Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3777
Gene name
LocationContig_24:144831..146703
Strand-
Gene length (bp)1872
Transcript length (bp)1542
Coding sequence length (bp)1542
Protein length (aa) 514

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00696 AA_kinase Amino acid kinase family 1.3E-33 14 321
PF13840 ACT_7 ACT domain 6.0E-09 443 505

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O60163|AK_SCHPO Probable aspartokinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC19F5.04 PE=1 SV=1 7 509 2.0E-160
sp|P10869|AK_YEAST Aspartokinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOM3 PE=1 SV=2 3 510 4.0E-147
sp|Q9S702|AK3_ARATH Aspartokinase 3, chloroplastic OS=Arabidopsis thaliana GN=AK3 PE=1 SV=1 115 509 4.0E-47
sp|O23653|AK2_ARATH Aspartokinase 2, chloroplastic OS=Arabidopsis thaliana GN=AK2 PE=1 SV=2 150 509 7.0E-47
sp|Q9LYU8|AK1_ARATH Aspartokinase 1, chloroplastic OS=Arabidopsis thaliana GN=AK1 PE=1 SV=1 16 509 1.0E-46
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O60163|AK_SCHPO Probable aspartokinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC19F5.04 PE=1 SV=1 7 509 2.0E-160
sp|P10869|AK_YEAST Aspartokinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOM3 PE=1 SV=2 3 510 4.0E-147
sp|Q9S702|AK3_ARATH Aspartokinase 3, chloroplastic OS=Arabidopsis thaliana GN=AK3 PE=1 SV=1 115 509 4.0E-47
sp|O23653|AK2_ARATH Aspartokinase 2, chloroplastic OS=Arabidopsis thaliana GN=AK2 PE=1 SV=2 150 509 7.0E-47
sp|Q9LYU8|AK1_ARATH Aspartokinase 1, chloroplastic OS=Arabidopsis thaliana GN=AK1 PE=1 SV=1 16 509 1.0E-46
sp|Q57991|AK_METJA Probable aspartokinase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0571 PE=1 SV=1 101 509 2.0E-43
sp|O81852|AKH2_ARATH Bifunctional aspartokinase/homoserine dehydrogenase 2, chloroplastic OS=Arabidopsis thaliana GN=AKHSDH2 PE=1 SV=1 7 509 3.0E-34
sp|P27725|AK1H_SERMA Bifunctional aspartokinase/homoserine dehydrogenase 1 OS=Serratia marcescens GN=thrA PE=3 SV=1 159 510 3.0E-33
sp|P49080|AKH2_MAIZE Bifunctional aspartokinase/homoserine dehydrogenase 2, chloroplastic OS=Zea mays GN=AKHSDH2 PE=2 SV=1 14 509 1.0E-32
sp|P49079|AKH1_MAIZE Bifunctional aspartokinase/homoserine dehydrogenase 1, chloroplastic OS=Zea mays GN=AKHSDH1 PE=2 SV=1 14 509 2.0E-32
sp|Q9SA18|AKH1_ARATH Bifunctional aspartokinase/homoserine dehydrogenase 1, chloroplastic OS=Arabidopsis thaliana GN=AKHSDH1 PE=1 SV=1 11 509 5.0E-32
sp|P00561|AK1H_ECOLI Bifunctional aspartokinase/homoserine dehydrogenase 1 OS=Escherichia coli (strain K12) GN=thrA PE=1 SV=2 159 510 2.0E-30
sp|P37142|AKH_DAUCA Bifunctional aspartokinase/homoserine dehydrogenase, chloroplastic (Fragment) OS=Daucus carota PE=1 SV=1 11 509 2.0E-29
sp|P57290|AKH_BUCAI Bifunctional aspartokinase/homoserine dehydrogenase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=thrA PE=3 SV=1 159 509 5.0E-29
sp|P08660|AK3_ECOLI Lysine-sensitive aspartokinase 3 OS=Escherichia coli (strain K12) GN=lysC PE=1 SV=2 15 509 8.0E-29
sp|Q8K9U9|AKH_BUCAP Bifunctional aspartokinase/homoserine dehydrogenase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=thrA PE=3 SV=1 159 509 5.0E-28
sp|P44505|AKH_HAEIN Bifunctional aspartokinase/homoserine dehydrogenase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=thrA PE=3 SV=1 163 510 9.0E-28
sp|Q88EI9|AK_PSEPK Aspartate kinase OS=Pseudomonas putida (strain KT2440) GN=PP_4473 PE=1 SV=1 126 506 8.0E-25
sp|A4VJB4|AKLYS_PSEU5 Aspartate kinase Ask_LysC OS=Pseudomonas stutzeri (strain A1501) GN=lysC PE=1 SV=1 108 506 7.0E-24
sp|O69077|AK_PSEAE Aspartokinase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=lysC PE=3 SV=2 154 506 3.0E-23
sp|C3JXY0|AK_PSEFS Aspartate kinase OS=Pseudomonas fluorescens (strain SBW25) GN=PFLU_4747 PE=1 SV=1 154 506 4.0E-22
sp|Q9ZJZ7|AK_HELPJ Aspartokinase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=lysC PE=3 SV=1 133 505 1.0E-19
sp|O25827|AK_HELPY Aspartokinase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=lysC PE=3 SV=1 133 505 3.0E-19
sp|Q89AR4|AKH_BUCBP Bifunctional aspartokinase/homoserine dehydrogenase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=thrA PE=3 SV=1 158 509 5.0E-19
sp|P08495|AK2_BACSU Aspartokinase 2 OS=Bacillus subtilis (strain 168) GN=lysC PE=1 SV=2 139 505 2.0E-17
sp|P94417|AK3_BACSU Aspartokinase 3 OS=Bacillus subtilis (strain 168) GN=yclM PE=1 SV=1 16 509 2.0E-17
sp|P53553|AK_GEOSE Aspartokinase OS=Geobacillus stearothermophilus GN=lysC PE=3 SV=1 139 505 8.0E-17
sp|O67221|AK_AQUAE Aspartokinase OS=Aquifex aeolicus (strain VF5) GN=lysC PE=3 SV=1 104 505 9.0E-17
sp|Q9ZCI7|AK_RICPR Aspartokinase OS=Rickettsia prowazekii (strain Madrid E) GN=lysC PE=3 SV=1 151 509 3.0E-15
sp|Q59229|AK_BACSG Aspartokinase OS=Bacillus sp. (strain MGA3) GN=lysC PE=1 SV=1 154 505 3.0E-15
sp|P61488|AK_THET2 Aspartokinase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=ask PE=3 SV=1 115 505 3.0E-15
sp|P61489|AK_THETH Aspartokinase OS=Thermus thermophilus GN=ask PE=1 SV=1 115 505 9.0E-15
sp|Q4UK84|AK_RICFE Aspartokinase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=lysC PE=3 SV=1 222 509 2.0E-14
sp|P41403|AK_MYCSM Aspartokinase OS=Mycobacterium smegmatis GN=ask PE=3 SV=1 219 505 6.0E-13
sp|Q68VZ7|AK_RICTY Aspartokinase OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=lysC PE=3 SV=1 215 509 1.0E-12
sp|Q8RQN1|AK_COREF Aspartokinase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=lysC PE=3 SV=1 219 505 3.0E-12
sp|P41398|AK_CORFL Aspartokinase OS=Corynebacterium flavescens GN=lysC PE=1 SV=1 219 508 4.0E-12
sp|P26512|AK_CORGL Aspartokinase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=lysC PE=1 SV=2 219 508 4.0E-12
sp|Q1RGM9|AK_RICBR Aspartokinase OS=Rickettsia bellii (strain RML369-C) GN=lysC PE=3 SV=1 157 501 5.0E-12
sp|Q04795|AK1_BACSU Aspartokinase 1 OS=Bacillus subtilis (strain 168) GN=dapG PE=3 SV=3 151 505 2.0E-11
sp|P00562|AK2H_ECOLI Bifunctional aspartokinase/homoserine dehydrogenase 2 OS=Escherichia coli (strain K12) GN=metL PE=1 SV=3 151 322 5.0E-11
sp|A4VFY3|AKECT_PSEU5 Aspartate kinase Ask_Ect OS=Pseudomonas stutzeri (strain A1501) GN=ask PE=1 SV=2 16 508 2.0E-10
sp|Q92GF9|AK_RICCN Aspartokinase OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=lysC PE=3 SV=1 222 509 3.0E-10
sp|P9WPX3|AK_MYCTU Aspartokinase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ask PE=1 SV=1 219 505 4.0E-10
sp|P9WPX2|AK_MYCTO Aspartokinase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ask PE=3 SV=1 219 505 4.0E-10
sp|P0A4Z9|AK_MYCBO Aspartokinase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ask PE=3 SV=1 219 505 4.0E-10
sp|Q9Z6L0|AK_CHLPN Aspartokinase OS=Chlamydia pneumoniae GN=lysC PE=3 SV=1 148 336 3.0E-07
sp|O84367|AK_CHLTR Aspartokinase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=lysC PE=3 SV=1 15 319 5.0E-07
sp|Q9PK32|AK_CHLMU Aspartokinase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=lysC PE=3 SV=1 151 319 2.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 15 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3777
MVSSTHQNSAGLGWVVQKFGGTSVGKFPDKIACDIVRPSLSRDRVVVICSARSTGKKAEGTTSRLLGVYSKLRGF
APASAAKFKDDAENDAEALIEQARGLIKEICSDHVSAAESYIRDDGLRKSLVLKTEAECQELTEYIVAARRFNLE
INSRSKDRVISFGEKLACLFMTALLQDSGVEAEYVDLCDVLHYDASAQLDAGFYKAAATAFAQKLSACEQRVPVV
TGFFGNVPGSLIDGDIGRGYTDLCAALCAVGLGARELQIWKEVDGIFTADPTKVPTASLLPSITRAEAAELTFYG
SEVIHHLTMDMVNRPQPPIQIRIKNVKNPRGNGTIVIPDAVRPQGQQQPAPSPPSSTPKRPTAMTIKDHISVINI
HSNKRSISSPAFFARIFSILDKNSISVDLISTSEVHVSLAIHSGSTHFDAFTRAIHSLEECGDVSVLSNMAILSL
VGAGMKNMIGVAGLMFSTLGEHNINLEMISQGASEINISCVIDSRDATRAMNVLHTHLFTFLE*
Coding >OphauB2|3777
ATGGTGAGCTCGACGCACCAAAATTCTGCAGGCCTGGGCTGGGTCGTCCAGAAGTTTGGTGGGACCAGCGTGGGC
AAATTCCCAGACAAGATTGCCTGCGACATTGTCAGGCCCAGTCTGTCGCGGGATCGCGTCGTTGTCATTTGCTCT
GCGAGAAGCACTGGCAAAAAGGCTGAGGGCACGACGAGCCGCTTGCTAGGGGTGTACAGCAAGCTGAGAGGCTTT
GCCCCGGCGTCGGCAGCCAAGTTTAAAGACGATGCAGAGAATGACGCCGAGGCGCTGATTGAGCAGGCGCGGGGG
CTCATCAAGGAAATTTGCAGCGATCATGTCTCTGCGGCTGAGTCGTACATACGAGACGACGGCCTGCGCAAGTCA
TTGGTGCTCAAGACGGAAGCTGAGTGCCAGGAGCTGACCGAGTACATTGTGGCGGCCAGACGATTCAACCTGGAA
ATCAACTCGCGGTCCAAGGACCGTGTCATTAGCTTTGGCGAGAAGCTGGCATGTCTCTTTATGACTGCCTTGCTG
CAGGACTCGGGGGTTGAGGCCGAGTATGTCGACCTGTGCGACGTGCTGCACTATGATGCCTCTGCGCAGTTGGAT
GCCGGCTTCTACAAGGCAGCGGCAACGGCGTTTGCGCAGAAGCTGTCGGCCTGCGAGCAGCGGGTGCCGGTAGTG
ACGGGTTTCTTTGGCAACGTGCCCGGCAGTCTGATAGACGGCGACATTGGCCGCGGCTACACGGACCTGTGCGCC
GCACTGTGTGCCGTTGGCCTCGGGGCGCGGGAGCTGCAGATATGGAAAGAGGTTGACGGCATTTTCACGGCAGAT
CCGACAAAGGTGCCGACGGCGAGCCTGCTGCCATCAATTACGCGGGCCGAGGCGGCTGAGCTGACGTTTTACGGG
TCCGAGGTGATTCACCATCTGACCATGGACATGGTGAACCGCCCGCAGCCACCCATTCAGATCCGCATCAAAAAC
GTCAAGAACCCGCGTGGCAATGGTACAATTGTCATTCCTGATGCGGTGCGCCCGCAGGGCCAGCAGCAGCCGGCG
CCGTCGCCACCAAGCAGCACGCCCAAGCGGCCGACGGCCATGACCATCAAGGACCACATCAGCGTCATCAACATC
CACTCAAACAAGCGCTCCATTTCGTCGCCTGCCTTTTTTGCGCGCATCTTTTCCATCCTGGACAAGAACTCCATC
TCGGTCGACCTGATATCGACGAGCGAGGTGCACGTGTCGCTCGCCATTCACTCTGGCAGCACGCACTTTGACGCC
TTTACCCGCGCCATCCACAGCCTCGAGGAGTGCGGCGATGTTAGCGTCTTGTCAAACATGGCCATTCTCAGCCTC
GTCGGCGCGGGCATGAAGAACATGATTGGCGTGGCGGGCCTCATGTTTTCCACGCTGGGGGAGCATAACATTAAT
TTGGAAATGATATCCCAGGGGGCGAGCGAAATCAACATATCTTGTGTCATTGACTCGCGCGATGCGACGCGGGCC
ATGAACGTCTTGCACACGCATCTCTTTACCTTTTTGGAGTAG
Transcript >OphauB2|3777
ATGGTGAGCTCGACGCACCAAAATTCTGCAGGCCTGGGCTGGGTCGTCCAGAAGTTTGGTGGGACCAGCGTGGGC
AAATTCCCAGACAAGATTGCCTGCGACATTGTCAGGCCCAGTCTGTCGCGGGATCGCGTCGTTGTCATTTGCTCT
GCGAGAAGCACTGGCAAAAAGGCTGAGGGCACGACGAGCCGCTTGCTAGGGGTGTACAGCAAGCTGAGAGGCTTT
GCCCCGGCGTCGGCAGCCAAGTTTAAAGACGATGCAGAGAATGACGCCGAGGCGCTGATTGAGCAGGCGCGGGGG
CTCATCAAGGAAATTTGCAGCGATCATGTCTCTGCGGCTGAGTCGTACATACGAGACGACGGCCTGCGCAAGTCA
TTGGTGCTCAAGACGGAAGCTGAGTGCCAGGAGCTGACCGAGTACATTGTGGCGGCCAGACGATTCAACCTGGAA
ATCAACTCGCGGTCCAAGGACCGTGTCATTAGCTTTGGCGAGAAGCTGGCATGTCTCTTTATGACTGCCTTGCTG
CAGGACTCGGGGGTTGAGGCCGAGTATGTCGACCTGTGCGACGTGCTGCACTATGATGCCTCTGCGCAGTTGGAT
GCCGGCTTCTACAAGGCAGCGGCAACGGCGTTTGCGCAGAAGCTGTCGGCCTGCGAGCAGCGGGTGCCGGTAGTG
ACGGGTTTCTTTGGCAACGTGCCCGGCAGTCTGATAGACGGCGACATTGGCCGCGGCTACACGGACCTGTGCGCC
GCACTGTGTGCCGTTGGCCTCGGGGCGCGGGAGCTGCAGATATGGAAAGAGGTTGACGGCATTTTCACGGCAGAT
CCGACAAAGGTGCCGACGGCGAGCCTGCTGCCATCAATTACGCGGGCCGAGGCGGCTGAGCTGACGTTTTACGGG
TCCGAGGTGATTCACCATCTGACCATGGACATGGTGAACCGCCCGCAGCCACCCATTCAGATCCGCATCAAAAAC
GTCAAGAACCCGCGTGGCAATGGTACAATTGTCATTCCTGATGCGGTGCGCCCGCAGGGCCAGCAGCAGCCGGCG
CCGTCGCCACCAAGCAGCACGCCCAAGCGGCCGACGGCCATGACCATCAAGGACCACATCAGCGTCATCAACATC
CACTCAAACAAGCGCTCCATTTCGTCGCCTGCCTTTTTTGCGCGCATCTTTTCCATCCTGGACAAGAACTCCATC
TCGGTCGACCTGATATCGACGAGCGAGGTGCACGTGTCGCTCGCCATTCACTCTGGCAGCACGCACTTTGACGCC
TTTACCCGCGCCATCCACAGCCTCGAGGAGTGCGGCGATGTTAGCGTCTTGTCAAACATGGCCATTCTCAGCCTC
GTCGGCGCGGGCATGAAGAACATGATTGGCGTGGCGGGCCTCATGTTTTCCACGCTGGGGGAGCATAACATTAAT
TTGGAAATGATATCCCAGGGGGCGAGCGAAATCAACATATCTTGTGTCATTGACTCGCGCGATGCGACGCGGGCC
ATGAACGTCTTGCACACGCATCTCTTTACCTTTTTGGAGTAG
Gene >OphauB2|3777
ATGGTGAGCTCGACGCACCAAAATTCTGCAGGCCTGGGCTGGGTCGTCCAGAAGTTTGGTGGGACCAGCGTGGGC
AAATTCCCAGACAAGGTTCGTTGCATGGAGCGTCTTGCAAGGCCAAGGAAAAACGTGGGCTCATTTTGTCTCATG
CCAGATTGCCTGCGACATTGTCAGGTATGCTGCAGGTCAGCTAGCAGAAGCTCAGAGGCTGCCGTCTCAACTCAT
GTTCGTCAATTAGGCCCAGTCTGTCGCGGGATCGCGTCGTTGTCATTTGCTCTGCGAGAAGCACTGGCAAAAAGG
CTGAGGGCACGACGAGCCGGTGAGTCATGTCGTGACTTTCTTTTTTTCTCACAGTGCCCCAAAAAACCCCAAAAA
AACGCTCTTCTCACATGACTGCAGCTTGCTAGGGGTGTACAGCAAGCTGAGAGGCTTTGCCCCGGCGTCGGCAGC
CAAGTTTAAAGACGATGCAGAGAATGACGCCGAGGCGCTGATTGAGCAGGCGCGGGGGCTCATCAAGGAAATTTG
CAGCGATCATGTCTCTGCGGCTGAGTCGTACATACGAGACGACGGCCTGCGCAAGTCATTGGTGCTCAAGACGGA
AGCTGAGTGCCAGGAGCTGACCGAGTACATTGTGGCGGCCAGACGATTCAACCTGGAAATCAACTCGCGGTCCAA
GGACCGTGTCATTAGCTTTGGCGAGAAGCTGGCATGTCTCTTTATGACTGCCTTGCTGCAGGACTCGGTGAGTGC
GGATAGGCCACTGTGGCTGCGACGCATCTGACCAAGCCATGTGCTCAGGGGGTTGAGGCCGAGTATGTCGACCTG
TGCGACGTGCTGCACTATGATGCCTCTGCGCAGTTGGATGCCGGCTTCTACAAGGCAGCGGCAACGGCGTTTGCG
CAGAAGCTGTCGGCCTGCGAGCAGCGGGTGCCGGTAGTGACGGGTTTCTTTGGCAACGTGCCCGGCAGTCTGATA
GACGGCGACATTGGCCGCGGCTACACGGACCTGTGCGCCGCACTGTGTGCCGTTGGCCTCGGGGCGCGGGAGCTG
CAGATATGGAAAGAGGTTGACGGCATTTTCACGGCAGATCCGACAAAGGTGCCGACGGCGAGCCTGCTGCCATCA
ATTACGCGGGCCGAGGCGGCTGAGCTGACGTTTTACGGGTCCGAGGTGATTCACCATCTGACCATGGACATGGTG
AACCGCCCGCAGCCACCCATTCAGATCCGCATCAAAAACGTCAAGAACCCGCGTGGCAATGGTACAATTGTCATT
CCTGATGCGGTGCGCCCGCAGGGCCAGCAGCAGCCGGCGCCGTCGCCACCAAGCAGCACGCCCAAGCGGCCGACG
GCCATGACCATCAAGGACCACATCAGCGTCATCAACATCCACTCAAACAAGCGCTCCATTTCGTCGCCTGCCTTT
TTTGCGCGCATCTTTTCCATCCTGGACAAGAACTCCATCTCGGTCGACCTGATATCGACGAGCGAGGTGCACGTG
TCGCTCGCCATTCACTCTGGCAGCACGCACTTTGACGCCTTTACCCGCGCCATCCACAGCCTCGAGGAGTGCGGC
GATGTTAGCGTCTTGTCAAACATGGCCATTCTCAGCCTCGTCGGCGCGGGCATGAAGAACATGATTGGCGTGGCG
GGCCTCATGTTTTCCACGCTGGGGGAGCATAACATTAATTTGGAAATGATATCCCAGGGTAAAGTTGATTGATTG
CTTTGTAGTAGTCTTTGCCGGGCATTGTGCTAATTTTTGAGGGATCCAGGGGCGAGCGAAATCAACATATCTTGT
GTCATTGACTCGCGCGATGCGACGCGGGCCATGAACGTCTTGCACACGCATCTCTTTACCTTTTTGGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail