Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3782
Gene name
LocationContig_24:158218..158956
Strand-
Gene length (bp)738
Transcript length (bp)738
Coding sequence length (bp)738
Protein length (aa) 246

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 23 0.99957

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup11211
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|3782 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3782
MLLSVLTLLAGLLLSSSAHPMDRADADSDSESGYSISTMDTQTTDMSRSASVMSDRGYHSWDEVDISSSPSPEPM
AASRRRGSSAGSVDAGAGPSGVGGATRRRGGVGGGAARRRGGGGAQMADAYSYTVVDEAGRRIAGPRGYGDGDLM
AALGRGEVAEGEVAAAEDEAVGIVEGEARVAGEAEAAEEVEAVEAAEAVEAAEAAEAAEEAAEVAEASGAAGAVE
AIEMVLLPRGGDSRRLWASM*
Coding >OphauB2|3782
ATGCTTCTATCCGTCTTGACCCTCTTGGCCGGGCTACTGCTCAGCAGCAGCGCCCATCCCATGGACCGCGCGGAC
GCCGATTCAGACAGCGAGTCTGGCTACTCGATTAGCACCATGGACACGCAAACAACCGACATGTCGCGCTCTGCC
AGCGTCATGTCAGACAGGGGCTACCACAGCTGGGACGAGGTCGACATTTCGTCGTCGCCGAGCCCCGAGCCCATG
GCTGCGTCTCGACGGCGTGGGTCAAGCGCAGGCAGTGTCGACGCGGGGGCGGGGCCGTCGGGCGTGGGCGGAGCA
ACGAGGCGGCGAGGAGGAGTAGGCGGTGGCGCGGCAAGGCGGCGAGGAGGAGGCGGTGCGCAAATGGCGGATGCG
TATTCCTACACAGTCGTTGACGAGGCGGGAAGGCGAATAGCAGGACCGAGGGGATATGGCGATGGAGACTTGATG
GCGGCGCTGGGGCGGGGGGAAGTGGCAGAGGGAGAGGTGGCGGCGGCAGAGGACGAGGCTGTGGGCATTGTGGAG
GGCGAGGCGAGAGTGGCTGGAGAGGCAGAGGCGGCCGAGGAGGTGGAGGCAGTAGAGGCGGCCGAGGCGGTGGAA
GCGGCAGAGGCGGCAGAGGCGGCAGAGGAGGCGGCAGAGGTAGCCGAGGCGTCGGGGGCGGCGGGAGCTGTCGAG
GCAATTGAAATGGTGCTTTTGCCGCGAGGTGGCGATTCAAGACGATTGTGGGCGAGCATGTAG
Transcript >OphauB2|3782
ATGCTTCTATCCGTCTTGACCCTCTTGGCCGGGCTACTGCTCAGCAGCAGCGCCCATCCCATGGACCGCGCGGAC
GCCGATTCAGACAGCGAGTCTGGCTACTCGATTAGCACCATGGACACGCAAACAACCGACATGTCGCGCTCTGCC
AGCGTCATGTCAGACAGGGGCTACCACAGCTGGGACGAGGTCGACATTTCGTCGTCGCCGAGCCCCGAGCCCATG
GCTGCGTCTCGACGGCGTGGGTCAAGCGCAGGCAGTGTCGACGCGGGGGCGGGGCCGTCGGGCGTGGGCGGAGCA
ACGAGGCGGCGAGGAGGAGTAGGCGGTGGCGCGGCAAGGCGGCGAGGAGGAGGCGGTGCGCAAATGGCGGATGCG
TATTCCTACACAGTCGTTGACGAGGCGGGAAGGCGAATAGCAGGACCGAGGGGATATGGCGATGGAGACTTGATG
GCGGCGCTGGGGCGGGGGGAAGTGGCAGAGGGAGAGGTGGCGGCGGCAGAGGACGAGGCTGTGGGCATTGTGGAG
GGCGAGGCGAGAGTGGCTGGAGAGGCAGAGGCGGCCGAGGAGGTGGAGGCAGTAGAGGCGGCCGAGGCGGTGGAA
GCGGCAGAGGCGGCAGAGGCGGCAGAGGAGGCGGCAGAGGTAGCCGAGGCGTCGGGGGCGGCGGGAGCTGTCGAG
GCAATTGAAATGGTGCTTTTGCCGCGAGGTGGCGATTCAAGACGATTGTGGGCGAGCATGTAG
Gene >OphauB2|3782
ATGCTTCTATCCGTCTTGACCCTCTTGGCCGGGCTACTGCTCAGCAGCAGCGCCCATCCCATGGACCGCGCGGAC
GCCGATTCAGACAGCGAGTCTGGCTACTCGATTAGCACCATGGACACGCAAACAACCGACATGTCGCGCTCTGCC
AGCGTCATGTCAGACAGGGGCTACCACAGCTGGGACGAGGTCGACATTTCGTCGTCGCCGAGCCCCGAGCCCATG
GCTGCGTCTCGACGGCGTGGGTCAAGCGCAGGCAGTGTCGACGCGGGGGCGGGGCCGTCGGGCGTGGGCGGAGCA
ACGAGGCGGCGAGGAGGAGTAGGCGGTGGCGCGGCAAGGCGGCGAGGAGGAGGCGGTGCGCAAATGGCGGATGCG
TATTCCTACACAGTCGTTGACGAGGCGGGAAGGCGAATAGCAGGACCGAGGGGATATGGCGATGGAGACTTGATG
GCGGCGCTGGGGCGGGGGGAAGTGGCAGAGGGAGAGGTGGCGGCGGCAGAGGACGAGGCTGTGGGCATTGTGGAG
GGCGAGGCGAGAGTGGCTGGAGAGGCAGAGGCGGCCGAGGAGGTGGAGGCAGTAGAGGCGGCCGAGGCGGTGGAA
GCGGCAGAGGCGGCAGAGGCGGCAGAGGAGGCGGCAGAGGTAGCCGAGGCGTCGGGGGCGGCGGGAGCTGTCGAG
GCAATTGAAATGGTGCTTTTGCCGCGAGGTGGCGATTCAAGACGATTGTGGGCGAGCATGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail