGATTTGAGCTCCTTTGACAGCGTCAAGGACTTTGCGAGTCGCGCCAATAAGCTCCATCGACTCG
ATGTGCTCATCAACAATGCCAGCTCCATGCTAATGCGGTACTCGAGGCACGAGGGCTACGAGACCATGATTACCG
TCAACGTCATCTCGACGCTGCTGCTCTCCATCTTGCTGCTTCCCATTCTGCGGCAGACTGGCTCACGCTTCAACA
TTGTGCCTCACATTGTCACGGTGTCGTCGGAAGCGGCATTCTTGGTTAGAGTCTTGCAACAGGCAAAGCCCGACT
TGACGCTAACCCAGGGGGAGCGCAGGCATTTTTTCCCCAACGAAAAGCCAAGCACGTGCTCGACAAACTCAAGAC
GGACGGCAGCTTCAGGGAACGCTACAACACCAGCAAGCTCCTGCAGCTCATGGCGACGCGCAAGCTGGCCGAGGC
GATTGACGCGTCGCACAAGGGCCGCGTCGTGGTCAATGCGCTCAGCCCGGGCTTGTGCAAGACGGAGCTCTTTCG
TGACATGTCCTTTTTCCCAGTAAACGTGGTGCGGTGGTTAATGTTGCACGTCTGTCTTCCTCGCAGCTGCGAAGT
GGGATCGCGCACCCTGCTGGCGGCGGCGTTTGCGGGCGACGAGACGCATGGCTGGTGGATGAGCAGCTGCAAGTT
AAGGCGGTACTGGCCAGCGTTGATGAGCGGGCCAGAGGGGGCGGAGTTGACGGACAAGATTTGGGGCGAACTGGT
TGACGTGCTCGAAACAACTGCCCCTGACGTCATGGCCCATATCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail