Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3765
Gene name
LocationContig_24:113281..113950
Strand+
Gene length (bp)669
Transcript length (bp)669
Coding sequence length (bp)669
Protein length (aa) 223

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03364 Polyketide_cyc Polyketide cyclase / dehydrase and lipid transport 5.6E-20 62 214

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USM9|COQ10_SCHPO Coenzyme Q-binding protein coq10, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=coq10 PE=3 SV=1 53 220 2.0E-18
sp|Q9ZDZ7|RATA_RICPR Ribosome association toxin RatA OS=Rickettsia prowazekii (strain Madrid E) GN=ratA PE=3 SV=1 59 219 9.0E-16
sp|Q6PBN4|CQ10X_DANRE Coenzyme Q-binding protein COQ10 homolog, mitochondrial OS=Danio rerio GN=zgc:73324 PE=2 SV=2 59 219 1.0E-15
sp|Q75CC1|COQ10_ASHGO Coenzyme Q-binding protein COQ10, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=COQ10 PE=3 SV=1 27 217 3.0E-14
sp|Q08058|COQ10_YEAST Coenzyme Q-binding protein COQ10, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COQ10 PE=1 SV=1 36 217 4.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USM9|COQ10_SCHPO Coenzyme Q-binding protein coq10, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=coq10 PE=3 SV=1 53 220 2.0E-18
sp|Q9ZDZ7|RATA_RICPR Ribosome association toxin RatA OS=Rickettsia prowazekii (strain Madrid E) GN=ratA PE=3 SV=1 59 219 9.0E-16
sp|Q6PBN4|CQ10X_DANRE Coenzyme Q-binding protein COQ10 homolog, mitochondrial OS=Danio rerio GN=zgc:73324 PE=2 SV=2 59 219 1.0E-15
sp|Q75CC1|COQ10_ASHGO Coenzyme Q-binding protein COQ10, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=COQ10 PE=3 SV=1 27 217 3.0E-14
sp|Q08058|COQ10_YEAST Coenzyme Q-binding protein COQ10, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COQ10 PE=1 SV=1 36 217 4.0E-11
sp|Q6GNP0|CQ10B_XENLA Coenzyme Q-binding protein COQ10 homolog B, mitochondrial OS=Xenopus laevis GN=coq10b PE=2 SV=1 59 217 1.0E-10
sp|O68560|RATA_PSEAE Ribosome association toxin RatA OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ratA PE=3 SV=1 62 219 2.0E-10
sp|P0AGL6|RATA_SHIFL Ribosome association toxin RatA OS=Shigella flexneri GN=ratA PE=3 SV=1 55 222 3.0E-09
sp|P0AGL5|RATA_ECOLI Ribosome association toxin RatA OS=Escherichia coli (strain K12) GN=ratA PE=1 SV=1 55 222 3.0E-09
sp|Q8FEY4|PAST_ECOL6 Persistence and stress-resistance toxin PasT OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=pasT PE=1 SV=1 55 222 4.0E-09
sp|Q556V1|COQ10_DICDI Coenzyme Q-binding protein COQ10, mitochondrial OS=Dictyostelium discoideum GN=coq10-1 PE=3 SV=1 58 219 5.0E-08
sp|Q6DFA6|CQ10A_XENLA Coenzyme Q-binding protein COQ10 homolog A, mitochondrial OS=Xenopus laevis GN=coq10b-a PE=2 SV=1 10 217 2.0E-07
sp|Q96MF6|CQ10A_HUMAN Coenzyme Q-binding protein COQ10 homolog A, mitochondrial OS=Homo sapiens GN=COQ10A PE=2 SV=2 3 221 2.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3765
MALISTRFILPRCGYHARVSHHAPVSLATTSIAASRRTLFQWPGFNRREPSDLQRITVTRTLPYTPHALFNMIAD
IESYRGFVPYCLDSRVTAWSEPEASGQRLPTRAELTVGFAGLKEKFTSELVCEPGVSVRAFSGPGDLAGWQANSE
ILSGAIEKLAASWTLHPIENSPESPDPTTKVQLVVDFQFTTPIYDIMGRTFTRVTAEAMIEAFESRAKEKLS*
Coding >OphauB2|3765
ATGGCTCTCATATCCACCAGATTTATCCTGCCCCGCTGCGGTTACCACGCACGCGTTTCTCACCACGCACCTGTC
TCTCTCGCTACGACTTCAATTGCGGCCTCTCGCCGGACATTGTTCCAATGGCCTGGCTTTAATCGAAGAGAGCCT
TCTGATTTGCAGCGCATTACTGTTACTCGCACGCTGCCCTACACGCCTCACGCGCTCTTCAACATGATTGCCGAC
ATCGAATCGTATCGCGGCTTTGTGCCGTACTGTCTCGACTCGCGTGTCACAGCCTGGTCAGAGCCAGAAGCCAGC
GGTCAACGATTGCCGACTCGAGCAGAACTTACAGTCGGTTTCGCTGGCCTCAAAGAGAAATTTACCAGCGAGTTG
GTCTGCGAGCCTGGTGTTTCCGTCCGGGCTTTCAGTGGGCCCGGTGATTTAGCAGGGTGGCAAGCGAATAGTGAA
ATATTGTCGGGTGCTATTGAGAAACTTGCCGCGAGCTGGACTCTTCACCCTATTGAGAATTCGCCCGAGTCGCCA
GACCCTACCACAAAAGTGCAGCTCGTTGTCGACTTCCAGTTCACCACGCCTATCTACGATATAATGGGTAGAACC
TTTACTAGGGTAACCGCTGAGGCCATGATTGAGGCATTCGAGTCGCGAGCTAAAGAGAAGCTGAGCTAG
Transcript >OphauB2|3765
ATGGCTCTCATATCCACCAGATTTATCCTGCCCCGCTGCGGTTACCACGCACGCGTTTCTCACCACGCACCTGTC
TCTCTCGCTACGACTTCAATTGCGGCCTCTCGCCGGACATTGTTCCAATGGCCTGGCTTTAATCGAAGAGAGCCT
TCTGATTTGCAGCGCATTACTGTTACTCGCACGCTGCCCTACACGCCTCACGCGCTCTTCAACATGATTGCCGAC
ATCGAATCGTATCGCGGCTTTGTGCCGTACTGTCTCGACTCGCGTGTCACAGCCTGGTCAGAGCCAGAAGCCAGC
GGTCAACGATTGCCGACTCGAGCAGAACTTACAGTCGGTTTCGCTGGCCTCAAAGAGAAATTTACCAGCGAGTTG
GTCTGCGAGCCTGGTGTTTCCGTCCGGGCTTTCAGTGGGCCCGGTGATTTAGCAGGGTGGCAAGCGAATAGTGAA
ATATTGTCGGGTGCTATTGAGAAACTTGCCGCGAGCTGGACTCTTCACCCTATTGAGAATTCGCCCGAGTCGCCA
GACCCTACCACAAAAGTGCAGCTCGTTGTCGACTTCCAGTTCACCACGCCTATCTACGATATAATGGGTAGAACC
TTTACTAGGGTAACCGCTGAGGCCATGATTGAGGCATTCGAGTCGCGAGCTAAAGAGAAGCTGAGCTAG
Gene >OphauB2|3765
ATGGCTCTCATATCCACCAGATTTATCCTGCCCCGCTGCGGTTACCACGCACGCGTTTCTCACCACGCACCTGTC
TCTCTCGCTACGACTTCAATTGCGGCCTCTCGCCGGACATTGTTCCAATGGCCTGGCTTTAATCGAAGAGAGCCT
TCTGATTTGCAGCGCATTACTGTTACTCGCACGCTGCCCTACACGCCTCACGCGCTCTTCAACATGATTGCCGAC
ATCGAATCGTATCGCGGCTTTGTGCCGTACTGTCTCGACTCGCGTGTCACAGCCTGGTCAGAGCCAGAAGCCAGC
GGTCAACGATTGCCGACTCGAGCAGAACTTACAGTCGGTTTCGCTGGCCTCAAAGAGAAATTTACCAGCGAGTTG
GTCTGCGAGCCTGGTGTTTCCGTCCGGGCTTTCAGTGGGCCCGGTGATTTAGCAGGGTGGCAAGCGAATAGTGAA
ATATTGTCGGGTGCTATTGAGAAACTTGCCGCGAGCTGGACTCTTCACCCTATTGAGAATTCGCCCGAGTCGCCA
GACCCTACCACAAAAGTGCAGCTCGTTGTCGACTTCCAGTTCACCACGCCTATCTACGATATAATGGGTAGAACC
TTTACTAGGGTAACCGCTGAGGCCATGATTGAGGCATTCGAGTCGCGAGCTAAAGAGAAGCTGAGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail