Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|377
Gene name
LocationContig_104:606..2019
Strand+
Gene length (bp)1413
Transcript length (bp)1413
Coding sequence length (bp)1413
Protein length (aa) 471

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00067 p450 Cytochrome P450 5.1E-49 2 462

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q05047|C72A1_CATRO Secologanin synthase OS=Catharanthus roseus GN=CYP72A1 PE=2 SV=1 14 441 5.0E-24
sp|Q9GQM9|CP6L1_BLAGE Cytochrome P450 6l1 OS=Blattella germanica GN=CYP6L1 PE=2 SV=1 4 440 1.0E-21
sp|H1A981|C7263_MEDTR 11-oxo-beta-amyrin 30-oxidase OS=Medicago truncatula GN=CYP72A63 PE=1 SV=1 24 441 2.0E-21
sp|H1A988|C7254_GLYUR 11-oxo-beta-amyrin 30-oxidase OS=Glycyrrhiza uralensis GN=CYP72A154 PE=1 SV=1 30 441 2.0E-21
sp|P79102|CP3AS_BOVIN Cytochrome P450 3A28 OS=Bos taurus GN=CYP3A28 PE=2 SV=1 44 470 4.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q05047|C72A1_CATRO Secologanin synthase OS=Catharanthus roseus GN=CYP72A1 PE=2 SV=1 14 441 5.0E-24
sp|Q9GQM9|CP6L1_BLAGE Cytochrome P450 6l1 OS=Blattella germanica GN=CYP6L1 PE=2 SV=1 4 440 1.0E-21
sp|H1A981|C7263_MEDTR 11-oxo-beta-amyrin 30-oxidase OS=Medicago truncatula GN=CYP72A63 PE=1 SV=1 24 441 2.0E-21
sp|H1A988|C7254_GLYUR 11-oxo-beta-amyrin 30-oxidase OS=Glycyrrhiza uralensis GN=CYP72A154 PE=1 SV=1 30 441 2.0E-21
sp|P79102|CP3AS_BOVIN Cytochrome P450 3A28 OS=Bos taurus GN=CYP3A28 PE=2 SV=1 44 470 4.0E-21
sp|Q9LUC9|C7A11_ARATH Cytochrome P450 72A11 OS=Arabidopsis thaliana GN=CYP72A11 PE=2 SV=1 259 441 1.0E-20
sp|Q07973|CP24A_HUMAN 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Homo sapiens GN=CYP24A1 PE=1 SV=2 84 463 3.0E-20
sp|Q9PVE8|C330_FUNHE Cytochrome P450 3A30 OS=Fundulus heteroclitus GN=cyp3a30 PE=2 SV=2 44 469 5.0E-20
sp|Q8AXY5|C356_FUNHE Cytochrome P450 3A56 OS=Fundulus heteroclitus GN=cyp3a56 PE=2 SV=1 44 469 5.0E-20
sp|Q6Z6D6|C7342_ORYSJ Cytochrome P450 734A2 OS=Oryza sativa subsp. japonica GN=CYP734A2 PE=2 SV=1 42 439 5.0E-20
sp|P24462|CP3A7_HUMAN Cytochrome P450 3A7 OS=Homo sapiens GN=CYP3A7 PE=1 SV=2 47 469 7.0E-20
sp|B9X287|C7346_ORYSJ Cytochrome P450 734A6 OS=Oryza sativa subsp. japonica GN=CYP734A6 PE=2 SV=1 25 444 9.0E-20
sp|P24463|CP3AC_CANLF Cytochrome P450 3A12 OS=Canis lupus familiaris GN=CYP3A12 PE=2 SV=1 44 469 9.0E-20
sp|Q5UQ90|YL532_MIMIV Cytochrome P450-like protein L532 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L532 PE=1 SV=1 273 446 1.0E-19
sp|Q9LUC6|C7A14_ARATH Cytochrome P450 72A14 OS=Arabidopsis thaliana GN=CYP72A14 PE=2 SV=1 259 441 2.0E-19
sp|Q9JMA7|CP341_MOUSE Cytochrome P450 3A41 OS=Mus musculus GN=Cyp3a41a PE=1 SV=2 4 461 2.0E-19
sp|Q964R0|CP6K1_BLAGE Cytochrome P450 6k1 OS=Blattella germanica GN=CYP6K1 PE=2 SV=1 42 440 2.0E-19
sp|P11707|CP3A6_RABIT Cytochrome P450 3A6 OS=Oryctolagus cuniculus GN=CYP3A6 PE=2 SV=2 4 461 2.0E-19
sp|Q964R1|CP6J1_BLAGE Cytochrome P450 6j1 OS=Blattella germanica GN=CYP6J1 PE=2 SV=1 8 465 2.0E-19
sp|Q29496|CP3AO_SHEEP Cytochrome P450 3A24 OS=Ovis aries GN=CYP3A24 PE=2 SV=1 44 461 3.0E-19
sp|Q64481|CP3AG_MOUSE Cytochrome P450 3A16 OS=Mus musculus GN=Cyp3a16 PE=2 SV=2 4 451 4.0E-19
sp|Q9LUC5|C7A15_ARATH Cytochrome P450 72A15 OS=Arabidopsis thaliana GN=CYP72A15 PE=2 SV=1 259 441 5.0E-19
sp|Q09128|CP24A_RAT 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp24a1 PE=1 SV=1 94 463 7.0E-19
sp|Q93Z79|C14A1_ARATH Cytochrome P450 714A1 OS=Arabidopsis thaliana GN=CYP714A1 PE=2 SV=1 44 456 7.0E-19
sp|F4IK45|C70B2_ARATH Cytochrome P450 709B2 OS=Arabidopsis thaliana GN=CYP709B2 PE=2 SV=1 238 441 1.0E-18
sp|Q6NKZ8|C14A2_ARATH Cytochrome P450 714A2 OS=Arabidopsis thaliana GN=CYP714A2 PE=2 SV=1 262 456 1.0E-18
sp|O17624|C13B1_CAEEL Putative cytochrome P450 cyp-13B1 OS=Caenorhabditis elegans GN=cyp-13B1 PE=3 SV=2 44 439 1.0E-18
sp|Q9LUC8|C7A13_ARATH Cytochrome P450 72A13 OS=Arabidopsis thaliana GN=CYP72A13 PE=2 SV=1 259 441 1.0E-18
sp|Q9FF18|C7351_ARATH Cytokinin hydroxylase OS=Arabidopsis thaliana GN=CYP735A1 PE=1 SV=1 42 441 1.0E-18
sp|P08684|CP3A4_HUMAN Cytochrome P450 3A4 OS=Homo sapiens GN=CYP3A4 PE=1 SV=4 42 469 2.0E-18
sp|Q98T91|C340_ORYLA Cytochrome P450 3A40 OS=Oryzias latipes GN=cyp3a40 PE=2 SV=1 44 469 2.0E-18
sp|Q9ASR3|C7091_ARATH Cytochrome P450 709B1 OS=Arabidopsis thaliana GN=CYP709B1 PE=2 SV=1 217 437 2.0E-18
sp|Q64464|CP3AD_MOUSE Cytochrome P450 3A13 OS=Mus musculus GN=Cyp3a13 PE=1 SV=1 44 440 2.0E-18
sp|P98187|CP4F8_HUMAN Cytochrome P450 4F8 OS=Homo sapiens GN=CYP4F8 PE=1 SV=1 42 430 2.0E-18
sp|Q50EK4|C75A1_PINTA Cytochrome P450 750A1 OS=Pinus taeda GN=CYP750A1 PE=2 SV=1 240 445 3.0E-18
sp|Q69XM6|C7344_ORYSJ Cytochrome P450 734A4 OS=Oryza sativa subsp. japonica GN=CYP734A4 PE=2 SV=1 42 441 3.0E-18
sp|P79152|CP3AJ_CAPHE Cytochrome P450 3A19 (Fragment) OS=Capra hircus aegagrus GN=CYP3A19 PE=2 SV=1 261 470 4.0E-18
sp|Q64441|CP24A_MOUSE 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Mus musculus GN=Cyp24a1 PE=2 SV=1 94 463 4.0E-18
sp|O09158|CP3AP_MOUSE Cytochrome P450 3A25 OS=Mus musculus GN=Cyp3a25 PE=1 SV=1 4 427 5.0E-18
sp|P05183|CP3A2_RAT Cytochrome P450 3A2 OS=Rattus norvegicus GN=Cyp3a2 PE=1 SV=2 44 461 5.0E-18
sp|P51538|CP3A9_RAT Cytochrome P450 3A9 OS=Rattus norvegicus GN=Cyp3a9 PE=2 SV=2 42 461 7.0E-18
sp|Q9SHG5|C72C1_ARATH Cytochrome P450 72C1 OS=Arabidopsis thaliana GN=CYP72C1 PE=2 SV=2 261 441 8.0E-18
sp|Q9STL0|C71AN_ARATH Cytochrome P450 71A23 OS=Arabidopsis thaliana GN=CYP71A23 PE=2 SV=1 213 456 8.0E-18
sp|Q12588|CP52J_CANMA Cytochrome P450 52A10 OS=Candida maltosa GN=CYP52A10 PE=2 SV=1 265 438 1.0E-17
sp|P33268|CP3A8_MACFA Cytochrome P450 3A8 OS=Macaca fascicularis GN=CYP3A8 PE=1 SV=1 44 469 1.0E-17
sp|Q27520|C13A1_CAEEL Putative cytochrome P450 CYP13A1 OS=Caenorhabditis elegans GN=cyp-13A1 PE=3 SV=1 44 440 1.0E-17
sp|O70537|CP3AV_MESAU Cytochrome P450 3A31 OS=Mesocricetus auratus GN=CYP3A31 PE=2 SV=1 44 451 1.0E-17
sp|P30608|CP52F_CANTR Cytochrome P450 52A6 OS=Candida tropicalis GN=CYP52A6 PE=2 SV=1 258 440 1.0E-17
sp|Q5KQH7|C14D1_ORYSJ Cytochrome P450 714D1 OS=Oryza sativa subsp. japonica GN=CYP714D1 PE=1 SV=1 233 441 1.0E-17
sp|Q64581|CP3AI_RAT Cytochrome P450 3A18 OS=Rattus norvegicus GN=Cyp3a18 PE=2 SV=1 44 461 1.0E-17
sp|Q64459|CP3AB_MOUSE Cytochrome P450 3A11 OS=Mus musculus GN=Cyp3a11 PE=1 SV=1 4 461 2.0E-17
sp|Q9STK8|C71AP_ARATH Cytochrome P450 71A25 OS=Arabidopsis thaliana GN=CYP71A25 PE=2 SV=1 211 438 2.0E-17
sp|Q9FI39|THAD_ARATH Cytochrome P450 705A5 OS=Arabidopsis thaliana GN=CYP705A5 PE=2 SV=1 210 419 2.0E-17
sp|Q9EP75|CP4FE_MOUSE Leukotriene-B4 omega-hydroxylase 3 OS=Mus musculus GN=Cyp4f14 PE=1 SV=1 42 466 2.0E-17
sp|Q64148|CP3AA_MESAU Lithocholate 6-beta-hydroxylase OS=Mesocricetus auratus GN=CYP3A10 PE=1 SV=2 20 444 2.0E-17
sp|P79401|CP3AT_PIG Cytochrome P450 3A29 OS=Sus scrofa GN=CYP3A29 PE=2 SV=1 42 461 2.0E-17
sp|Q95031|CP6B6_HELAM Cytochrome P450 6B6 OS=Helicoverpa armigera GN=CYP6B6 PE=2 SV=1 45 440 3.0E-17
sp|Q9T0K0|C71AJ_ARATH Cytochrome P450 71A19 OS=Arabidopsis thaliana GN=CYP71A19 PE=2 SV=1 95 440 3.0E-17
sp|P51869|CP4F4_RAT Cytochrome P450 4F4 OS=Rattus norvegicus GN=Cyp4f4 PE=2 SV=1 241 430 3.0E-17
sp|P49430|THAS_RAT Thromboxane-A synthase OS=Rattus norvegicus GN=Tbxas1 PE=2 SV=1 8 440 3.0E-17
sp|Q9ZW95|C7352_ARATH Cytokinin hydroxylase OS=Arabidopsis thaliana GN=CYP735A2 PE=1 SV=1 42 441 3.0E-17
sp|P16496|CP52C_CANMA Cytochrome P450 52A3-A OS=Candida maltosa GN=CYP52A3-A PE=1 SV=3 244 433 4.0E-17
sp|P24458|CP52E_CANMA Cytochrome P450 52A3-B OS=Candida maltosa GN=CYP52A3-B PE=1 SV=1 240 433 5.0E-17
sp|Q08477|CP4F3_HUMAN Docosahexaenoic acid omega-hydroxylase CYP4F3 OS=Homo sapiens GN=CYP4F3 PE=1 SV=2 238 430 5.0E-17
sp|Q9STK9|C71AO_ARATH Cytochrome P450 71A24 OS=Arabidopsis thaliana GN=CYP71A24 PE=2 SV=3 210 438 5.0E-17
sp|B9G934|C14C3_ORYSJ Cytochrome P450 714C3 OS=Oryza sativa subsp. japonica GN=CYP714C3 PE=3 SV=2 262 437 5.0E-17
sp|Q09653|C13AA_CAEEL Putative cytochrome P450 CYP13A10 OS=Caenorhabditis elegans GN=cyp-13A10 PE=3 SV=3 6 441 7.0E-17
sp|P20815|CP3A5_HUMAN Cytochrome P450 3A5 OS=Homo sapiens GN=CYP3A5 PE=1 SV=1 41 468 9.0E-17
sp|Q9Y757|CP52L_DEBHN Cytochrome P450 52A12 OS=Debaryomyces hansenii GN=CYP52A12 PE=2 SV=2 258 437 1.0E-16
sp|Q9HB55|CP343_HUMAN Cytochrome P450 3A43 OS=Homo sapiens GN=CYP3A43 PE=1 SV=1 44 469 1.0E-16
sp|O42563|CP3AR_ONCMY Cytochrome P450 3A27 OS=Oncorhynchus mykiss GN=cyp3a27 PE=2 SV=1 22 468 1.0E-16
sp|B6SSW8|C14B3_MAIZE Cytochrome P450 714B3 OS=Zea mays GN=CYP714B3 PE=2 SV=1 262 441 1.0E-16
sp|H2DH21|C7A29_PANGI Cytochrome P450 CYP72A219 OS=Panax ginseng PE=2 SV=1 220 437 1.0E-16
sp|P04800|CP3A1_RAT Cytochrome P450 3A1 OS=Rattus norvegicus GN=Cyp3a1 PE=1 SV=1 44 461 1.0E-16
sp|Q2PG45|THAS_MACFA Thromboxane-A synthase OS=Macaca fascicularis GN=TBXAS1 PE=2 SV=2 246 430 1.0E-16
sp|Q12586|CP52I_CANMA Cytochrome P450 52A9 OS=Candida maltosa GN=CYP52A9 PE=1 SV=1 265 439 1.0E-16
sp|Q9STL1|C71AM_ARATH Cytochrome P450 71A22 OS=Arabidopsis thaliana GN=CYP71A22 PE=2 SV=1 213 438 2.0E-16
sp|Q9V676|CP6T3_DROME Probable cytochrome P450 6t3 OS=Drosophila melanogaster GN=Cyp6t3 PE=3 SV=1 262 448 2.0E-16
sp|P33274|CP4F1_RAT Cytochrome P450 4F1 OS=Rattus norvegicus GN=Cyp4f1 PE=2 SV=1 241 430 2.0E-16
sp|P47787|THAS_PIG Thromboxane-A synthase OS=Sus scrofa GN=TBXAS1 PE=2 SV=1 226 440 2.0E-16
sp|D4AY62|A1131_ARTBC Cytochrome P450 ARB_01131 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01131 PE=3 SV=1 265 438 2.0E-16
sp|Q64409|CP3AH_CAVPO Cytochrome P450 3A17 OS=Cavia porcellus GN=CYP3A17 PE=2 SV=1 44 461 2.0E-16
sp|Q12589|CP52K_CANMA Cytochrome P450 52A11 OS=Candida maltosa GN=CYP52A11 PE=2 SV=1 265 438 3.0E-16
sp|Q9T093|C70B3_ARATH Cytochrome P450 709B3 OS=Arabidopsis thaliana GN=CYP709B3 PE=2 SV=1 246 441 3.0E-16
sp|Q27664|CP6B2_HELAM Cytochrome P450 6B2 OS=Helicoverpa armigera GN=CYP6B2 PE=2 SV=1 45 440 3.0E-16
sp|Q27515|C13A6_CAEEL Putative cytochrome P450 CYP13A6 OS=Caenorhabditis elegans GN=cyp-13A6 PE=3 SV=1 256 436 4.0E-16
sp|P58047|C71AS_ARATH Putative cytochrome P450 71A28 OS=Arabidopsis thaliana GN=CYP71A28 PE=3 SV=2 283 446 4.0E-16
sp|Q3MID2|CP4F3_RAT Leukotriene-B(4) omega-hydroxylase 2 OS=Rattus norvegicus GN=Cyp4f3 PE=2 SV=1 260 466 4.0E-16
sp|Q9HCS2|CP4FC_HUMAN Cytochrome P450 4F12 OS=Homo sapiens GN=CYP4F12 PE=1 SV=2 241 433 6.0E-16
sp|P30607|CP52B_CANTR Cytochrome P450 52A2 OS=Candida tropicalis GN=CYP52A2 PE=1 SV=1 258 425 6.0E-16
sp|Q27518|C13A2_CAEEL Putative cytochrome P450 CYP13A2 OS=Caenorhabditis elegans GN=cyp-13A2 PE=3 SV=1 261 468 6.0E-16
sp|Q9GJX5|CP4AL_PIG Taurochenodeoxycholic 6 alpha-hydroxylase OS=Sus scrofa GN=CYP4A21 PE=1 SV=1 249 439 6.0E-16
sp|Q9T0K2|C71AK_ARATH Cytochrome P450 71A20 OS=Arabidopsis thaliana GN=CYP71A20 PE=2 SV=2 125 440 7.0E-16
sp|P51871|CP4F6_RAT Cytochrome P450 4F6 OS=Rattus norvegicus GN=Cyp4f6 PE=2 SV=1 261 430 7.0E-16
sp|Q99N16|CP4F3_MOUSE Leukotriene-B(4) omega-hydroxylase 2 OS=Mus musculus GN=Cyp4f3 PE=1 SV=2 260 462 7.0E-16
sp|Q9FIB0|C78A7_ARATH Cytochrome P450 78A7 OS=Arabidopsis thaliana GN=CYP78A7 PE=2 SV=1 255 419 7.0E-16
sp|P36423|THAS_MOUSE Thromboxane-A synthase OS=Mus musculus GN=Tbxas1 PE=1 SV=2 253 416 7.0E-16
sp|P78329|CP4F2_HUMAN Phylloquinone omega-hydroxylase CYP4F2 OS=Homo sapiens GN=CYP4F2 PE=1 SV=1 42 430 7.0E-16
sp|Q0DS59|C14B2_ORYSJ Cytochrome P450 714B2 OS=Oryza sativa subsp. japonica GN=CYP714B2 PE=1 SV=2 262 441 8.0E-16
sp|Q9SWR5|C93C1_SOYBN 2-hydroxyisoflavanone synthase OS=Glycine max GN=IFS2 PE=2 SV=1 214 442 8.0E-16
sp|P43083|CP52V_CANAP Cytochrome P450 52E1 OS=Candida apicola GN=CYP52E1 PE=3 SV=1 265 442 8.0E-16
sp|P51870|CP4F5_RAT Cytochrome P450 4F5 OS=Rattus norvegicus GN=Cyp4f5 PE=2 SV=1 260 430 9.0E-16
sp|Q9VVR9|C12C1_DROME Probable cytochrome P450 12c1, mitochondrial OS=Drosophila melanogaster GN=Cyp12c1 PE=2 SV=2 263 463 9.0E-16
sp|Q7XHW5|C14B1_ORYSJ Cytochrome P450 714B1 OS=Oryza sativa subsp. japonica GN=CYP714B1 PE=1 SV=2 262 441 1.0E-15
sp|Q9VXY0|CP4S3_DROME Probable cytochrome P450 4s3 OS=Drosophila melanogaster GN=Cyp4s3 PE=3 SV=1 4 433 1.0E-15
sp|Q12573|CP52W_CANAP Cytochrome P450 52E2 OS=Candida apicola GN=CYP52E2 PE=3 SV=1 265 442 1.0E-15
sp|Q9VRB3|CP6V1_DROME Probable cytochrome P450 6v1 OS=Drosophila melanogaster GN=Cyp6v1 PE=2 SV=1 218 444 1.0E-15
sp|P24557|THAS_HUMAN Thromboxane-A synthase OS=Homo sapiens GN=TBXAS1 PE=1 SV=3 256 430 2.0E-15
sp|Q2QYH7|C14C2_ORYSJ Cytochrome P450 714C2 OS=Oryza sativa subsp. japonica GN=CYP714C2 PE=2 SV=1 237 425 2.0E-15
sp|Q9HBI6|CP4FB_HUMAN Phylloquinone omega-hydroxylase CYP4F11 OS=Homo sapiens GN=CYP4F11 PE=1 SV=3 260 430 2.0E-15
sp|Q2KIG5|THAS_BOVIN Thromboxane-A synthase OS=Bos taurus GN=TBXAS1 PE=2 SV=1 256 416 2.0E-15
sp|A6YIH8|C7D55_HYOMU Premnaspirodiene oxygenase OS=Hyoscyamus muticus GN=CYP71D55 PE=1 SV=1 225 438 2.0E-15
sp|Q64417|CP3AE_CAVPO Cytochrome P450 3A14 OS=Cavia porcellus GN=CYP3A14 PE=2 SV=2 44 461 3.0E-15
sp|Q64406|CP3AF_CAVPO Cytochrome P450 3A15 OS=Cavia porcellus GN=CYP3A15 PE=2 SV=1 261 433 3.0E-15
sp|E3W9C4|C71A1_ZINZE Alpha-humulene 10-hydroxylase OS=Zingiber zerumbet GN=CYP71BA1 PE=1 SV=1 240 438 3.0E-15
sp|P10632|CP2C8_HUMAN Cytochrome P450 2C8 OS=Homo sapiens GN=CYP2C8 PE=1 SV=2 5 443 4.0E-15
sp|Q9VFJ0|CA131_DROME Probable cytochrome P450 313a1 OS=Drosophila melanogaster GN=Cyp313a1 PE=3 SV=2 261 439 4.0E-15
sp|Q9VCW1|CP6D4_DROME Probable cytochrome P450 6d4 OS=Drosophila melanogaster GN=Cyp6d4 PE=2 SV=1 262 454 4.0E-15
sp|Q9STK7|C71AQ_ARATH Cytochrome P450 71A26 OS=Arabidopsis thaliana GN=CYP71A26 PE=3 SV=1 1 438 5.0E-15
sp|P30610|CP52H_CANTR Cytochrome P450 52A8 OS=Candida tropicalis GN=CYP52A8 PE=2 SV=1 265 447 5.0E-15
sp|P30612|CP52P_CANTR Cytochrome P450 52C1 OS=Candida tropicalis GN=CYP52C1 PE=2 SV=1 269 416 5.0E-15
sp|P82711|C6A19_DROME Probable cytochrome P450 6a19 OS=Drosophila melanogaster GN=Cyp6a19 PE=3 SV=1 91 441 5.0E-15
sp|Q12645|PID9_FUSSO Pisatin demethylase OS=Fusarium solani subsp. pisi GN=PDAT9 PE=3 SV=1 270 441 7.0E-15
sp|O18993|CP3AL_CALJA Cytochrome P450 3A21 OS=Callithrix jacchus GN=CYP3A21 PE=2 SV=1 44 469 7.0E-15
sp|Q9ZUX1|C94C1_ARATH Cytochrome P450 94C1 OS=Arabidopsis thaliana GN=CYP94C1 PE=2 SV=1 80 441 1.0E-14
sp|O48921|C97B2_SOYBN Cytochrome P450 97B2, chloroplastic OS=Glycine max GN=CYP97B2 PE=2 SV=1 269 445 1.0E-14
sp|P20817|CP4AE_RAT Cytochrome P450 4A14 OS=Rattus norvegicus GN=Cyp4a14 PE=1 SV=2 1 445 1.0E-14
sp|O48786|C734A_ARATH Cytochrome P450 734A1 OS=Arabidopsis thaliana GN=CYP734A1 PE=2 SV=1 259 437 1.0E-14
sp|Q27513|C13A4_CAEEL Putative cytochrome P450 CYP13A4 OS=Caenorhabditis elegans GN=cyp-13A4 PE=3 SV=1 6 431 1.0E-14
sp|Q27516|C13A8_CAEEL Putative cytochrome P450 CYP13A8 OS=Caenorhabditis elegans GN=cyp-13A8 PE=3 SV=2 259 440 1.0E-14
sp|Q8K4D6|CP4X1_RAT Cytochrome P450 4X1 OS=Rattus norvegicus GN=Cyp4x1 PE=2 SV=1 209 430 1.0E-14
sp|Q9FVS9|C96AF_ARATH Alkane hydroxylase MAH1 OS=Arabidopsis thaliana GN=CYP96A15 PE=2 SV=1 2 443 2.0E-14
sp|Q12581|CP52X_CANMA Cytochrome P450 52A5 OS=Candida maltosa GN=CYP52A5 PE=1 SV=1 258 443 2.0E-14
sp|Q7Y1V5|C78AB_ORYSJ Cytochrome P450 78A11 OS=Oryza sativa subsp. japonica GN=CYP78A11 PE=1 SV=2 261 417 2.0E-14
sp|P29980|CPXN_NOSS1 Probable cytochrome P450 110 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=cyp110 PE=3 SV=3 129 470 2.0E-14
sp|Q9V770|C6A17_DROME Probable cytochrome P450 6a17 OS=Drosophila melanogaster GN=Cyp6a17 PE=2 SV=1 240 425 2.0E-14
sp|Q9VFP1|CP6D5_DROME Probable cytochrome P450 6d5 OS=Drosophila melanogaster GN=Cyp6d5 PE=2 SV=1 47 462 2.0E-14
sp|Q94FM7|C71DK_TOBAC 5-epiaristolochene 1,3-dihydroxylase OS=Nicotiana tabacum GN=CYP71D20 PE=1 SV=2 253 438 3.0E-14
sp|O23365|C97B3_ARATH Cytochrome P450 97B3, chloroplastic OS=Arabidopsis thaliana GN=CYP97B3 PE=2 SV=2 269 453 3.0E-14
sp|Q9V4U7|C6A14_DROME Probable cytochrome P450 6a14 OS=Drosophila melanogaster GN=Cyp6a14 PE=3 SV=2 264 447 3.0E-14
sp|Q947B7|MFS_MENPI (+)-menthofuran synthase OS=Mentha piperita PE=1 SV=1 240 441 3.0E-14
sp|Q9XHE8|C71DI_MENSP Cytochrome P450 71D18 OS=Mentha spicata GN=CYP71D18 PE=1 SV=1 215 438 4.0E-14
sp|Q6WKZ1|C71DI_MENGR Cytochrome P450 71D18 OS=Mentha gracilis GN=CYP71D18 PE=1 SV=1 215 438 4.0E-14
sp|P10615|CP52A_CANTR Cytochrome P450 52A1 OS=Candida tropicalis GN=CYP52A1 PE=1 SV=3 265 425 4.0E-14
sp|Q6A152|CP4X1_MOUSE Cytochrome P450 4X1 OS=Mus musculus GN=Cyp4x1 PE=1 SV=1 209 439 4.0E-14
sp|O81974|C71D8_SOYBN Cytochrome P450 71D8 OS=Glycine max GN=CYP71D8 PE=2 SV=1 249 444 5.0E-14
sp|Q9Y758|CP52M_DEBHN Cytochrome P450 52A13 OS=Debaryomyces hansenii GN=CYP52A13 PE=2 SV=1 258 445 5.0E-14
sp|O46054|C4AE1_DROME Cytochrome P450 4ae1 OS=Drosophila melanogaster GN=Cyp4ae1 PE=2 SV=1 141 433 5.0E-14
sp|O81973|C93A3_SOYBN Cytochrome P450 93A3 OS=Glycine max GN=CYP93A3 PE=2 SV=1 211 420 5.0E-14
sp|Q02928|CP4AB_HUMAN Cytochrome P450 4A11 OS=Homo sapiens GN=CYP4A11 PE=1 SV=1 261 445 5.0E-14
sp|Q5TCH4|CP4AM_HUMAN Cytochrome P450 4A22 OS=Homo sapiens GN=CYP4A22 PE=1 SV=1 261 428 6.0E-14
sp|Q8SPK0|CP4AP_PIG Cytochrome P450 4A25 OS=Sus scrofa GN=CYP4A25 PE=2 SV=1 261 439 6.0E-14
sp|Q7KWN2|C525A_DICDI Probable cytochrome P450 525A1 OS=Dictyostelium discoideum GN=cyp525A1 PE=3 SV=1 260 468 6.0E-14
sp|O61387|CP6B7_HELAM Cytochrome P450 6B7 OS=Helicoverpa armigera GN=CYP6B7 PE=2 SV=1 45 440 6.0E-14
sp|Q6NT55|CP4FN_HUMAN Cytochrome P450 4F22 OS=Homo sapiens GN=CYP4F22 PE=2 SV=1 232 440 7.0E-14
sp|Q8SPK1|CP4AO_PIG Cytochrome P450 4A24 OS=Sus scrofa GN=CYP4A24 PE=2 SV=1 261 451 7.0E-14
sp|P48420|C78A1_MAIZE Cytochrome P450 78A1 OS=Zea mays GN=CYP78A1 PE=2 SV=1 224 417 7.0E-14
sp|P33262|CP2CK_MACFA Cytochrome P450 2C20 OS=Macaca fascicularis GN=CYP2C20 PE=2 SV=1 42 440 7.0E-14
sp|Q9UVC3|CP51_CUNEL Lanosterol 14-alpha demethylase OS=Cunninghamella elegans GN=CYP51 PE=3 SV=1 260 441 9.0E-14
sp|Q9Y6A2|CP46A_HUMAN Cholesterol 24-hydroxylase OS=Homo sapiens GN=CYP46A1 PE=1 SV=1 229 461 9.0E-14
sp|Q9Y8G7|C505_FUSOX Bifunctional P-450:NADPH-P450 reductase OS=Fusarium oxysporum GN=CYP505 PE=1 SV=1 1 443 1.0E-13
sp|Q5IZM4|CP51_MYCVP Lanosterol 14-alpha demethylase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=cyp51 PE=3 SV=1 269 445 1.0E-13
sp|Q42716|C71A8_MENPI Cytochrome P450 71A8 OS=Mentha piperita GN=CYP71A8 PE=3 SV=1 212 441 1.0E-13
sp|O46515|CP11A_HORSE Cholesterol side-chain cleavage enzyme, mitochondrial OS=Equus caballus GN=CYP11A1 PE=3 SV=1 257 463 2.0E-13
sp|Q27589|CP4D2_DROME Cytochrome P450 4d2 OS=Drosophila melanogaster GN=Cyp4d2 PE=2 SV=2 240 439 2.0E-13
sp|B9GBJ9|C14C1_ORYSJ Cytochrome P450 714C1 OS=Oryza sativa subsp. japonica GN=CYP714C1 PE=2 SV=1 262 437 2.0E-13
sp|O48958|C71E1_SORBI 4-hydroxyphenylacetaldehyde oxime monooxygenase OS=Sorghum bicolor GN=CYP71E1 PE=2 SV=1 212 417 2.0E-13
sp|P05179|CP2C7_RAT Cytochrome P450 2C7 OS=Rattus norvegicus GN=Cyp2c7 PE=1 SV=2 42 445 2.0E-13
sp|P21595|CP56_YEAST Cytochrome P450-DIT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIT2 PE=1 SV=2 1 437 3.0E-13
sp|Q9LMM1|C86A4_ARATH Cytochrome P450 86A4 OS=Arabidopsis thaliana GN=CYP86A4 PE=1 SV=1 8 429 3.0E-13
sp|P13527|CP6A1_MUSDO Cytochrome P450 6A1 OS=Musca domestica GN=CYP6A1 PE=2 SV=1 93 451 3.0E-13
sp|O65012|C78A4_PINRA Cytochrome P450 78A4 OS=Pinus radiata GN=CYP78A4 PE=2 SV=1 260 434 3.0E-13
sp|Q9VWR2|CP308_DROME Probable cytochrome P450 308a1 OS=Drosophila melanogaster GN=Cyp308a1 PE=2 SV=2 238 469 3.0E-13
sp|Q9W130|CP9C1_DROME Cytochrome P450 9c1 OS=Drosophila melanogaster GN=Cyp9c1 PE=2 SV=1 244 444 4.0E-13
sp|P82713|CP392_DROME Probable cytochrome P450 309a2 OS=Drosophila melanogaster GN=Cyp309a2 PE=2 SV=2 217 439 5.0E-13
sp|O49342|C71AD_ARATH Indoleacetaldoxime dehydratase OS=Arabidopsis thaliana GN=CYP71A13 PE=1 SV=1 241 438 5.0E-13
sp|P9WPN2|CP132_MYCTO Putative cytochrome P450 132 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp132 PE=3 SV=1 51 468 5.0E-13
sp|P59954|CP132_MYCBO Putative cytochrome P450 132 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp132 PE=3 SV=1 51 468 5.0E-13
sp|P38364|PID6_FUSSO Pisatin demethylase OS=Fusarium solani subsp. pisi GN=PDA6-1 PE=3 SV=1 270 441 5.0E-13
sp|Q9LJY7|C75AK_ARATH Cytochrome P450 705A20 OS=Arabidopsis thaliana GN=CYP705A20 PE=2 SV=1 210 454 5.0E-13
sp|Q9VHP4|CP313_DROME Probable cytochrome P450 313b1 OS=Drosophila melanogaster GN=Cyp313b1 PE=2 SV=2 6 439 5.0E-13
sp|O08336|CYPB_BACSU Bifunctional cytochrome P450/NADPH--P450 reductase 2 OS=Bacillus subtilis (strain 168) GN=cypB PE=1 SV=1 87 433 6.0E-13
sp|P9WPN3|CP132_MYCTU Putative cytochrome P450 132 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp132 PE=1 SV=1 51 468 6.0E-13
sp|Q9SXS3|C93C2_GLYEC 2-hydroxyisoflavanone synthase OS=Glycyrrhiza echinata GN=CYP93C2 PE=1 SV=1 211 442 6.0E-13
sp|O35728|CP4AE_MOUSE Cytochrome P450 4A14 OS=Mus musculus GN=Cyp4a14 PE=1 SV=1 261 445 6.0E-13
sp|O23066|C86A2_ARATH Cytochrome P450 86A2 OS=Arabidopsis thaliana GN=CYP86A2 PE=1 SV=1 8 429 7.0E-13
sp|Q9V4U9|C6A13_DROME Probable cytochrome P450 6a13 OS=Drosophila melanogaster GN=Cyp6a13 PE=2 SV=1 94 433 7.0E-13
sp|P20816|CP4A2_RAT Cytochrome P450 4A2 OS=Rattus norvegicus GN=Cyp4a2 PE=1 SV=2 1 439 7.0E-13
sp|B3RFJ6|86A22_PETHY Cytochrome P450 86A22 OS=Petunia hybrida GN=CYP86A22 PE=1 SV=1 8 429 7.0E-13
sp|G4XV71|C93C2_GLYUR 2-hydroxyisoflavanone synthase OS=Glycyrrhiza uralensis GN=CYP93C2 PE=2 SV=2 211 442 7.0E-13
sp|Q9WVK8|CP46A_MOUSE Cholesterol 24-hydroxylase OS=Mus musculus GN=Cyp46a1 PE=1 SV=1 229 461 8.0E-13
sp|P93530|C71D6_SOLCH Cytochrome P450 71D6 OS=Solanum chacoense GN=CYP71D6 PE=2 SV=1 240 421 8.0E-13
sp|Q91WL5|CP4CA_MOUSE Cytochrome P450 4A12A OS=Mus musculus GN=Cyp4a12a PE=1 SV=2 249 445 8.0E-13
sp|Q9DBW0|CP4V2_MOUSE Cytochrome P450 4V2 OS=Mus musculus GN=Cyp4v2 PE=1 SV=1 240 440 8.0E-13
sp|Q9LTL8|C71BO_ARATH Cytochrome P450 71B24 OS=Arabidopsis thaliana GN=CYP71B24 PE=2 SV=1 212 464 9.0E-13
sp|Q42799|C93A2_SOYBN Cytochrome P450 93A2 OS=Glycine max GN=CYP93A2 PE=2 SV=1 215 420 9.0E-13
sp|Q96581|C75A4_GENTR Flavonoid 3',5'-hydroxylase OS=Gentiana triflora GN=CYP75A4 PE=2 SV=1 216 462 9.0E-13
sp|Q27514|C13A5_CAEEL Putative cytochrome P450 CYP13A5 OS=Caenorhabditis elegans GN=cyp-13A5 PE=3 SV=1 6 440 9.0E-13
sp|S4UX02|CYPH1_SALMI Ferruginol synthase OS=Salvia miltiorrhiza GN=CYP76AH1 PE=1 SV=1 204 443 9.0E-13
sp|A3A871|C71Z6_ORYSJ Ent-isokaurene C2-hydroxylase OS=Oryza sativa subsp. japonica GN=CYP71Z6 PE=1 SV=1 248 438 9.0E-13
sp|Q9VA27|CP4C3_DROME Cytochrome P450 4c3 OS=Drosophila melanogaster GN=Cyp4c3 PE=2 SV=1 259 444 1.0E-12
sp|P79153|CP11A_CAPHI Cholesterol side-chain cleavage enzyme, mitochondrial OS=Capra hircus GN=CYP11A1 PE=2 SV=1 255 454 1.0E-12
sp|Q27519|C13A7_CAEEL Putative cytochrome P450 CYP13A7 OS=Caenorhabditis elegans GN=cyp-13A7 PE=3 SV=1 261 440 1.0E-12
sp|Q27698|CP6D1_MUSDO Cytochrome P450 6d1 OS=Musca domestica GN=CYP6D1 PE=1 SV=1 42 448 1.0E-12
sp|O04164|C71A6_NEPRA Cytochrome P450 71A6 (Fragment) OS=Nepeta racemosa GN=CYP71A6 PE=2 SV=1 158 441 2.0E-12
sp|P33269|CP4D1_DROME Cytochrome P450 4d1 OS=Drosophila melanogaster GN=Cyp4d1 PE=2 SV=2 42 468 2.0E-12
sp|Q9VYQ7|CP311_DROME Probable cytochrome P450 311a1 OS=Drosophila melanogaster GN=Cyp311a1 PE=2 SV=1 229 466 2.0E-12
sp|P9WPP9|CP51_MYCTU Lanosterol 14-alpha demethylase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp51 PE=1 SV=1 269 445 2.0E-12
sp|P9WPP8|CP51_MYCTO Lanosterol 14-alpha demethylase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp51 PE=3 SV=1 269 445 2.0E-12
sp|P0A513|CP51_MYCBO Lanosterol 14-alpha demethylase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp51 PE=3 SV=1 269 445 2.0E-12
sp|P05108|CP11A_HUMAN Cholesterol side-chain cleavage enzyme, mitochondrial OS=Homo sapiens GN=CYP11A1 PE=1 SV=2 260 463 2.0E-12
sp|P08683|CP2CB_RAT Cytochrome P450 2C11 OS=Rattus norvegicus GN=Cyp2c11 PE=1 SV=1 42 442 2.0E-12
sp|Q95036|CP6B5_PAPGL Cytochrome P450 6B5 (Fragment) OS=Papilio glaucus GN=CYP6B5 PE=2 SV=1 45 440 2.0E-12
sp|Q9XHE6|C71DF_MENPI Cytochrome P450 71D15 OS=Mentha piperita GN=CYP71D15 PE=1 SV=1 259 443 2.0E-12
sp|P37120|C75A2_SOLME Flavonoid 3',5'-hydroxylase OS=Solanum melongena GN=CYP75A2 PE=2 SV=1 215 468 2.0E-12
sp|Q9ZNR0|C78A6_ARATH Cytochrome P450 78A6 OS=Arabidopsis thaliana GN=CYP78A6 PE=2 SV=1 261 417 2.0E-12
sp|Q27902|CP6B4_PAPGL Cytochrome P450 6B4 OS=Papilio glaucus GN=CYP6B4 PE=2 SV=1 45 440 2.0E-12
sp|P93531|C71D7_SOLCH Cytochrome P450 71D7 OS=Solanum chacoense GN=CYP71D7 PE=3 SV=1 225 438 2.0E-12
sp|Q9V771|C6A23_DROME Probable cytochrome P450 6a23 OS=Drosophila melanogaster GN=Cyp6a23 PE=2 SV=2 240 425 2.0E-12
sp|P48419|C75A3_PETHY Flavonoid 3',5'-hydroxylase 2 OS=Petunia hybrida GN=CYP75A3 PE=2 SV=1 215 468 3.0E-12
sp|P29981|CP4C1_BLADI Cytochrome P450 4C1 OS=Blaberus discoidalis GN=CYP4C1 PE=2 SV=1 211 444 3.0E-12
sp|Q6WKZ0|C7D94_MENGR Cytochrome P450 71D94 OS=Mentha gracilis GN=CYP71D94 PE=2 SV=1 270 438 3.0E-12
sp|O16805|CP4D1_DROSI Cytochrome P450 4d1 OS=Drosophila simulans GN=Cyp4d1 PE=3 SV=1 42 468 3.0E-12
sp|P79202|CP11A_SHEEP Cholesterol side-chain cleavage enzyme, mitochondrial OS=Ovis aries GN=CYP11A1 PE=1 SV=1 255 454 3.0E-12
sp|P10611|CP4A4_RABIT Cytochrome P450 4A4 OS=Oryctolagus cuniculus GN=CYP4A4 PE=1 SV=3 241 439 3.0E-12
sp|P93149|C93B1_GLYEC Licodione synthase OS=Glycyrrhiza echinata GN=CYP93B1 PE=1 SV=2 262 442 3.0E-12
sp|Q9CAD6|C86A7_ARATH Cytochrome P450 86A7 OS=Arabidopsis thaliana GN=CYP86A7 PE=2 SV=1 69 470 3.0E-12
sp|P08516|CP4AA_RAT Cytochrome P450 4A10 OS=Rattus norvegicus GN=Cyp4a10 PE=1 SV=2 3 445 3.0E-12
sp|Q964T2|CP9E2_BLAGE Cytochrome P450 9e2 OS=Blattella germanica GN=CYP9E2 PE=2 SV=1 261 444 3.0E-12
sp|O04773|C75A6_CAMME Flavonoid 3',5'-hydroxylase OS=Campanula medium GN=CYP75A6 PE=2 SV=1 212 468 4.0E-12
sp|B5BSX1|BAMO_GLYUR Beta-amyrin 11-oxidase OS=Glycyrrhiza uralensis GN=CYP88D6 PE=1 SV=1 6 430 4.0E-12
sp|Q9VVN6|CP312_DROME Probable cytochrome P450 312a1 OS=Drosophila melanogaster GN=Cyp312a1 PE=2 SV=1 250 451 4.0E-12
sp|Q93VK5|LUT5_ARATH Protein LUTEIN DEFICIENT 5, chloroplastic OS=Arabidopsis thaliana GN=CYP97A3 PE=1 SV=1 269 441 4.0E-12
sp|D5JBX1|GAO_BARSP Germacrene A oxidase OS=Barnadesia spinosa PE=1 SV=1 245 421 4.0E-12
sp|Q9XHE7|C71DD_MENPI Cytochrome P450 71D13 OS=Mentha piperita GN=CYP71D13 PE=1 SV=1 217 438 4.0E-12
sp|P48418|C75A1_PETHY Flavonoid 3',5'-hydroxylase 1 OS=Petunia hybrida GN=CYP75A1 PE=2 SV=1 214 468 4.0E-12
sp|Q9V675|CP6G2_DROME Probable cytochrome P450 6g2 OS=Drosophila melanogaster GN=Cyp6g2 PE=2 SV=1 247 433 5.0E-12
sp|A2RRT9|CP4V2_RAT Cytochrome P450 4V2 OS=Rattus norvegicus GN=Cyp4v2 PE=2 SV=1 240 440 5.0E-12
sp|Q9VS79|CP4D8_DROME Cytochrome P450 4d8 OS=Drosophila melanogaster GN=Cyp4d8 PE=2 SV=2 256 439 5.0E-12
sp|O65438|C71AR_ARATH Cytochrome P450 71A27 OS=Arabidopsis thaliana GN=CYP71A27 PE=3 SV=3 261 438 5.0E-12
sp|P10612|CP11A_PIG Cholesterol side-chain cleavage enzyme, mitochondrial OS=Sus scrofa GN=CYP11A1 PE=1 SV=1 256 467 6.0E-12
sp|P14581|CP4A7_RABIT Cytochrome P450 4A7 OS=Oryctolagus cuniculus GN=CYP4A7 PE=1 SV=1 249 439 6.0E-12
sp|Q43078|C97B1_PEA Cytochrome P450 97B1, chloroplastic OS=Pisum sativum GN=CYP97B1 PE=2 SV=1 269 434 6.0E-12
sp|Q86W10|CP4Z1_HUMAN Cytochrome P450 4Z1 OS=Homo sapiens GN=CYP4Z1 PE=2 SV=1 239 428 6.0E-12
sp|Q9VQD2|CP391_DROME Probable cytochrome P450 309a1 OS=Drosophila melanogaster GN=Cyp309a1 PE=1 SV=4 217 444 7.0E-12
sp|O18635|C12A2_MUSDO Cytochrome P450 CYP12A2 OS=Musca domestica GN=CYP12A2 PE=2 SV=1 81 441 7.0E-12
sp|Q50LE0|C85A3_SOLLC Cytochrome P450 85A3 OS=Solanum lycopersicum GN=CYP85A3 PE=2 SV=1 218 430 7.0E-12
sp|Q09736|CP51_SCHPO Lanosterol 14-alpha demethylase erg11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg11 PE=1 SV=1 260 433 7.0E-12
sp|Q9LTL2|C71BP_ARATH Cytochrome P450 71B25 OS=Arabidopsis thaliana GN=CYP71B25 PE=2 SV=1 247 438 7.0E-12
sp|O73853|CP17A_ICTPU Steroid 17-alpha-hydroxylase/17,20 lyase OS=Ictalurus punctatus GN=cyp17a1 PE=2 SV=1 240 441 8.0E-12
sp|P33265|CP2CS_MESAU Cytochrome P450 2C28 OS=Mesocricetus auratus GN=CYP2C28 PE=2 SV=1 42 464 8.0E-12
sp|Q9LIP4|C71BX_ARATH Cytochrome P450 71B36 OS=Arabidopsis thaliana GN=CYP71B36 PE=3 SV=1 218 441 8.0E-12
sp|Q6TBX7|LUT1_ARATH Carotene epsilon-monooxygenase, chloroplastic OS=Arabidopsis thaliana GN=CYP97C1 PE=1 SV=1 269 455 9.0E-12
sp|Q42798|C93A1_SOYBN 3,9-dihydroxypterocarpan 6A-monooxygenase OS=Glycine max GN=CYP93A1 PE=1 SV=1 214 420 1.0E-11
sp|O88833|CP4AA_MOUSE Cytochrome P450 4A10 OS=Mus musculus GN=Cyp4a10 PE=2 SV=2 249 439 1.0E-11
sp|P14579|CP4A5_RABIT Cytochrome P450 4A5 OS=Oryctolagus cuniculus GN=CYP4A5 PE=2 SV=1 249 439 1.0E-11
sp|P00189|CP11A_BOVIN Cholesterol side-chain cleavage enzyme, mitochondrial OS=Bos taurus GN=CYP11A1 PE=1 SV=1 255 461 1.0E-11
sp|D5JBW9|GAO_SAUCO Germacrene A oxidase OS=Saussurea costus PE=1 SV=1 211 421 1.0E-11
sp|E1B2Z9|C7AV8_CICIN Cytochrome P450 71AV8 OS=Cichorium intybus GN=CYP71AV8 PE=2 SV=1 211 421 1.0E-11
sp|O64637|C76C2_ARATH Cytochrome P450 76C2 OS=Arabidopsis thaliana GN=CYP76C2 PE=2 SV=1 259 438 1.0E-11
sp|P24464|CP4AC_RAT Cytochrome P450 4A12 OS=Rattus norvegicus GN=Cyp4a12 PE=2 SV=2 249 445 1.0E-11
sp|Q9DBG1|CP27A_MOUSE Sterol 26-hydroxylase, mitochondrial OS=Mus musculus GN=Cyp27a1 PE=1 SV=1 259 441 1.0E-11
sp|P16141|CP52D_CANMA Cytochrome P450 52A4 OS=Candida maltosa GN=CYP52A4 PE=1 SV=4 258 425 1.0E-11
sp|Q9XHC6|C93E1_SOYBN Beta-amyrin 24-hydroxylase OS=Glycine max GN=CYP93E1 PE=1 SV=1 249 438 2.0E-11
sp|P24465|C71A1_PERAE Cytochrome P450 71A1 OS=Persea americana GN=CYP71A1 PE=1 SV=2 260 441 2.0E-11
sp|P37123|C77A1_SOLME Cytochrome P450 77A1 (Fragment) OS=Solanum melongena GN=CYP77A1 PE=2 SV=1 2 438 2.0E-11
sp|Q9V419|C28A5_DROME Probable cytochrome P450 28a5 OS=Drosophila melanogaster GN=Cyp28a5 PE=2 SV=1 262 444 2.0E-11
sp|O15528|CP27B_HUMAN 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Homo sapiens GN=CYP27B1 PE=1 SV=1 260 440 2.0E-11
sp|Q9V674|CP6G1_DROME Cytochrome P450 6g1 OS=Drosophila melanogaster GN=Cyp6g1 PE=2 SV=1 262 433 2.0E-11
sp|Q9V773|C6A20_DROME Probable cytochrome P450 6a20 OS=Drosophila melanogaster GN=Cyp6a20 PE=2 SV=2 247 441 2.0E-11
sp|P11715|CP17A_RAT Steroid 17-alpha-hydroxylase/17,20 lyase OS=Rattus norvegicus GN=Cyp17a1 PE=1 SV=2 262 443 2.0E-11
sp|Q9VMT5|C28D1_DROME Probable cytochrome P450 28d1 OS=Drosophila melanogaster GN=Cyp28d1 PE=2 SV=1 1 441 2.0E-11
sp|P33267|CP2F2_MOUSE Cytochrome P450 2F2 OS=Mus musculus GN=Cyp2f2 PE=1 SV=1 8 457 2.0E-11
sp|P98188|C94A2_VICSA Cytochrome P450 94A2 OS=Vicia sativa GN=CYP94A2 PE=2 SV=1 250 439 2.0E-11
sp|Q59990|CP120_SYNY3 Putative cytochrome P450 120 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cyp120 PE=1 SV=1 269 458 2.0E-11
sp|Q9SAB6|C71AI_ARATH Cytochrome P450 71A18 OS=Arabidopsis thaliana GN=CYP71A18 PE=2 SV=2 241 438 2.0E-11
sp|Q9QZ82|CP11A_MOUSE Cholesterol side-chain cleavage enzyme, mitochondrial OS=Mus musculus GN=Cyp11a1 PE=1 SV=1 252 463 3.0E-11
sp|P33261|CP2CJ_HUMAN Cytochrome P450 2C19 OS=Homo sapiens GN=CYP2C19 PE=1 SV=3 42 445 3.0E-11
sp|Q6WKY9|C7D95_MENGR Cytochrome P450 71D95 OS=Mentha gracilis GN=CYP71D95 PE=1 SV=1 217 438 3.0E-11
sp|P14580|CP4A6_RABIT Cytochrome P450 4A6 OS=Oryctolagus cuniculus GN=CYP4A6 PE=1 SV=1 249 439 3.0E-11
sp|Q2XV99|CP11A_MACFA Cholesterol side-chain cleavage enzyme, mitochondrial OS=Macaca fascicularis GN=CYP11A1 PE=2 SV=1 260 463 3.0E-11
sp|O49340|C71AC_ARATH Cytochrome P450 71A12 OS=Arabidopsis thaliana GN=CYP71A12 PE=2 SV=1 240 438 3.0E-11
sp|Q07217|CP11A_ONCMY Cholesterol side-chain cleavage enzyme, mitochondrial OS=Oncorhynchus mykiss GN=cyp11a1 PE=2 SV=1 260 440 3.0E-11
sp|P00182|CP2C3_RABIT Cytochrome P450 2C3 OS=Oryctolagus cuniculus GN=CYP2C3 PE=1 SV=2 8 445 3.0E-11
sp|P58046|C71AF_ARATH Cytochrome P450 71A15 OS=Arabidopsis thaliana GN=CYP71A15 PE=3 SV=1 211 438 3.0E-11
sp|Q9FMY1|C86B1_ARATH Cytochrome P450 86B1 OS=Arabidopsis thaliana GN=CYP86B1 PE=2 SV=1 248 452 3.0E-11
sp|Q6YV88|C71Z7_ORYSJ Ent-cassadiene C2-hydroxylase OS=Oryza sativa subsp. japonica GN=CYP71Z7 PE=1 SV=1 248 438 3.0E-11
sp|O64635|C76C4_ARATH Cytochrome P450 76C4 OS=Arabidopsis thaliana GN=CYP76C4 PE=3 SV=1 160 438 3.0E-11
sp|D5JBW8|GAO_CICIN Germacrene A oxidase OS=Cichorium intybus PE=1 SV=1 253 421 4.0E-11
sp|Q27517|C13A3_CAEEL Putative cytochrome P450 CYP13A3 OS=Caenorhabditis elegans GN=cyp-13A3 PE=3 SV=1 100 440 4.0E-11
sp|P56656|CP239_MOUSE Cytochrome P450 2C39 OS=Mus musculus GN=Cyp2c39 PE=1 SV=2 42 445 4.0E-11
sp|Q27594|CP6A9_DROME Cytochrome P450 6a9 OS=Drosophila melanogaster GN=Cyp6a9 PE=2 SV=3 94 447 4.0E-11
sp|Q6EIG3|CP26B_DANRE Cytochrome P450 26B1 OS=Danio rerio GN=cyp26b1 PE=1 SV=1 285 433 4.0E-11
sp|Q6IV13|C7D95_MENSP Cytochrome P450 71D95 OS=Mentha spicata GN=CYP71D95 PE=1 SV=1 217 438 4.0E-11
sp|Q1ZXL2|C518B_DICDI Probable cytochrome P450 518B1 OS=Dictyostelium discoideum GN=cyp518B1 PE=3 SV=1 226 459 5.0E-11
sp|P33260|CP2CI_HUMAN Cytochrome P450 2C18 OS=Homo sapiens GN=CYP2C18 PE=1 SV=3 42 440 5.0E-11
sp|P33264|CP2CR_MESAU Cytochrome P450 2C27 OS=Mesocricetus auratus GN=CYP2C27 PE=2 SV=1 42 445 5.0E-11
sp|H2DH17|C7A22_PANGI Cytochrome P450 CYP749A22 OS=Panax ginseng PE=2 SV=1 41 433 5.0E-11
sp|P00179|CP2C5_RABIT Cytochrome P450 2C5 OS=Oryctolagus cuniculus GN=CYP2C5 PE=1 SV=2 42 463 5.0E-11
sp|Q9VMT6|C28D2_DROME Probable cytochrome P450 28d2 OS=Drosophila melanogaster GN=Cyp28d2 PE=3 SV=1 259 451 5.0E-11
sp|Q9LIP3|C71BY_ARATH Cytochrome P450 71B37 OS=Arabidopsis thaliana GN=CYP71B37 PE=3 SV=2 220 448 5.0E-11
sp|P47195|C80A1_BERST Berbamunine synthase OS=Berberis stolonifera GN=CYP80A1 PE=1 SV=1 260 443 5.0E-11
sp|Q9FG65|C81D1_ARATH Cytochrome P450 81D1 OS=Arabidopsis thaliana GN=CYP81D1 PE=2 SV=1 273 468 6.0E-11
sp|P15123|CP2CG_RABIT Cytochrome P450 2C16 OS=Oryctolagus cuniculus GN=CYP2C16 PE=2 SV=1 42 463 6.0E-11
sp|Q9LMX7|C78A5_ARATH Cytochrome P450 78A5 OS=Arabidopsis thaliana GN=CYP78A5 PE=2 SV=1 255 420 6.0E-11
sp|Q8N118|CP4X1_HUMAN Cytochrome P450 4X1 OS=Homo sapiens GN=CYP4X1 PE=2 SV=1 242 433 6.0E-11
sp|Q964T1|CP4CU_BLAGE Cytochrome P450 4c21 OS=Blattella germanica GN=CYP4C21 PE=2 SV=1 1 433 6.0E-11
sp|P30609|CP52G_CANTR Cytochrome P450 52A7 OS=Candida tropicalis GN=CYP52A7 PE=2 SV=1 273 438 6.0E-11
sp|P11712|CP2C9_HUMAN Cytochrome P450 2C9 OS=Homo sapiens GN=CYP2C9 PE=1 SV=3 5 445 6.0E-11
sp|P14137|CP11A_RAT Cholesterol side-chain cleavage enzyme, mitochondrial OS=Rattus norvegicus GN=Cyp11a1 PE=2 SV=1 252 463 6.0E-11
sp|Q96418|C75A5_EUSER Flavonoid 3',5'-hydroxylase OS=Eustoma exaltatum subsp. russellianum GN=CYP75A5 PE=2 SV=1 214 468 7.0E-11
sp|Q9V769|C6A22_DROME Cytochrome P450 6a22 OS=Drosophila melanogaster GN=Cyp6a22 PE=2 SV=1 275 448 7.0E-11
sp|P11714|CP2D9_MOUSE Cytochrome P450 2D9 OS=Mus musculus GN=Cyp2d9 PE=1 SV=2 240 443 7.0E-11
sp|P49602|CP51_USTMA Lanosterol 14-alpha demethylase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ERG11 PE=3 SV=1 269 433 7.0E-11
sp|Q6ZWL3|CP4V2_HUMAN Cytochrome P450 4V2 OS=Homo sapiens GN=CYP4V2 PE=1 SV=2 260 440 7.0E-11
sp|Q9LSF8|C82G1_ARATH Cytochrome P450 82G1 OS=Arabidopsis thaliana GN=CYP82G1 PE=1 SV=1 259 468 7.0E-11
sp|O44221|CP4E5_DROMT Cytochrome P450 4e5, mitochondrial OS=Drosophila mettleri GN=Cyp4e5 PE=2 SV=1 260 439 8.0E-11
sp|Q69F95|C85A_PHAVU Cytochrome P450 85A OS=Phaseolus vulgaris GN=BA13 PE=3 SV=2 273 430 8.0E-11
sp|P0DKI7|STORR_PAPSO Bifunctional protein STORR OS=Papaver somniferum GN=STORR PE=1 SV=1 273 440 8.0E-11
sp|O18596|C4D10_DROMT Cytochrome P450 4d10 OS=Drosophila mettleri GN=Cyp4d10 PE=1 SV=1 240 470 8.0E-11
sp|D5JBX0|GAO_HELAN Germacrene A oxidase OS=Helianthus annuus PE=1 SV=1 211 421 9.0E-11
sp|Q6XQ14|C71E7_MANES 2-methylbutanal oxime monooxygenase OS=Manihot esculenta GN=CYP71E7 PE=1 SV=1 217 449 9.0E-11
sp|P33263|CP2CQ_MESAU Cytochrome P450 2C26 OS=Mesocricetus auratus GN=CYP2C26 PE=2 SV=1 42 445 9.0E-11
sp|P48421|C83A1_ARATH Cytochrome P450 83A1 OS=Arabidopsis thaliana GN=CYP83A1 PE=1 SV=2 254 417 9.0E-11
sp|Q9W011|C4D20_DROME Probable cytochrome P450 4d20 OS=Drosophila melanogaster GN=Cyp4d20 PE=3 SV=1 261 433 1.0E-10
sp|Q9NR63|CP26B_HUMAN Cytochrome P450 26B1 OS=Homo sapiens GN=CYP26B1 PE=1 SV=1 285 444 1.0E-10
sp|Q9LTM1|C71BM_ARATH Cytochrome P450 71B22 OS=Arabidopsis thaliana GN=CYP71B22 PE=2 SV=1 242 464 1.0E-10
sp|O04790|C75A7_EUSER Flavonoid 3',5'-hydroxylase OS=Eustoma exaltatum subsp. russellianum GN=CYP75A7 PE=2 SV=1 214 468 1.0E-10
sp|Q9VL92|CP4E3_DROME Cytochrome P450 4e3 OS=Drosophila melanogaster GN=Cyp4e3 PE=2 SV=1 256 439 1.0E-10
sp|Q9V9L1|CP6W1_DROME Probable cytochrome P450 6w1 OS=Drosophila melanogaster GN=Cyp6w1 PE=2 SV=1 262 427 1.0E-10
sp|Q43250|C71C1_MAIZE 3-hydroxyindolin-2-one monooxygenase OS=Zea mays GN=CYP71C1 PE=1 SV=1 253 441 1.0E-10
sp|P58048|C71B8_ARATH Cytochrome P450 71B8 OS=Arabidopsis thaliana GN=CYP71B8 PE=3 SV=1 252 438 1.0E-10
sp|Q9STL2|C71AL_ARATH Cytochrome P450 71A21 OS=Arabidopsis thaliana GN=CYP71A21 PE=2 SV=1 213 438 1.0E-10
sp|P17666|CP2CE_RABIT Cytochrome P450 2C14 OS=Oryctolagus cuniculus GN=CYP2C14 PE=2 SV=1 5 445 1.0E-10
sp|Q9LNJ4|C70A2_ARATH Cytochrome P450 703A2 OS=Arabidopsis thaliana GN=CYP703A2 PE=2 SV=1 43 434 1.0E-10
sp|Q5RCN6|CP4V2_PONAB Cytochrome P450 4V2 OS=Pongo abelii GN=CYP4V2 PE=2 SV=1 260 440 2.0E-10
sp|Q811W2|CP26B_MOUSE Cytochrome P450 26B1 OS=Mus musculus GN=Cyp26b1 PE=1 SV=1 285 444 2.0E-10
sp|P17178|CP27A_RAT Sterol 26-hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp27a1 PE=1 SV=1 268 439 2.0E-10
sp|P27786|CP17A_MOUSE Steroid 17-alpha-hydroxylase/17,20 lyase OS=Mus musculus GN=Cyp17a1 PE=1 SV=1 262 443 2.0E-10
sp|Q9V4T5|CP4E1_DROME Probable cytochrome P450 4e1 OS=Drosophila melanogaster GN=Cyp4e1 PE=2 SV=1 259 439 2.0E-10
sp|D5J9U8|GAO_LACSA Germacrene A oxidase OS=Lactuca sativa GN=GAO1 PE=1 SV=1 253 421 2.0E-10
sp|Q9SLP1|C78A9_ARATH Cytochrome P450 78A9 OS=Arabidopsis thaliana GN=CYP78A9 PE=2 SV=1 261 438 2.0E-10
sp|P33270|CP6A2_DROME Cytochrome P450 6a2 OS=Drosophila melanogaster GN=Cyp6a2 PE=2 SV=2 261 443 2.0E-10
sp|Q8VWZ7|C76B6_CATRO Geraniol 8-hydroxylase OS=Catharanthus roseus GN=CYP76B6 PE=1 SV=1 215 438 2.0E-10
sp|Q64410|CP17A_CAVPO Steroid 17-alpha-hydroxylase/17,20 lyase OS=Cavia porcellus GN=CYP17A1 PE=1 SV=1 262 441 3.0E-10
sp|Q964Q7|CP6D3_MUSDO Cytochrome P450 6d3 OS=Musca domestica GN=CYP6D3 PE=2 SV=1 42 440 3.0E-10
sp|Q02318|CP27A_HUMAN Sterol 26-hydroxylase, mitochondrial OS=Homo sapiens GN=CYP27A1 PE=1 SV=1 261 439 3.0E-10
sp|Q8GSQ1|C85A1_ORYSJ Cytochrome P450 85A1 OS=Oryza sativa subsp. japonica GN=CYP85A1 PE=1 SV=1 240 452 3.0E-10
sp|P56654|CP237_MOUSE Cytochrome P450 2C37 OS=Mus musculus GN=Cyp2c37 PE=1 SV=2 42 445 4.0E-10
sp|P14779|CPXB_BACME Bifunctional cytochrome P450/NADPH--P450 reductase OS=Bacillus megaterium GN=cyp102A1 PE=1 SV=2 260 440 4.0E-10
sp|P82712|CCD1P_DROME Probable cytochrome P450 12d1 proximal, mitochondrial OS=Drosophila melanogaster GN=Cyp12d1-p PE=2 SV=3 81 441 4.0E-10
sp|G3V7X8|CP26B_RAT Cytochrome P450 26B1 OS=Rattus norvegicus GN=Cyp26b1 PE=2 SV=1 285 444 4.0E-10
sp|O48956|C98A1_SORBI Cytochrome P450 98A1 OS=Sorghum bicolor GN=CYP98A1 PE=2 SV=1 269 430 4.0E-10
sp|Q9LIP5|C71BW_ARATH Cytochrome P450 71B35 OS=Arabidopsis thaliana GN=CYP71B35 PE=2 SV=1 220 438 4.0E-10
sp|Q9VYY4|C4G15_DROME Cytochrome P450 4g15 OS=Drosophila melanogaster GN=Cyp4g15 PE=2 SV=1 261 433 5.0E-10
sp|P56655|CP238_MOUSE Cytochrome P450 2C38 OS=Mus musculus GN=Cyp2c38 PE=2 SV=2 42 445 5.0E-10
sp|Q9V5L3|C49A1_DROME Probable cytochrome P450 49a1 OS=Drosophila melanogaster GN=Cyp49a1 PE=2 SV=3 266 463 5.0E-10
sp|Q9AXH9|KAO1_HORVU Ent-kaurenoic acid oxidase 1 OS=Hordeum vulgare GN=KAO1 PE=1 SV=1 243 430 5.0E-10
sp|Q7KR10|CCD1D_DROME Probable cytochrome P450 12d1 distal, mitochondrial OS=Drosophila melanogaster GN=Cyp12d1-d PE=2 SV=1 81 441 5.0E-10
sp|O35293|CP2F2_RAT Cytochrome P450 2F2 OS=Rattus norvegicus GN=Cyp2f2 PE=2 SV=1 8 450 5.0E-10
sp|P51590|CP2J3_RAT Cytochrome P450 2J3 OS=Rattus norvegicus GN=Cyp2j3 PE=2 SV=1 240 467 5.0E-10
sp|Q6GUQ4|CP2E1_MACMU Cytochrome P450 2E1 OS=Macaca mulatta GN=CYP2E1 PE=2 SV=1 224 445 5.0E-10
sp|D1MI46|C76BA_SWEMU Geraniol 8-hydroxylase OS=Swertia mussotii GN=CYP76B10 PE=1 SV=1 241 438 6.0E-10
sp|Q92113|CP17A_SQUAC Steroid 17-alpha-hydroxylase/17,20 lyase OS=Squalus acanthias GN=CYP17A1 PE=2 SV=1 260 457 6.0E-10
sp|F8S1I0|C7BL2_LACSA Costunolide synthase OS=Lactuca sativa GN=CYP71BL2 PE=1 SV=1 262 421 6.0E-10
sp|P30437|CP17A_ONCMY Steroid 17-alpha-hydroxylase/17,20 lyase OS=Oncorhynchus mykiss GN=cyp17a1 PE=2 SV=1 269 457 6.0E-10
sp|O23976|C76B1_HELTU 7-ethoxycoumarin O-deethylase OS=Helianthus tuberosus GN=CYP76B1 PE=1 SV=1 204 441 6.0E-10
sp|Q08078|CP2CP_MESAU Cytochrome P450 2C25 OS=Mesocricetus auratus GN=CYP2C25 PE=2 SV=1 42 445 6.0E-10
sp|Q82IY3|PTLI_STRAW Pentalenene oxygenase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ptlI PE=1 SV=1 43 441 6.0E-10
sp|P70085|CP17A_ORYLA Steroid 17-alpha-hydroxylase/17,20 lyase OS=Oryzias latipes GN=cyp17a1 PE=2 SV=1 269 457 6.0E-10
sp|Q9VRI9|CP6T1_DROME Probable cytochrome P450 6t1 OS=Drosophila melanogaster GN=Cyp6t1 PE=2 SV=1 273 448 7.0E-10
sp|Q00714|STCS_EMENI Probable sterigmatocystin biosynthesis P450 monooxygenase stcS OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcS PE=1 SV=2 243 439 7.0E-10
sp|E1BHJ4|CP26B_BOVIN Cytochrome P450 26B1 OS=Bos taurus GN=CYP26B1 PE=3 SV=1 285 444 7.0E-10
sp|P11711|CP2A1_RAT Cytochrome P450 2A1 OS=Rattus norvegicus GN=Cyp2a1 PE=1 SV=2 8 433 7.0E-10
sp|Q9V776|CP317_DROME Probable cytochrome P450 317a1 OS=Drosophila melanogaster GN=Cyp317a1 PE=3 SV=2 245 457 7.0E-10
sp|P00181|CP2C2_RABIT Cytochrome P450 2C2 OS=Oryctolagus cuniculus GN=CYP2C2 PE=1 SV=2 42 445 8.0E-10
sp|Q9EPT4|CP11A_MESAU Cholesterol side-chain cleavage enzyme, mitochondrial OS=Mesocricetus auratus GN=CYP11A1 PE=2 SV=1 252 463 8.0E-10
sp|Q4G0S4|C27C1_HUMAN Cytochrome P450 27C1 OS=Homo sapiens GN=CYP27C1 PE=2 SV=2 260 440 8.0E-10
sp|P30611|CP52N_CANTR Cytochrome P450 52B1 OS=Candida tropicalis GN=CYP52B1 PE=2 SV=1 255 433 8.0E-10
sp|O48927|C78A3_SOYBN Cytochrome P450 78A3 OS=Glycine max GN=CYP78A3 PE=2 SV=1 261 421 8.0E-10
sp|P70687|CP17A_MESAU Steroid 17-alpha-hydroxylase/17,20 lyase OS=Mesocricetus auratus GN=CYP17A1 PE=2 SV=1 262 443 8.0E-10
sp|L7X3S1|MSH_PAPSO Methyltetrahydroprotoberberine 14-monooxygenase OS=Papaver somniferum GN=CYP82N4 PE=1 SV=1 273 443 9.0E-10
sp|O13317|TRI11_FUSSP Isotrichodermin C-15 hydroxylase OS=Fusarium sporotrichioides GN=TRI11 PE=3 SV=1 260 441 9.0E-10
sp|O81117|C94A1_VICSA Cytochrome P450 94A1 OS=Vicia sativa GN=CYP94A1 PE=2 SV=2 250 439 9.0E-10
sp|Q12585|CP52T_CANMA Cytochrome P450 52D1 OS=Candida maltosa GN=CYP52D1 PE=2 SV=1 265 433 1.0E-09
sp|P37122|C76A2_SOLME Cytochrome P450 76A2 OS=Solanum melongena GN=CYP76A2 PE=2 SV=1 218 416 1.0E-09
sp|Q43147|C85A1_SOLLC Cytochrome P450 85A1 OS=Solanum lycopersicum GN=CYP85A1 PE=2 SV=1 269 430 1.0E-09
sp|P85191|CP450_HELAN Cytochrome P450 (Fragment) OS=Helianthus annuus PE=1 SV=1 315 443 1.0E-09
sp|Q9V559|CP4P3_DROME Probable cytochrome P450 4p3 OS=Drosophila melanogaster GN=Cyp4p3 PE=2 SV=3 262 439 1.0E-09
sp|P05181|CP2E1_HUMAN Cytochrome P450 2E1 OS=Homo sapiens GN=CYP2E1 PE=1 SV=1 225 445 1.0E-09
sp|P9WPM1|CP139_MYCTU Putative cytochrome P450 139 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp139 PE=1 SV=1 269 441 1.0E-09
sp|P9WPM0|CP139_MYCTO Putative cytochrome P450 139 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp139 PE=3 SV=1 269 441 1.0E-09
sp|P63720|CP139_MYCBO Putative cytochrome P450 139 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp139 PE=3 SV=1 269 441 1.0E-09
sp|O35084|CP27B_MOUSE 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Mus musculus GN=Cyp27b1 PE=2 SV=2 255 439 1.0E-09
sp|Q27593|CP6A8_DROME Cytochrome P450 6a8 OS=Drosophila melanogaster GN=Cyp6a8 PE=2 SV=2 42 433 1.0E-09
sp|P51581|CP2E1_MESAU Cytochrome P450 2E1 OS=Mesocricetus auratus GN=CYP2E1 PE=2 SV=1 240 445 1.0E-09
sp|Q69X58|C76M7_ORYSJ Ent-cassadiene C11-alpha-hydroxylase 1 OS=Oryza sativa subsp. japonica GN=CYP76M7 PE=1 SV=1 214 418 1.0E-09
sp|Q92045|CP11A_DASAM Cholesterol side-chain cleavage enzyme, mitochondrial (Fragment) OS=Dasyatis americana GN=CYP11A1 PE=2 SV=1 257 462 1.0E-09
sp|Q9C5Y2|KAO2_ARATH Ent-kaurenoic acid oxidase 2 OS=Arabidopsis thaliana GN=KAO2 PE=2 SV=2 270 468 1.0E-09
sp|P12394|CP17A_CHICK Steroid 17-alpha-hydroxylase/17,20 lyase OS=Gallus gallus GN=CYP17A1 PE=2 SV=1 240 456 1.0E-09
sp|I3V6B1|C80BX_PAPSO (S)-N-methylcoclaurine 3'-hydroxylase-like protein OS=Papaver somniferum GN=CYP80BX PE=2 SV=1 269 417 2.0E-09
sp|H2DH19|C7D31_PANGI Cytochrome P450 CYP71D312 OS=Panax ginseng PE=2 SV=1 238 423 2.0E-09
sp|Q9CX98|CP2U1_MOUSE Cytochrome P450 2U1 OS=Mus musculus GN=Cyp2u1 PE=2 SV=2 201 457 2.0E-09
sp|Q64458|CP2CT_MOUSE Cytochrome P450 2C29 OS=Mus musculus GN=Cyp2c29 PE=1 SV=2 42 445 2.0E-09
sp|O65787|C71B6_ARATH Cytochrome P450 71B6 OS=Arabidopsis thaliana GN=CYP71B6 PE=2 SV=1 240 452 2.0E-09
sp|Q0DBF4|C7018_ORYSJ Ent-sandaracopimaradiene 3-hydroxylase OS=Oryza sativa subsp. japonica GN=CYP701A8 PE=1 SV=1 2 419 2.0E-09
sp|Q9LHA1|C8D11_ARATH Cytochrome P450 81D11 OS=Arabidopsis thaliana GN=CYP81D11 PE=2 SV=1 255 470 2.0E-09
sp|P33266|CP2E1_MACFA Cytochrome P450 2E1 (Fragment) OS=Macaca fascicularis GN=CYP2E1 PE=2 SV=1 225 445 2.0E-09
sp|Q91Z85|CP17A_PERLE Steroid 17-alpha-hydroxylase/17,20 lyase OS=Peromyscus leucopus GN=Cyp17a1 PE=3 SV=1 262 443 2.0E-09
sp|P33273|CP255_RAT Cytochrome P450 2C55 OS=Rattus norvegicus GN=Cyp2c55 PE=2 SV=2 42 464 3.0E-09
sp|P48422|C86A1_ARATH Cytochrome P450 86A1 OS=Arabidopsis thaliana GN=CYP86A1 PE=1 SV=2 273 429 3.0E-09
sp|G3GBK0|C7BL3_CICIN Costunolide synthase OS=Cichorium intybus GN=CYP71BL3 PE=1 SV=1 262 421 3.0E-09
sp|O22307|C71DB_LOTJA Cytochrome P450 71D11 (Fragment) OS=Lotus japonicus GN=CYP71D11 PE=2 SV=1 238 438 3.0E-09
sp|Q9V3S0|CP4G1_DROME Cytochrome P450 4g1 OS=Drosophila melanogaster GN=Cyp4g1 PE=2 SV=1 261 433 3.0E-09
sp|P24470|CP2CN_RAT Cytochrome P450 2C23 OS=Rattus norvegicus GN=Cyp2c23 PE=2 SV=2 8 445 3.0E-09
sp|Q9VG40|CP134_DROME Probable cytochrome P450 313a4 OS=Drosophila melanogaster GN=Cyp313a4 PE=2 SV=4 258 433 3.0E-09
sp|Q55EK2|C524A_DICDI Probable cytochrome P450 524A1 OS=Dictyostelium discoideum GN=cyp524A1 PE=3 SV=1 281 433 3.0E-09
sp|P58050|C71BD_ARATH Cytochrome P450 71B13 OS=Arabidopsis thaliana GN=CYP71B13 PE=2 SV=1 240 464 4.0E-09
sp|Q6WNQ8|C81E8_MEDTR Cytochrome P450 81E8 OS=Medicago truncatula GN=CYP81E8 PE=2 SV=1 269 417 4.0E-09
sp|Q9ZV28|C7104_ARATH Cytochrome P450 710A1 OS=Arabidopsis thaliana GN=CYP710A4 PE=2 SV=1 273 440 4.0E-09
sp|O57525|CP17A_RANDY Steroid 17-alpha-hydroxylase/17,20 lyase OS=Rana dybowskii GN=CYP17A1 PE=2 SV=1 211 470 4.0E-09
sp|Q9LIP6|C71BV_ARATH Cytochrome P450 71B34 OS=Arabidopsis thaliana GN=CYP71B34 PE=2 SV=1 240 438 5.0E-09
sp|Q43255|C71C2_MAIZE indolin-2-one monooxygenase OS=Zea mays GN=CYP71C2 PE=1 SV=1 259 441 5.0E-09
sp|Q9VE00|C12A4_DROME Probable cytochrome P450 12a4, mitochondrial OS=Drosophila melanogaster GN=Cyp12a4 PE=2 SV=2 277 463 5.0E-09
sp|Q5Z5S6|C7019_ORYSJ Ent-kaurene oxidase-like 5 OS=Oryza sativa subsp. japonica GN=CYP701A9 PE=2 SV=1 283 419 5.0E-09
sp|O35132|CP27B_RAT 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp27b1 PE=2 SV=2 255 439 5.0E-09
sp|P51589|CP2J2_HUMAN Cytochrome P450 2J2 OS=Homo sapiens GN=CYP2J2 PE=1 SV=2 240 467 6.0E-09
sp|Q0IIF9|CP2U1_BOVIN Cytochrome P450 2U1 OS=Bos taurus GN=CYP2U1 PE=2 SV=1 240 468 6.0E-09
sp|C0SJS2|C71AJ_PASSA Psoralen synthase (Fragment) OS=Pastinaca sativa GN=CYP71AJ3 PE=1 SV=1 242 449 6.0E-09
sp|O75881|CP7B1_HUMAN 25-hydroxycholesterol 7-alpha-hydroxylase OS=Homo sapiens GN=CYP7B1 PE=1 SV=2 281 443 6.0E-09
sp|O23051|KAO1_ARATH Ent-kaurenoic acid oxidase 1 OS=Arabidopsis thaliana GN=KAO1 PE=2 SV=1 240 468 7.0E-09
sp|Q9SD85|F3PH_ARATH Flavonoid 3'-monooxygenase OS=Arabidopsis thaliana GN=CYP75B1 PE=1 SV=1 241 461 7.0E-09
sp|O48923|C71DA_SOYBN Cytochrome P450 71D10 OS=Glycine max GN=CYP71D10 PE=2 SV=1 261 438 7.0E-09
sp|Q9LTM2|C71BL_ARATH Cytochrome P450 71B21 OS=Arabidopsis thaliana GN=CYP71B21 PE=3 SV=1 242 420 7.0E-09
sp|O18963|CP2E1_BOVIN Cytochrome P450 2E1 OS=Bos taurus GN=CYP2E1 PE=2 SV=1 231 445 7.0E-09
sp|Q7Z449|CP2U1_HUMAN Cytochrome P450 2U1 OS=Homo sapiens GN=CYP2U1 PE=1 SV=1 244 457 7.0E-09
sp|Q43068|C82A1_PEA Cytochrome P450 82A1 (Fragment) OS=Pisum sativum GN=CYP82A1 PE=2 SV=2 262 416 8.0E-09
sp|P08686|CP21A_HUMAN Steroid 21-hydroxylase OS=Homo sapiens GN=CYP21A2 PE=1 SV=1 240 434 8.0E-09
sp|O65782|C83B1_ARATH Cytochrome P450 83B1 OS=Arabidopsis thaliana GN=CYP83B1 PE=1 SV=1 214 438 9.0E-09
sp|Q9D816|CP255_MOUSE Cytochrome P450 2C55 OS=Mus musculus GN=Cyp2c55 PE=1 SV=1 219 442 9.0E-09
sp|Q6UEG2|AFLN_ASPPA P450 monooxygenase AflN OS=Aspergillus parasiticus GN=aflN PE=3 SV=1 239 439 9.0E-09
sp|O55127|CP26A_MOUSE Cytochrome P450 26A1 OS=Mus musculus GN=Cyp26a1 PE=2 SV=1 268 445 1.0E-08
sp|P93147|C81E1_GLYEC Isoflavone 2'-hydroxylase OS=Glycyrrhiza echinata GN=CYP81E1 PE=1 SV=2 262 468 1.0E-08
sp|P08682|CP2E1_RABIT Cytochrome P450 2E1 OS=Oryctolagus cuniculus GN=CYP2E1 PE=2 SV=2 240 445 1.0E-08
sp|Q9VLZ7|C4D21_DROME Probable cytochrome P450 4d21 OS=Drosophila melanogaster GN=Cyp4d21 PE=3 SV=1 240 433 1.0E-08
sp|P79383|CP2E1_PIG Cytochrome P450 2E1 OS=Sus scrofa GN=CYP2E1 PE=2 SV=1 229 445 1.0E-08
sp|Q948Y1|C719A_COPJA (S)-canadine synthase OS=Coptis japonica GN=CYP719A1 PE=1 SV=1 268 433 1.0E-08
sp|P15128|CP4B1_RABIT Cytochrome P450 4B1 OS=Oryctolagus cuniculus GN=CYP4B1 PE=1 SV=1 261 446 1.0E-08
sp|P11371|CP2C4_RABIT Cytochrome P450 2C4 OS=Oryctolagus cuniculus GN=CYP2C4 PE=2 SV=1 268 463 1.0E-08
sp|Q9SBQ9|F3PH_PETHY Flavonoid 3'-monooxygenase OS=Petunia hybrida GN=CYP75B2 PE=2 SV=1 221 433 1.0E-08
sp|P00180|CP2C1_RABIT Cytochrome P450 2C1 OS=Oryctolagus cuniculus GN=CYP2C1 PE=1 SV=2 5 437 1.0E-08
sp|Q9SP06|C80B3_PAPSO (S)-N-methylcoclaurine 3'-hydroxylase isozyme 1 (Fragment) OS=Papaver somniferum GN=CYP80B3 PE=1 SV=1 268 438 1.0E-08
sp|Q9GMC8|CP17A_FELCA Steroid 17-alpha-hydroxylase/17,20 lyase OS=Felis catus GN=CYP17A1 PE=2 SV=1 262 443 2.0E-08
sp|Q8WNE1|CP2F5_GORGO Cytochrome P450 2F5 OS=Gorilla gorilla gorilla GN=CYP2F5 PE=3 SV=2 240 445 2.0E-08
sp|O18809|CP2F3_CAPHI Cytochrome P450 2F3 OS=Capra hircus GN=CYP2F3 PE=2 SV=1 8 457 2.0E-08
sp|Q08D50|CP26B_XENTR Cytochrome P450 26B1 OS=Xenopus tropicalis GN=cyp26b1 PE=2 SV=1 285 446 2.0E-08
sp|P17177|CP27A_RABIT Sterol 26-hydroxylase, mitochondrial OS=Oryctolagus cuniculus GN=CYP27A1 PE=2 SV=1 268 439 2.0E-08
sp|O49396|C82C3_ARATH Cytochrome P450 82C3 OS=Arabidopsis thaliana GN=CYP82C3 PE=2 SV=3 273 468 2.0E-08
sp|Q9V7G5|C4AA1_DROME Probable cytochrome P450 4aa1 OS=Drosophila melanogaster GN=Cyp4aa1 PE=2 SV=2 249 433 2.0E-08
sp|Q27712|CP2L1_PANAR Cytochrome P450 2L1 OS=Panulirus argus GN=CYP2L1 PE=1 SV=1 2 437 2.0E-08
sp|B5UAQ8|C7195_ESCCA Cheilanthifoline synthase OS=Eschscholzia californica GN=CYP719A5 PE=1 SV=1 258 433 2.0E-08
sp|Q9VGZ0|C12E1_DROME Probable cytochrome P450 12e1, mitochondrial OS=Drosophila melanogaster GN=Cyp12e1 PE=2 SV=4 266 469 2.0E-08
sp|Q6V0L0|CP26C_HUMAN Cytochrome P450 26C1 OS=Homo sapiens GN=CYP26C1 PE=2 SV=2 214 426 2.0E-08
sp|Q92104|CP11B_LITCT Cytochrome P450 11B, mitochondrial OS=Lithobates catesbeiana GN=CYP11B PE=2 SV=1 262 460 2.0E-08
sp|F4JW83|C84A4_ARATH Cytochrome P450 84A4 OS=Arabidopsis thaliana GN=CYP84A4 PE=1 SV=1 273 417 2.0E-08
sp|Q12587|CP52Q_CANMA Cytochrome P450 52C2 OS=Candida maltosa GN=CYP52C2 PE=2 SV=1 259 425 2.0E-08
sp|P05093|CP17A_HUMAN Steroid 17-alpha-hydroxylase/17,20 lyase OS=Homo sapiens GN=CYP17A1 PE=1 SV=1 240 443 2.0E-08
sp|Q9V558|CP4P1_DROME Cytochrome P450 4p1 OS=Drosophila melanogaster GN=Cyp4p1 PE=2 SV=1 262 439 3.0E-08
sp|Q9V4T3|C4AD1_DROME Probable cytochrome P450 4ad1 OS=Drosophila melanogaster GN=Cyp4ad1 PE=2 SV=1 234 439 3.0E-08
sp|Q8LIF2|C7345_ORYSJ Cytochrome P450 734A5 OS=Oryza sativa subsp. japonica GN=CYP734A5 PE=2 SV=1 261 441 3.0E-08
sp|Q8HYN1|CP17A_PANTR Steroid 17-alpha-hydroxylase/17,20 lyase OS=Pan troglodytes GN=CYP17A1 PE=2 SV=1 240 443 3.0E-08
sp|P15539|C11B2_MOUSE Cytochrome P450 11B2, mitochondrial OS=Mus musculus GN=Cyp11b2 PE=2 SV=3 262 458 3.0E-08
sp|Q8CIM7|CP2DQ_MOUSE Cytochrome P450 2D26 OS=Mus musculus GN=Cyp2d26 PE=1 SV=1 240 443 3.0E-08
sp|O43174|CP26A_HUMAN Cytochrome P450 26A1 OS=Homo sapiens GN=CYP26A1 PE=2 SV=2 268 445 3.0E-08
sp|H2DH18|C7A12_PANGI Cytochrome P450 CYP736A12 OS=Panax ginseng PE=2 SV=1 213 438 3.0E-08
sp|Q4V8D1|CP2U1_RAT Cytochrome P450 2U1 OS=Rattus norvegicus GN=Cyp2u1 PE=1 SV=1 220 468 3.0E-08
sp|I3PFJ5|C76AD_BETVU Cytochrome P450 76AD1 OS=Beta vulgaris GN=CYP76AD1 PE=2 SV=1 269 417 3.0E-08
sp|Q759W0|CP51_ASHGO Lanosterol 14-alpha demethylase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ERG11 PE=3 SV=1 273 433 3.0E-08
sp|Q50LH3|C7192_ESCCA (S)-stylopine synthase 1 OS=Eschscholzia californica GN=CYP719A2 PE=1 SV=1 13 433 3.0E-08
sp|O64697|C7101_ARATH Cytochrome P450 710A1 OS=Arabidopsis thaliana GN=CYP710A1 PE=1 SV=1 269 442 4.0E-08
sp|B1NF18|C719B_PAPSO Salutaridine synthase OS=Papaver somniferum GN=CYP719B1 PE=1 SV=1 262 416 4.0E-08
sp|Q9LVD2|C71BA_ARATH Cytochrome P450 71B10 OS=Arabidopsis thaliana GN=CYP71B10 PE=3 SV=1 240 438 4.0E-08
sp|Q7X7X4|C99A2_ORYSJ Cytochrome P450 99A2 OS=Oryza sativa subsp. japonica GN=CYP99A2 PE=2 SV=2 252 438 4.0E-08
sp|P97720|C11B1_MESAU Cytochrome P450 11B1, mitochondrial OS=Mesocricetus auratus GN=CYP11B1 PE=2 SV=1 262 458 4.0E-08
sp|Q8HYM9|CP17A_MACMU Steroid 17-alpha-hydroxylase/17,20 lyase OS=Macaca mulatta GN=CYP17A1 PE=2 SV=1 262 443 4.0E-08
sp|Q2XVA1|CP17A_MACFA Steroid 17-alpha-hydroxylase/17,20 lyase OS=Macaca fascicularis GN=CYP17A1 PE=2 SV=1 262 443 4.0E-08
sp|Q8HYN0|CP17A_PAPCY Steroid 17-alpha-hydroxylase/17,20 lyase OS=Papio cynocephalus GN=CYP17A1 PE=2 SV=1 262 443 4.0E-08
sp|O46658|CP2DP_PIG Vitamin D(3) 25-hydroxylase OS=Sus scrofa GN=CYP2D25 PE=1 SV=3 229 441 4.0E-08
sp|Q9FMV7|C94B1_ARATH Cytochrome P450 94B1 OS=Arabidopsis thaliana GN=CYP94B1 PE=2 SV=1 273 439 4.0E-08
sp|P20814|CP2CD_RAT Cytochrome P450 2C13, male-specific OS=Rattus norvegicus GN=Cyp2c13 PE=1 SV=1 240 445 4.0E-08
sp|P54781|ERG5_YEAST Cytochrome P450 61 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG5 PE=1 SV=1 244 468 5.0E-08
sp|P15538|C11B1_HUMAN Cytochrome P450 11B1, mitochondrial OS=Homo sapiens GN=CYP11B1 PE=1 SV=5 262 459 5.0E-08
sp|P9WPM3|CP138_MYCTU Putative cytochrome P450 138 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp138 PE=1 SV=1 260 440 5.0E-08
sp|P9WPM2|CP138_MYCTO Putative cytochrome P450 138 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp138 PE=3 SV=1 260 440 5.0E-08
sp|P63718|CP138_MYCBO Putative cytochrome P450 138 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp138 PE=3 SV=1 260 440 5.0E-08
sp|Q9MZY0|CP2E1_CANLF Cytochrome P450 2E1 OS=Canis lupus familiaris GN=CYP2E1 PE=2 SV=1 240 445 5.0E-08
sp|Q9LTM3|C71BK_ARATH Cytochrome P450 71B20 OS=Arabidopsis thaliana GN=CYP71B20 PE=2 SV=1 240 443 6.0E-08
sp|Q50EK6|C72B1_PINTA Abietadienol/abietadienal oxidase OS=Pinus taeda GN=CYP720B1 PE=1 SV=1 269 442 6.0E-08
sp|P05185|CP17A_BOVIN Steroid 17-alpha-hydroxylase/17,20 lyase OS=Bos taurus GN=CYP17A1 PE=2 SV=1 262 443 6.0E-08
sp|O18992|CP2DJ_CALJA Cytochrome P450 2D19 OS=Callithrix jacchus GN=CYP2D19 PE=2 SV=1 243 441 6.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0004497 monooxygenase activity Yes
GO:0020037 heme binding Yes
GO:0005506 iron ion binding Yes
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Yes
GO:0003824 catalytic activity No
GO:0046872 metal ion binding No
GO:0046906 tetrapyrrole binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0016491 oxidoreductase activity No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0046914 transition metal ion binding No
GO:0043169 cation binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|377
MPQVPGHPLLGILPQMCNQGLYDATLTQMHHAAANHGASCSWIGTSPVLLLRHPEMIRQLLIDNASRTTRLDDDG
NGPFAILARVTGLTAATANGRNWSRWRRGFLRTFASPAALRASHHAMVRIAQRHVAAMKHPPQPHNLYHAMEAFA
LDSVWHLGLGLDDASHHLPHIRVVMARYGRLVGNPSHLWRHLVRCLCSGKPVTEPDHVELSVGNHFDQVLGRILH
QNIDLLRPGNPLGKDSLLQTTSQESGGSFQKPFTHDVMAQARQLLSLGHEASALLLLWAVYELSQQPQVVSRLRQ
EMSHYGYHATTPDFNTLRAMPYLDAVVAEILRLHPPISTTARLATHDLVLQTRNRDDVLIPRGTLLFASIHLLHH
DQQVWGPTASDFVPERWSGILANKLENQCHHLPFLAGSRACPSSAFVVLQLKTMLTTLFAQLDIEILDRPLIEKQ
VGGVVRPSVPVSFLAHKRSL*
Coding >OphauB2|377
ATGCCCCAGGTGCCCGGCCACCCGCTGCTCGGCATCCTCCCCCAAATGTGTAACCAGGGCCTCTACGACGCAACC
CTGACCCAGATGCACCATGCCGCCGCCAACCATGGCGCTTCCTGCTCCTGGATTGGCACCAGCCCCGTCCTCCTG
CTCCGCCATCCGGAAATGATACGCCAGCTGCTTATAGATAACGCCTCTCGCACCACGCGCCTCGATGACGACGGC
AACGGGCCCTTTGCAATTCTCGCCCGCGTCACCGGCCTCACTGCCGCCACCGCCAATGGCAGAAACTGGAGCCGC
TGGCGACGAGGCTTCCTCCGCACCTTTGCCAGCCCCGCTGCCCTCAGGGCCTCGCATCACGCCATGGTCCGTATT
GCCCAGAGACACGTTGCCGCCATGAAACATCCGCCTCAGCCTCACAATCTCTACCACGCCATGGAAGCTTTTGCC
CTCGACTCCGTCTGGCACCTTGGTCTCGGCCTCGACGACGCCTCCCACCACTTGCCCCATATCCGCGTCGTCATG
GCTCGATATGGCCGTCTAGTCGGCAACCCTTCCCATCTCTGGCGCCACCTTGTCCGCTGCCTGTGCTCGGGAAAA
CCAGTCACTGAACCCGATCACGTCGAGTTGAGCGTTGGCAACCACTTTGACCAAGTCCTGGGTCGCATTCTCCAT
CAAAACATCGACTTGCTGAGGCCGGGAAACCCACTGGGCAAAGACAGCCTCTTGCAAACAACCTCGCAAGAGTCG
GGCGGCTCTTTTCAAAAGCCCTTTACCCACGACGTCATGGCCCAGGCGCGTCAGCTCCTCTCCCTCGGCCACGAG
GCTTCAGCCCTGCTCCTCCTATGGGCCGTCTACGAGCTCAGCCAACAGCCCCAAGTCGTCAGCCGGCTCAGACAG
GAAATGAGCCACTACGGCTACCACGCCACCACACCAGACTTCAACACCCTTCGAGCCATGCCCTACTTGGACGCA
GTAGTGGCGGAAATCCTTCGCCTTCACCCCCCCATTTCAACCACGGCCCGTCTGGCAACACATGACTTGGTTCTG
CAAACACGCAATCGAGATGATGTCTTGATTCCCCGCGGCACCCTGCTGTTTGCGTCCATCCATCTCTTGCATCAC
GACCAACAGGTCTGGGGCCCAACAGCCTCAGACTTTGTCCCAGAGCGATGGAGTGGCATTTTAGCAAACAAGCTG
GAAAACCAGTGCCACCATCTCCCCTTTCTAGCAGGATCGAGAGCCTGTCCCAGCTCCGCCTTTGTCGTACTGCAG
CTAAAGACGATGCTCACCACTCTCTTCGCCCAGCTTGATATTGAAATCCTGGACAGGCCACTGATTGAGAAGCAG
GTCGGAGGCGTCGTCAGGCCGTCGGTGCCCGTGTCTTTTTTGGCCCACAAGAGGTCTCTGTAA
Transcript >OphauB2|377
ATGCCCCAGGTGCCCGGCCACCCGCTGCTCGGCATCCTCCCCCAAATGTGTAACCAGGGCCTCTACGACGCAACC
CTGACCCAGATGCACCATGCCGCCGCCAACCATGGCGCTTCCTGCTCCTGGATTGGCACCAGCCCCGTCCTCCTG
CTCCGCCATCCGGAAATGATACGCCAGCTGCTTATAGATAACGCCTCTCGCACCACGCGCCTCGATGACGACGGC
AACGGGCCCTTTGCAATTCTCGCCCGCGTCACCGGCCTCACTGCCGCCACCGCCAATGGCAGAAACTGGAGCCGC
TGGCGACGAGGCTTCCTCCGCACCTTTGCCAGCCCCGCTGCCCTCAGGGCCTCGCATCACGCCATGGTCCGTATT
GCCCAGAGACACGTTGCCGCCATGAAACATCCGCCTCAGCCTCACAATCTCTACCACGCCATGGAAGCTTTTGCC
CTCGACTCCGTCTGGCACCTTGGTCTCGGCCTCGACGACGCCTCCCACCACTTGCCCCATATCCGCGTCGTCATG
GCTCGATATGGCCGTCTAGTCGGCAACCCTTCCCATCTCTGGCGCCACCTTGTCCGCTGCCTGTGCTCGGGAAAA
CCAGTCACTGAACCCGATCACGTCGAGTTGAGCGTTGGCAACCACTTTGACCAAGTCCTGGGTCGCATTCTCCAT
CAAAACATCGACTTGCTGAGGCCGGGAAACCCACTGGGCAAAGACAGCCTCTTGCAAACAACCTCGCAAGAGTCG
GGCGGCTCTTTTCAAAAGCCCTTTACCCACGACGTCATGGCCCAGGCGCGTCAGCTCCTCTCCCTCGGCCACGAG
GCTTCAGCCCTGCTCCTCCTATGGGCCGTCTACGAGCTCAGCCAACAGCCCCAAGTCGTCAGCCGGCTCAGACAG
GAAATGAGCCACTACGGCTACCACGCCACCACACCAGACTTCAACACCCTTCGAGCCATGCCCTACTTGGACGCA
GTAGTGGCGGAAATCCTTCGCCTTCACCCCCCCATTTCAACCACGGCCCGTCTGGCAACACATGACTTGGTTCTG
CAAACACGCAATCGAGATGATGTCTTGATTCCCCGCGGCACCCTGCTGTTTGCGTCCATCCATCTCTTGCATCAC
GACCAACAGGTCTGGGGCCCAACAGCCTCAGACTTTGTCCCAGAGCGATGGAGTGGCATTTTAGCAAACAAGCTG
GAAAACCAGTGCCACCATCTCCCCTTTCTAGCAGGATCGAGAGCCTGTCCCAGCTCCGCCTTTGTCGTACTGCAG
CTAAAGACGATGCTCACCACTCTCTTCGCCCAGCTTGATATTGAAATCCTGGACAGGCCACTGATTGAGAAGCAG
GTCGGAGGCGTCGTCAGGCCGTCGGTGCCCGTGTCTTTTTTGGCCCACAAGAGGTCTCTGTAA
Gene >OphauB2|377
ATGCCCCAGGTGCCCGGCCACCCGCTGCTCGGCATCCTCCCCCAAATGTGTAACCAGGGCCTCTACGACGCAACC
CTGACCCAGATGCACCATGCCGCCGCCAACCATGGCGCTTCCTGCTCCTGGATTGGCACCAGCCCCGTCCTCCTG
CTCCGCCATCCGGAAATGATACGCCAGCTGCTTATAGATAACGCCTCTCGCACCACGCGCCTCGATGACGACGGC
AACGGGCCCTTTGCAATTCTCGCCCGCGTCACCGGCCTCACTGCCGCCACCGCCAATGGCAGAAACTGGAGCCGC
TGGCGACGAGGCTTCCTCCGCACCTTTGCCAGCCCCGCTGCCCTCAGGGCCTCGCATCACGCCATGGTCCGTATT
GCCCAGAGACACGTTGCCGCCATGAAACATCCGCCTCAGCCTCACAATCTCTACCACGCCATGGAAGCTTTTGCC
CTCGACTCCGTCTGGCACCTTGGTCTCGGCCTCGACGACGCCTCCCACCACTTGCCCCATATCCGCGTCGTCATG
GCTCGATATGGCCGTCTAGTCGGCAACCCTTCCCATCTCTGGCGCCACCTTGTCCGCTGCCTGTGCTCGGGAAAA
CCAGTCACTGAACCCGATCACGTCGAGTTGAGCGTTGGCAACCACTTTGACCAAGTCCTGGGTCGCATTCTCCAT
CAAAACATCGACTTGCTGAGGCCGGGAAACCCACTGGGCAAAGACAGCCTCTTGCAAACAACCTCGCAAGAGTCG
GGCGGCTCTTTTCAAAAGCCCTTTACCCACGACGTCATGGCCCAGGCGCGTCAGCTCCTCTCCCTCGGCCACGAG
GCTTCAGCCCTGCTCCTCCTATGGGCCGTCTACGAGCTCAGCCAACAGCCCCAAGTCGTCAGCCGGCTCAGACAG
GAAATGAGCCACTACGGCTACCACGCCACCACACCAGACTTCAACACCCTTCGAGCCATGCCCTACTTGGACGCA
GTAGTGGCGGAAATCCTTCGCCTTCACCCCCCCATTTCAACCACGGCCCGTCTGGCAACACATGACTTGGTTCTG
CAAACACGCAATCGAGATGATGTCTTGATTCCCCGCGGCACCCTGCTGTTTGCGTCCATCCATCTCTTGCATCAC
GACCAACAGGTCTGGGGCCCAACAGCCTCAGACTTTGTCCCAGAGCGATGGAGTGGCATTTTAGCAAACAAGCTG
GAAAACCAGTGCCACCATCTCCCCTTTCTAGCAGGATCGAGAGCCTGTCCCAGCTCCGCCTTTGTCGTACTGCAG
CTAAAGACGATGCTCACCACTCTCTTCGCCCAGCTTGATATTGAAATCCTGGACAGGCCACTGATTGAGAAGCAG
GTCGGAGGCGTCGTCAGGCCGTCGGTGCCCGTGTCTTTTTTGGCCCACAAGAGGTCTCTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail