Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3771
Gene name
LocationContig_24:126235..128474
Strand+
Gene length (bp)2239
Transcript length (bp)2043
Coding sequence length (bp)2043
Protein length (aa) 681

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 264 463 4.0E-10
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 287 467 2.0E-09
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 262 401 2.0E-09
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 262 429 4.0E-09
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 309 483 1.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 264 463 4.0E-10
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 287 467 2.0E-09
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 262 401 2.0E-09
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 262 429 4.0E-09
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 309 483 1.0E-08
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 337 486 2.0E-08
sp|G4SLH0|TTN1_CAEEL Titin homolog OS=Caenorhabditis elegans GN=ttn-1 PE=1 SV=2 262 472 2.0E-07
sp|P08799|MYS2_DICDI Myosin-2 heavy chain OS=Dictyostelium discoideum GN=mhcA PE=1 SV=3 263 494 5.0E-07
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 339 485 9.0E-07
sp|G4SLH0|TTN1_CAEEL Titin homolog OS=Caenorhabditis elegans GN=ttn-1 PE=1 SV=2 262 459 3.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2064
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5540
Ophiocordyceps australis map64 (Brazil) OphauB2|3771 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|04765
Ophiocordyceps camponoti-rufipedis Ophun1|26
Ophiocordyceps kimflemingae Ophio5|5744
Ophiocordyceps subramaniannii Hirsu2|2380

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3771
MSLKQRPSNQNSLPGESSRSNTYHRHSSEEEDRQSHSSYTDEDDDEAEYRDHIYSDSEGGEVQPSESASTRPSHF
QPLSSSRAAPHRQPLAHQHQGLYHSVRDPAPISSSVAPSDEYGGGHYGPAAFHQPFQRGPGLYGGRSHGLAHYHQ
YAQNQGGHYISGYPGNNQVVPYGGYNGHNPFTPLNNGSSGASFFSGAEPRHPYEMMPYQPPPGYYGPPTHYNLPA
HMQQFTLSPPAPTQPATEAPAQKTPSPAPKEPPIDLEKIRSEAQEAAKKEHEEKIKAINEQQEREARIRKDAEDS
FVRRMEEMRKQQEEAQKEIARAKAEAEAAALARIEAERKAREEREKQEAEALKRAEENAIRKYEKEQKEAEERRV
KEQEMRERIEADAKRRLEDALRNEAETKAAALQKANEEAERIKLMHEEAQRKAEADARAKLEAEAEAKRKAAEAE
EAAKQEHEALKKKIQDEARAAALEAAEEAARAKGEKGAIRFKDAVGRKFSFPYNICNTWQGMQGLIKQAFMHVEV
IGPHVQEGRYDLTGPDGEIILPSVWEKVVQPDWAIEMTMWPVEEKKPEPPMPDIPPIGLRPGGMPMPHGAGGPGM
GRPPRGMAGPGMMPGWGPPTGHSPPHLPDDLGMPGMPGMPGMMPRNVKKAHRTNTKKIPTGVFDYIIGSKPSKHR
KKSKK*
Coding >OphauB2|3771
ATGTCACTAAAGCAACGCCCCTCTAACCAAAATTCTTTACCGGGCGAGTCGTCCAGATCAAACACCTACCACAGG
CACTCTAGTGAAGAAGAAGACAGGCAGTCTCACAGCTCGTATACCGACGAAGACGACGACGAGGCTGAATATCGA
GATCATATCTACTCAGACTCAGAAGGGGGCGAAGTACAGCCGAGTGAGTCGGCGTCGACGAGGCCTTCTCATTTC
CAACCACTTTCCTCATCCAGGGCGGCTCCTCATCGCCAGCCTCTGGCGCACCAACACCAAGGCCTCTATCATTCG
GTGCGGGATCCTGCACCAATCTCATCCAGCGTGGCTCCCTCGGACGAGTACGGCGGTGGCCACTACGGCCCCGCC
GCCTTTCACCAACCCTTTCAGCGCGGGCCCGGTCTCTACGGCGGCCGCTCTCATGGCCTTGCCCACTATCACCAA
TATGCCCAGAACCAAGGTGGTCACTACATTTCGGGCTATCCAGGCAATAACCAGGTGGTGCCTTATGGCGGTTAC
AATGGCCATAATCCTTTTACTCCTCTCAACAATGGCTCCAGTGGCGCCAGCTTCTTTAGTGGTGCTGAGCCCAGA
CACCCATATGAGATGATGCCCTATCAGCCTCCCCCGGGCTATTACGGCCCGCCTACTCACTATAATCTCCCTGCT
CACATGCAACAGTTTACCCTGTCGCCTCCGGCGCCGACGCAACCAGCTACTGAGGCACCGGCACAAAAGACGCCA
TCTCCGGCGCCCAAGGAGCCCCCGATTGATCTCGAAAAAATCAGATCTGAGGCTCAAGAGGCCGCCAAGAAGGAA
CACGAGGAGAAGATCAAGGCAATCAACGAACAACAGGAGCGCGAAGCCCGAATCCGCAAAGACGCTGAGGATTCG
TTTGTGCGCAGGATGGAGGAAATGCGAAAGCAGCAGGAAGAGGCCCAAAAGGAGATTGCGCGGGCCAAGGCTGAG
GCCGAGGCAGCAGCCTTGGCCAGAATCGAGGCTGAGCGCAAAGCTCGGGAAGAGAGGGAGAAGCAAGAAGCCGAG
GCGCTGAAGCGGGCAGAGGAAAACGCTATTCGCAAGTACGAAAAGGAACAGAAGGAAGCCGAGGAACGCAGGGTG
AAGGAGCAGGAGATGCGCGAGCGCATAGAGGCAGATGCGAAAAGACGTCTCGAAGATGCGCTTCGAAATGAAGCC
GAAACCAAGGCAGCCGCTTTGCAGAAGGCGAATGAAGAGGCTGAGCGCATCAAGCTGATGCACGAGGAGGCGCAG
CGCAAGGCTGAAGCTGATGCCAGGGCTAAACTCGAGGCCGAAGCAGAGGCGAAAAGAAAAGCCGCCGAGGCTGAG
GAGGCGGCCAAGCAGGAACACGAGGCTCTCAAGAAGAAGATTCAAGACGAGGCGCGAGCCGCTGCCCTCGAGGCT
GCCGAAGAGGCTGCCAGGGCCAAGGGCGAAAAGGGCGCCATCAGGTTCAAGGATGCCGTGGGACGAAAGTTTAGC
TTTCCCTACAACATTTGCAACACATGGCAGGGCATGCAAGGTCTCATCAAACAGGCCTTTATGCACGTCGAAGTG
ATTGGACCCCACGTTCAAGAGGGCCGGTACGATTTGACGGGTCCAGATGGCGAAATTATTCTGCCGTCGGTCTGG
GAAAAGGTGGTGCAGCCAGACTGGGCAATCGAGATGACCATGTGGCCAGTAGAAGAGAAGAAGCCAGAGCCGCCT
ATGCCCGATATACCGCCGATTGGTCTGAGGCCTGGAGGCATGCCAATGCCACACGGTGCAGGAGGCCCAGGAATG
GGACGGCCTCCAAGGGGCATGGCTGGTCCGGGCATGATGCCAGGATGGGGGCCACCCACAGGGCATTCACCTCCA
CATCTGCCCGATGACTTGGGCATGCCCGGAATGCCTGGAATGCCCGGCATGATGCCACGCAATGTCAAGAAGGCT
CACCGTACCAACACCAAAAAGATTCCCACGGGTGTCTTTGACTACATAATAGGGTCTAAGCCTAGTAAGCATAGG
AAAAAGAGCAAGAAGTGA
Transcript >OphauB2|3771
ATGTCACTAAAGCAACGCCCCTCTAACCAAAATTCTTTACCGGGCGAGTCGTCCAGATCAAACACCTACCACAGG
CACTCTAGTGAAGAAGAAGACAGGCAGTCTCACAGCTCGTATACCGACGAAGACGACGACGAGGCTGAATATCGA
GATCATATCTACTCAGACTCAGAAGGGGGCGAAGTACAGCCGAGTGAGTCGGCGTCGACGAGGCCTTCTCATTTC
CAACCACTTTCCTCATCCAGGGCGGCTCCTCATCGCCAGCCTCTGGCGCACCAACACCAAGGCCTCTATCATTCG
GTGCGGGATCCTGCACCAATCTCATCCAGCGTGGCTCCCTCGGACGAGTACGGCGGTGGCCACTACGGCCCCGCC
GCCTTTCACCAACCCTTTCAGCGCGGGCCCGGTCTCTACGGCGGCCGCTCTCATGGCCTTGCCCACTATCACCAA
TATGCCCAGAACCAAGGTGGTCACTACATTTCGGGCTATCCAGGCAATAACCAGGTGGTGCCTTATGGCGGTTAC
AATGGCCATAATCCTTTTACTCCTCTCAACAATGGCTCCAGTGGCGCCAGCTTCTTTAGTGGTGCTGAGCCCAGA
CACCCATATGAGATGATGCCCTATCAGCCTCCCCCGGGCTATTACGGCCCGCCTACTCACTATAATCTCCCTGCT
CACATGCAACAGTTTACCCTGTCGCCTCCGGCGCCGACGCAACCAGCTACTGAGGCACCGGCACAAAAGACGCCA
TCTCCGGCGCCCAAGGAGCCCCCGATTGATCTCGAAAAAATCAGATCTGAGGCTCAAGAGGCCGCCAAGAAGGAA
CACGAGGAGAAGATCAAGGCAATCAACGAACAACAGGAGCGCGAAGCCCGAATCCGCAAAGACGCTGAGGATTCG
TTTGTGCGCAGGATGGAGGAAATGCGAAAGCAGCAGGAAGAGGCCCAAAAGGAGATTGCGCGGGCCAAGGCTGAG
GCCGAGGCAGCAGCCTTGGCCAGAATCGAGGCTGAGCGCAAAGCTCGGGAAGAGAGGGAGAAGCAAGAAGCCGAG
GCGCTGAAGCGGGCAGAGGAAAACGCTATTCGCAAGTACGAAAAGGAACAGAAGGAAGCCGAGGAACGCAGGGTG
AAGGAGCAGGAGATGCGCGAGCGCATAGAGGCAGATGCGAAAAGACGTCTCGAAGATGCGCTTCGAAATGAAGCC
GAAACCAAGGCAGCCGCTTTGCAGAAGGCGAATGAAGAGGCTGAGCGCATCAAGCTGATGCACGAGGAGGCGCAG
CGCAAGGCTGAAGCTGATGCCAGGGCTAAACTCGAGGCCGAAGCAGAGGCGAAAAGAAAAGCCGCCGAGGCTGAG
GAGGCGGCCAAGCAGGAACACGAGGCTCTCAAGAAGAAGATTCAAGACGAGGCGCGAGCCGCTGCCCTCGAGGCT
GCCGAAGAGGCTGCCAGGGCCAAGGGCGAAAAGGGCGCCATCAGGTTCAAGGATGCCGTGGGACGAAAGTTTAGC
TTTCCCTACAACATTTGCAACACATGGCAGGGCATGCAAGGTCTCATCAAACAGGCCTTTATGCACGTCGAAGTG
ATTGGACCCCACGTTCAAGAGGGCCGGTACGATTTGACGGGTCCAGATGGCGAAATTATTCTGCCGTCGGTCTGG
GAAAAGGTGGTGCAGCCAGACTGGGCAATCGAGATGACCATGTGGCCAGTAGAAGAGAAGAAGCCAGAGCCGCCT
ATGCCCGATATACCGCCGATTGGTCTGAGGCCTGGAGGCATGCCAATGCCACACGGTGCAGGAGGCCCAGGAATG
GGACGGCCTCCAAGGGGCATGGCTGGTCCGGGCATGATGCCAGGATGGGGGCCACCCACAGGGCATTCACCTCCA
CATCTGCCCGATGACTTGGGCATGCCCGGAATGCCTGGAATGCCCGGCATGATGCCACGCAATGTCAAGAAGGCT
CACCGTACCAACACCAAAAAGATTCCCACGGGTGTCTTTGACTACATAATAGGGTCTAAGCCTAGTAAGCATAGG
AAAAAGAGCAAGAAGTGA
Gene >OphauB2|3771
ATGTCGTAAGTCGCTGCCGCCTGTGCGACTTTTGTCGTCTTCAAAAGCGCTCCATTCGCTTACACGGAGCTAGAC
TAAAGCAACGCCCCTCTAACCAAAATTCTTTACCGGGCGAGTCGTCCAGATCAAACACCTACCACAGGCACTCTA
GTGAAGAAGAAGACAGGCAGTCTCACAGCTCGTATACCGACGAAGACGACGACGAGGCTGAATATCGAGATCATA
TCTACTCAGACTCAGAAGGGGGCGAAGTACAGCCGAGTGAGTCGGCGTCGACGAGGCCTTCTCATTTCCAACCAC
TTTCCTCATCCAGGGCGGCTCCTCATCGCCAGCCTCTGGCGCACCAACACCAAGGCCTCTATCATTCGGTGCGGG
ATCCTGCACCAATCTCATCCAGCGTGGCTCCCTCGGACGAGTACGGCGGTGGCCACTACGGCCCCGCCGCCTTTC
ACCAACCCTTTCAGCGCGGGCCCGGTCTCTACGGCGGCCGCTCTCATGGCCTTGCCCACTATCACCAATATGCCC
AGAACCAAGGTGGTCACTACATTTCGGGCTATCCAGGCAATAACCAGGTGGTGCCTTATGGCGGTTACAATGGCC
ATAATCCTTTTACTCCTCTCAACAATGGCTCCAGTGGCGCCAGCTTCTTTAGTGGTGCTGAGCCCAGACACCCAT
ATGAGATGATGCCCTATCAGCCTCCCCCGGGCTATTACGGCCCGCCTACTCACTATAATCTCCCTGCTCACATGC
AACAGTTTACCCTGTCGCCTCCGGCGCCGACGCAACCAGCTACTGAGGCACCGGCACAAAAGACGCCATCTCCGG
CGCCCAAGGAGCCCCCGATTGATCTCGAAAAAATCAGATCTGAGGCTCAAGAGGCCGCCAAGAAGGAACACGAGG
AGAAGATCAAGGCAATCAACGAACAACAGGAGCGCGAAGCCCGAATCCGCAAAGACGCTGAGGATTCGTTTGTGC
GCAGGATGGAGGAAATGCGAAAGCAGCAGGAAGAGGCCCAAAAGGAGATTGCGCGGGCCAAGGCTGAGGCCGAGG
CAGCAGCCTTGGCCAGAATCGAGGCTGAGCGCAAAGCTCGGGAAGAGAGGGAGAAGCAAGAAGCCGAGGCGCTGA
AGCGGGCAGAGGAAAACGCTATTCGCAAGTACGAAAAGGAACAGAAGGAAGCCGAGGAACGCAGGGTGAAGGAGC
AGGAGATGCGCGAGCGCATAGAGGCAGATGCGAAAAGACGTCTCGAAGATGCGCTTCGAAATGAAGCCGAAACCA
AGGCAGCCGCTTTGCAGAAGGCGAATGAAGAGGCTGAGCGCATCAAGCTGATGCACGAGGAGGCGCAGCGCAAGG
CTGAAGCTGATGCCAGGGCTAAACTCGAGGCCGAAGCAGAGGCGAAAAGAAAAGCCGCCGAGGCTGAGGAGGCGG
CCAAGCAGGAACACGAGGCTCTCAAGAAGAAGATTCAAGACGAGGCGCGAGCCGCTGCCCTCGAGGCTGCCGAAG
AGGCTGCCAGGGCCAAGGGCGAAAAGGGCGCCATCAGGTTCAAGGATGCCGTGGGACGAAAGTTTAGCTTTCCCT
ACAACATTTGCAACACATGGCAGGTATGTCAACAACATGGACTCTCCTTACCGCACCGTCATGTGTGAATATACT
GACTCGTTTATCTGCAGGGCATGCAAGGTCTCATCAAACAGGCCTTTATGCACGTCGAAGTGATTGGACCCCACG
TTCAAGAGGGCCGGTACGATTTGACGGGTCCAGATGGCGAAATTATTCTGCCGTCGGTCTGGGAAAAGGTGGTGC
AGCCAGACTGGGCAATCGAGATGACCATGTGGCCAGTAGAAGAGAAGAAGCCAGAGCCGCCTATGCCCGATATAC
CGCCGATTGGTCTGAGGCCTGGAGGCATGCCAATGCCACACGGTGCAGGAGGCCCAGGAATGGGACGGCCTCCAA
GGGGCATGGCTGGTCCGGGCATGATGCCAGGATGGGGGCCACCCACAGGGCATTCACCTCCACATCTGCCCGATG
ACTTGGGCATGCCCGGAATGCCTGGAATGCCCGGCATGATGCCACGCAATGTCAAGAAGGCTCACCGTACCAACA
CCAAAAAGATTCCCACGGGTGTCTTTGACTACATAATAGGGTCTAAGCCTAGTAAGCATAGGAAAAAGTAGGAAG
AGCTTTTCCTTTGGCTAGCAGAATCTTTGACAGAGCTAACAAGATGTATAGGAGCAAGAAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail