Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3779
Gene name
LocationContig_24:152153..152838
Strand+
Gene length (bp)685
Transcript length (bp)510
Coding sequence length (bp)510
Protein length (aa) 170

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03134 TB2_DP1_HVA22 TB2/DP1, HVA22 family 4.5E-27 68 142

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q871R7|YOP1_NEUCR Protein yop-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=yop-1 PE=3 SV=1 4 165 2.0E-88
sp|Q51VY4|YOP1_MAGO7 Protein YOP1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=YOP1 PE=3 SV=2 4 169 4.0E-84
sp|Q4WTW3|YOP1_ASPFU Protein yop1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=yop1 PE=3 SV=1 2 169 7.0E-71
sp|Q5BB01|YOP1_EMENI Protein yop1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=yop1 PE=3 SV=1 2 169 8.0E-68
sp|Q6CE07|YOP1_YARLI Protein YOP1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YOP1 PE=3 SV=2 5 169 3.0E-41
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q871R7|YOP1_NEUCR Protein yop-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=yop-1 PE=3 SV=1 4 165 2.0E-88
sp|Q51VY4|YOP1_MAGO7 Protein YOP1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=YOP1 PE=3 SV=2 4 169 4.0E-84
sp|Q4WTW3|YOP1_ASPFU Protein yop1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=yop1 PE=3 SV=1 2 169 7.0E-71
sp|Q5BB01|YOP1_EMENI Protein yop1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=yop1 PE=3 SV=1 2 169 8.0E-68
sp|Q6CE07|YOP1_YARLI Protein YOP1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YOP1 PE=3 SV=2 5 169 3.0E-41
sp|Q9UU91|YOP1_SCHPO Protein yop1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=yop1 PE=1 SV=1 1 163 5.0E-38
sp|Q4P0H0|YOP1_USTMA Protein YOP1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=YOP1 PE=3 SV=1 6 162 1.0E-37
sp|Q6BWH8|YOP1_DEBHA Protein YOP1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=YOP1 PE=3 SV=1 1 168 5.0E-37
sp|Q75A56|YOP1_ASHGO Protein YOP1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=YOP1 PE=3 SV=2 13 166 6.0E-37
sp|P0CN16|YOP1_CRYNJ Protein YOP1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=YOP1 PE=3 SV=1 7 163 8.0E-36
sp|P0CN17|YOP1_CRYNB Protein YOP1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=YOP1 PE=3 SV=1 7 163 8.0E-36
sp|Q6CP93|YOP1_KLULA Protein YOP1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=YOP1 PE=3 SV=1 3 148 5.0E-34
sp|Q12402|YOP1_YEAST Protein YOP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOP1 PE=1 SV=3 8 147 1.0E-31
sp|Q6FMU3|YOP1_CANGA Protein YOP1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=YOP1 PE=3 SV=1 14 168 8.0E-30
sp|Q5RE33|REEP5_PONAB Receptor expression-enhancing protein 5 OS=Pongo abelii GN=REEP5 PE=2 SV=1 24 162 6.0E-28
sp|Q00765|REEP5_HUMAN Receptor expression-enhancing protein 5 OS=Homo sapiens GN=REEP5 PE=1 SV=3 24 162 6.0E-28
sp|Q60870|REEP5_MOUSE Receptor expression-enhancing protein 5 OS=Mus musculus GN=Reep5 PE=1 SV=1 24 162 8.0E-28
sp|B2RZ37|REEP5_RAT Receptor expression-enhancing protein 5 OS=Rattus norvegicus GN=Reep5 PE=1 SV=1 24 162 8.0E-28
sp|Q29RM3|REEP5_BOVIN Receptor expression-enhancing protein 5 OS=Bos taurus GN=REEP5 PE=2 SV=1 24 162 1.0E-27
sp|Q66IF1|REEP6_DANRE Receptor expression-enhancing protein 6 OS=Danio rerio GN=reep6 PE=2 SV=1 23 142 3.0E-27
sp|Q96HR9|REEP6_HUMAN Receptor expression-enhancing protein 6 OS=Homo sapiens GN=REEP6 PE=1 SV=1 24 147 7.0E-23
sp|Q32LG5|REEP6_BOVIN Receptor expression-enhancing protein 6 OS=Bos taurus GN=REEP6 PE=2 SV=1 23 162 5.0E-22
sp|Q5XI60|REEP6_RAT Receptor expression-enhancing protein 6 OS=Rattus norvegicus GN=Reep6 PE=2 SV=1 23 165 9.0E-20
sp|Q9JM62|REEP6_MOUSE Receptor expression-enhancing protein 6 OS=Mus musculus GN=Reep6 PE=1 SV=1 23 162 3.0E-18
sp|Q8STK5|Y9J5_ENCCU Uncharacterized membrane protein ECU09_1950 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU09_1950 PE=1 SV=1 11 165 1.0E-17
sp|Q3ZCI8|REEP4_BOVIN Receptor expression-enhancing protein 4 OS=Bos taurus GN=REEP4 PE=2 SV=1 64 150 2.0E-17
sp|Q10010|YSV4_CAEEL Uncharacterized protein T19C3.4 OS=Caenorhabditis elegans GN=T19C3.4 PE=3 SV=1 56 162 3.0E-17
sp|Q8K072|REEP4_MOUSE Receptor expression-enhancing protein 4 OS=Mus musculus GN=Reep4 PE=1 SV=1 64 150 2.0E-16
sp|Q9BRK0|REEP2_HUMAN Receptor expression-enhancing protein 2 OS=Homo sapiens GN=REEP2 PE=1 SV=2 64 162 3.0E-16
sp|Q6AZM3|REEP4_XENLA Receptor expression-enhancing protein 4 OS=Xenopus laevis GN=reep4 PE=1 SV=1 64 145 3.0E-16
sp|Q99KK1|REEP3_MOUSE Receptor expression-enhancing protein 3 OS=Mus musculus GN=Reep3 PE=1 SV=1 64 145 3.0E-16
sp|Q2KI30|REEP2_BOVIN Receptor expression-enhancing protein 2 OS=Bos taurus GN=REEP2 PE=2 SV=1 64 162 3.0E-16
sp|Q6NUK4|REEP3_HUMAN Receptor expression-enhancing protein 3 OS=Homo sapiens GN=REEP3 PE=1 SV=1 64 144 4.0E-16
sp|Q8VCD6|REEP2_MOUSE Receptor expression-enhancing protein 2 OS=Mus musculus GN=Reep2 PE=1 SV=2 64 162 6.0E-16
sp|Q4QQW1|REEP4_RAT Receptor expression-enhancing protein 4 OS=Rattus norvegicus GN=Reep4 PE=1 SV=1 64 150 7.0E-16
sp|Q5R598|REEP4_PONAB Receptor expression-enhancing protein 4 OS=Pongo abelii GN=REEP4 PE=2 SV=1 64 150 1.0E-15
sp|Q9H6H4|REEP4_HUMAN Receptor expression-enhancing protein 4 OS=Homo sapiens GN=REEP4 PE=1 SV=1 64 150 1.0E-15
sp|Q5BL63|REEP4_XENTR Receptor expression-enhancing protein 4 OS=Xenopus tropicalis GN=reep4 PE=2 SV=1 64 145 1.0E-15
sp|Q7ZVX5|REEP3_DANRE Receptor expression-enhancing protein 3 OS=Danio rerio GN=reep3 PE=2 SV=1 64 145 1.0E-15
sp|Q07764|HVA22_HORVU Protein HVA22 OS=Hordeum vulgare GN=HVA22 PE=2 SV=1 68 169 3.0E-15
sp|Q5HZP8|REP3B_XENLA Receptor expression-enhancing protein 3-B OS=Xenopus laevis GN=reep3-b PE=2 SV=1 64 145 5.0E-15
sp|Q6P418|REP3A_XENLA Receptor expression-enhancing protein 3-A OS=Xenopus laevis GN=reep3-a PE=2 SV=1 64 145 8.0E-15
sp|Q4KMI4|REEP2_DANRE Receptor expression-enhancing protein 2 OS=Danio rerio GN=reep2 PE=2 SV=1 64 145 1.0E-14
sp|Q9H902|REEP1_HUMAN Receptor expression-enhancing protein 1 OS=Homo sapiens GN=REEP1 PE=1 SV=1 64 145 2.0E-14
sp|Q8BGH4|REEP1_MOUSE Receptor expression-enhancing protein 1 OS=Mus musculus GN=Reep1 PE=1 SV=1 64 145 2.0E-14
sp|Q9S7V4|HA22A_ARATH HVA22-like protein a OS=Arabidopsis thaliana GN=HVA22A PE=2 SV=1 58 143 4.0E-14
sp|Q9FED2|HA22E_ARATH HVA22-like protein e OS=Arabidopsis thaliana GN=HVA22E PE=2 SV=1 59 147 2.0E-13
sp|Q9S760|HA22D_ARATH HVA22-like protein d OS=Arabidopsis thaliana GN=HVA22D PE=2 SV=1 68 136 6.0E-13
sp|Q682H0|HA22F_ARATH HVA22-like protein f OS=Arabidopsis thaliana GN=HVA22F PE=2 SV=1 68 140 6.0E-13
sp|Q6NLY8|HA22K_ARATH HVA22-like protein k OS=Arabidopsis thaliana GN=HVA22K PE=2 SV=1 64 147 9.0E-12
sp|Q9S784|HA22C_ARATH HVA22-like protein c OS=Arabidopsis thaliana GN=HVA22C PE=2 SV=1 65 158 2.0E-11
sp|Q9SYX7|HA22B_ARATH HVA22-like protein b OS=Arabidopsis thaliana GN=HVA22B PE=2 SV=2 64 140 1.0E-08
sp|Q8LEM6|HA22H_ARATH HVA22-like protein h OS=Arabidopsis thaliana GN=HVA22H PE=2 SV=2 64 165 2.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.5

Transmembrane Domains

Domain # Start End Length
1 45 67 22
2 87 109 22
3 114 136 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3779
MSFQEKAHGYIGTLDKELSKYPALNNLEKSSGVPKAYAVVGVAALYLFLIVFNLGGQLLTNFAGFVIPGYYSLNA
LFTTNKDDDTQWLTYWVVFSFFTVIESFINIVYWFPFYFVFKFIFLLWLSLPMFRGADIIFKSFMVPTLGRYFQQ
PGSTASGLRSKTGGIDKSE*
Coding >OphauB2|3779
ATGTCCTTCCAAGAAAAAGCCCATGGCTACATTGGCACCCTTGATAAGGAGCTGTCCAAATATCCAGCCCTGAAC
AATCTGGAAAAGTCGTCTGGTGTTCCCAAGGCCTACGCTGTTGTCGGCGTTGCCGCTCTCTATCTCTTTCTCATT
GTTTTCAACCTCGGAGGCCAGCTTCTGACCAACTTTGCTGGATTCGTTATCCCGGGCTACTACTCGCTCAATGCT
TTATTTACAACAAATAAAGACGATGATACTCAGTGGTTGACGTACTGGGTTGTCTTTTCCTTCTTCACCGTCATT
GAGAGCTTCATCAACATTGTCTACTGGTTCCCATTCTACTTTGTTTTCAAGTTCATTTTTCTGCTGTGGCTGTCG
CTGCCCATGTTCCGTGGCGCCGACATCATTTTCAAGTCGTTCATGGTGCCCACGCTAGGTCGATACTTCCAGCAG
CCTGGTTCGACGGCCTCGGGTCTGCGCTCCAAGACTGGCGGCATCGACAAGTCCGAATAG
Transcript >OphauB2|3779
ATGTCCTTCCAAGAAAAAGCCCATGGCTACATTGGCACCCTTGATAAGGAGCTGTCCAAATATCCAGCCCTGAAC
AATCTGGAAAAGTCGTCTGGTGTTCCCAAGGCCTACGCTGTTGTCGGCGTTGCCGCTCTCTATCTCTTTCTCATT
GTTTTCAACCTCGGAGGCCAGCTTCTGACCAACTTTGCTGGATTCGTTATCCCGGGCTACTACTCGCTCAATGCT
TTATTTACAACAAATAAAGACGATGATACTCAGTGGTTGACGTACTGGGTTGTCTTTTCCTTCTTCACCGTCATT
GAGAGCTTCATCAACATTGTCTACTGGTTCCCATTCTACTTTGTTTTCAAGTTCATTTTTCTGCTGTGGCTGTCG
CTGCCCATGTTCCGTGGCGCCGACATCATTTTCAAGTCGTTCATGGTGCCCACGCTAGGTCGATACTTCCAGCAG
CCTGGTTCGACGGCCTCGGGTCTGCGCTCCAAGACTGGCGGCATCGACAAGTCCGAATAG
Gene >OphauB2|3779
ATGTCCTTCCAAGAAAAAGCCCATGGCTACATTGGCACCCTTGATAAGGAGGCATGTCTTTGTACAATGACGCCA
CATTGCACACTGATGCTAACAAGCCCCTTCTTTTAGCTGTCCAAATATCCAGCCCTGAACAATCTGGAAAAGTCG
TCTGGTGTTCCCAAGGCCTACGCTGTTGTCGGCGTTGCCGCTCTCTATCTCTTTCTCATTGTTTTCAACCTCGGA
GGCCAGCTTCTGACCAACTTTGCTGGATTCGTTATCCCGGGCTACTACTCGCTCAATGCTTTATTTACAACAAAT
AAAGACGATGATACTCAGTGGTTGACGGTATGCTTACTTATCCAATCTGTTGCGGCACGATGGCTCGTTGCTGAC
CAAACATGGCTATTAGTACTGGGTTGTCTTTTCCTTCTTCACCGTCATTGAGAGCTTCATCAACATTGTCTACTG
GTTCCCATTCTACTTTGTTTTCAAGTTCATTTTTCTGCTGTGGCTGTCGCTGCCCATGTTCCGGTGAGTTTGCTA
CTCAGAGTCAACGGTGACATGTTTGCTAACAATGTGCAGTGGCGCCGACATCATTTTCAAGTCGTTCATGGTGCC
CACGCTAGGTCGATACTTCCAGCAGCCTGGTTCGACGGCCTCGGGTCTGCGCTCCAAGACTGGCGGCATCGACAA
GTCCGAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail