Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3762
Gene name
LocationContig_24:102981..104573
Strand-
Gene length (bp)1592
Transcript length (bp)1365
Coding sequence length (bp)1365
Protein length (aa) 455

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01244 Peptidase_M19 Membrane dipeptidase (Peptidase family M19) 2.8E-101 74 431

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14124|DPEH1_SCHPO Uncharacterized dipeptidase C3A11.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3A11.10c PE=1 SV=1 1 435 3.0E-92
sp|D4DEJ7|DPEP1_TRIVH Putative dipeptidase TRV_05564 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_05564 PE=3 SV=1 30 448 7.0E-90
sp|D4B2N2|DPEP1_ARTBC Putative dipeptidase ARB_02715 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02715 PE=3 SV=1 30 448 1.0E-89
sp|E5R2Q7|DPEP1_ARTGP Putative dipeptidase MGYG_00085 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_00085 PE=3 SV=1 29 448 2.0E-89
sp|C5PCN6|DPEP2_COCP7 Putative dipeptidase CPC735_014430 OS=Coccidioides posadasii (strain C735) GN=CPC735_014430 PE=3 SV=1 34 443 4.0E-89
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14124|DPEH1_SCHPO Uncharacterized dipeptidase C3A11.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3A11.10c PE=1 SV=1 1 435 3.0E-92
sp|D4DEJ7|DPEP1_TRIVH Putative dipeptidase TRV_05564 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_05564 PE=3 SV=1 30 448 7.0E-90
sp|D4B2N2|DPEP1_ARTBC Putative dipeptidase ARB_02715 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02715 PE=3 SV=1 30 448 1.0E-89
sp|E5R2Q7|DPEP1_ARTGP Putative dipeptidase MGYG_00085 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_00085 PE=3 SV=1 29 448 2.0E-89
sp|C5PCN6|DPEP2_COCP7 Putative dipeptidase CPC735_014430 OS=Coccidioides posadasii (strain C735) GN=CPC735_014430 PE=3 SV=1 34 443 4.0E-89
sp|E9CV02|DPEP2_COCPS Putative dipeptidase CPSG_01350 OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) GN=CPSG_01350 PE=3 SV=1 34 443 4.0E-89
sp|C5PCZ0|DPEP1_COCP7 Putative dipeptidase CPC735_015490 OS=Coccidioides posadasii (strain C735) GN=CPC735_015490 PE=3 SV=1 68 445 9.0E-89
sp|C5FK77|DPEP1_ARTOC Putative dipeptidase MCYG_02918 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_02918 PE=3 SV=1 62 448 5.0E-86
sp|E9D269|DPEP1_COCPS Putative dipeptidase CPSG_03667 OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) GN=CPSG_03667 PE=3 SV=1 68 445 9.0E-85
sp|B8LWT1|DPEP2_TALSN Putative dipeptidase TSTA_079200 OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=TSTA_079200 PE=3 SV=1 69 443 5.0E-83
sp|P31429|DPEP1_RABIT Dipeptidase 1 OS=Oryctolagus cuniculus GN=DPEP1 PE=1 SV=1 50 440 4.0E-82
sp|P16444|DPEP1_HUMAN Dipeptidase 1 OS=Homo sapiens GN=DPEP1 PE=1 SV=3 68 441 8.0E-82
sp|C7ZIE1|DPEP2_NECH7 Putative dipeptidase NECHADRAFT_87110 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=NECHADRAFT_87110 PE=3 SV=1 38 448 5.0E-81
sp|O59832|DPEH2_SCHPO Uncharacterized dipeptidase C965.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC965.12 PE=3 SV=1 62 446 2.0E-80
sp|C4JQN7|DPEP2_UNCRE Putative dipeptidase UREG_03382 OS=Uncinocarpus reesii (strain UAMH 1704) GN=UREG_03382 PE=3 SV=1 69 443 1.0E-79
sp|P31430|DPEP1_RAT Dipeptidase 1 OS=Rattus norvegicus GN=Dpep1 PE=2 SV=2 53 441 1.0E-78
sp|Q3SZM7|DPEP1_BOVIN Dipeptidase 1 OS=Bos taurus GN=DPEP1 PE=2 SV=1 68 443 5.0E-78
sp|P43477|DPEP1_SHEEP Dipeptidase 1 OS=Ovis aries GN=DPEP1 PE=1 SV=1 68 443 1.0E-77
sp|P22412|DPEP1_PIG Dipeptidase 1 OS=Sus scrofa GN=DPEP1 PE=1 SV=1 51 443 1.0E-74
sp|P31428|DPEP1_MOUSE Dipeptidase 1 OS=Mus musculus GN=Dpep1 PE=1 SV=2 53 441 3.0E-74
sp|Q8C255|DPEP2_MOUSE Dipeptidase 2 OS=Mus musculus GN=Dpep2 PE=1 SV=1 68 440 2.0E-66
sp|Q5M872|DPEP2_RAT Dipeptidase 2 OS=Rattus norvegicus GN=Dpep2 PE=2 SV=1 41 440 1.0E-64
sp|Q9H4A9|DPEP2_HUMAN Dipeptidase 2 OS=Homo sapiens GN=DPEP2 PE=1 SV=2 60 440 6.0E-62
sp|Q9DA79|DPEP3_MOUSE Dipeptidase 3 OS=Mus musculus GN=Dpep3 PE=1 SV=1 68 438 2.0E-59
sp|Q5U2X4|DPEP3_RAT Dipeptidase 3 OS=Rattus norvegicus GN=Dpep3 PE=2 SV=1 68 438 3.0E-59
sp|Q9H4B8|DPEP3_HUMAN Dipeptidase 3 OS=Homo sapiens GN=DPEP3 PE=2 SV=2 69 446 1.0E-52
sp|Q4R7M2|DPEP3_MACFA Dipeptidase 3 OS=Macaca fascicularis GN=DPEP3 PE=2 SV=2 69 442 5.0E-51
sp|P27509|YPQQ_KLEPN Uncharacterized protein in pqqA 5'region (Fragment) OS=Klebsiella pneumoniae PE=3 SV=1 198 432 3.0E-25
sp|P07783|YPQR_ACICA Uncharacterized protein in PQQ-III 3'region (Fragment) OS=Acinetobacter calcoaceticus PE=3 SV=1 78 369 3.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0006508 proteolysis Yes
GO:0070573 metallodipeptidase activity Yes
GO:0043170 macromolecule metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0016805 dipeptidase activity No
GO:0008233 peptidase activity No
GO:0008150 biological_process No
GO:0016787 hydrolase activity No
GO:0008237 metallopeptidase activity No
GO:0003674 molecular_function No
GO:0008235 metalloexopeptidase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0006807 nitrogen compound metabolic process No
GO:0003824 catalytic activity No
GO:0008238 exopeptidase activity No
GO:0071704 organic substance metabolic process No
GO:0008152 metabolic process No
GO:0044238 primary metabolic process No
GO:0019538 protein metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 46 0.5

Transmembrane Domains

Domain # Start End Length
1 24 46 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3762
MASSKTEAPARHHEQEHRAKSNRSIILRGLALCLIAAFILSTIQTIQRPASCYYYRLKRSFSQESVDERARRILS
ENPLIDGHIDFAVVLREAYGNRIDNAQWAQHFENGTLPGHVDLARLRKGLSGGAFWSVFAPCPAKGDDLSDGNLA
ASVQFTMDQIDATDRAFSAYPDDFALNIDSSGALDAFKHGKLISPLGVEGLHQIGNSVANLRLFHRLGGRYVTLT
HNCHNKYADAACLENPFRKAEPLWNGVSPLGRQLIHEMNRIGMIVDLSHVSEETMTDILGERSDWSGSEAPIIFS
HSSVWAICPHPRNVKDHVLQRVKQHNSLVMVNISPDFIACVDKGKQNGIPEPDPENADLDQVVRHIMYIGNLIGY
DHVGIGTDFDGIPTTPRGFEDVSKYPDLVTALLRAGVDDSDVAKIVGRNLLRVWKDVDSVSAKMKAKGAPVMEDN
RKPV*
Coding >OphauB2|3762
ATGGCCTCCTCCAAGACAGAAGCTCCTGCCAGACACCATGAGCAAGAGCATCGTGCCAAGAGCAACCGCAGCATC
ATCCTACGCGGCCTCGCTCTGTGTCTCATTGCCGCCTTTATTCTCAGCACTATCCAAACTATCCAAAGACCTGCC
TCATGTTACTATTACCGTCTGAAGCGCAGTTTCAGCCAAGAGTCCGTCGACGAACGAGCCCGTAGAATTCTCTCC
GAGAACCCTCTTATTGATGGTCACATTGACTTTGCCGTCGTCTTGCGAGAGGCATATGGCAACCGTATTGACAAT
GCCCAGTGGGCTCAACACTTCGAAAATGGTACCCTCCCGGGTCACGTCGATCTCGCTCGTCTGAGAAAAGGCCTA
TCCGGCGGTGCCTTTTGGAGTGTTTTCGCCCCTTGCCCAGCCAAGGGTGATGATCTCTCAGATGGGAATCTCGCT
GCCAGTGTTCAATTCACCATGGACCAAATCGACGCCACAGACAGGGCTTTTAGTGCATATCCCGACGACTTCGCC
CTCAATATTGACAGTTCAGGAGCCCTCGACGCCTTTAAACACGGCAAGCTCATATCGCCGCTCGGGGTCGAGGGC
TTGCACCAGATTGGAAACTCGGTGGCGAATCTGCGCCTCTTCCATCGCCTTGGTGGGCGCTACGTGACTCTCACC
CATAATTGCCACAACAAATATGCCGATGCCGCCTGCCTCGAAAACCCTTTTAGAAAGGCAGAACCTCTTTGGAAT
GGCGTGAGCCCCTTGGGTCGGCAGCTTATTCACGAAATGAACCGCATTGGCATGATTGTCGACCTTTCTCACGTC
AGTGAAGAAACCATGACGGACATTTTGGGCGAACGCAGTGACTGGTCTGGATCCGAGGCGCCCATTATCTTCTCC
CACAGCTCAGTATGGGCTATTTGTCCGCATCCGCGCAACGTCAAAGACCATGTGCTGCAACGCGTCAAGCAGCAC
AATTCACTGGTCATGGTAAACATTAGTCCAGACTTCATCGCGTGCGTCGACAAGGGCAAGCAGAATGGGATCCCC
GAACCAGACCCCGAAAACGCAGATCTTGATCAGGTCGTTCGTCACATCATGTATATTGGCAACCTGATTGGCTAC
GATCATGTTGGCATTGGCACCGACTTTGATGGTATTCCGACCACGCCCCGAGGATTCGAGGATGTCTCAAAGTAC
CCAGATCTTGTGACGGCACTGCTACGCGCCGGCGTCGACGACTCAGACGTGGCAAAGATTGTGGGCCGTAACCTG
CTGCGCGTCTGGAAGGATGTCGATTCTGTGTCTGCAAAGATGAAGGCAAAGGGCGCTCCCGTCATGGAGGACAAC
AGGAAGCCAGTGTAA
Transcript >OphauB2|3762
ATGGCCTCCTCCAAGACAGAAGCTCCTGCCAGACACCATGAGCAAGAGCATCGTGCCAAGAGCAACCGCAGCATC
ATCCTACGCGGCCTCGCTCTGTGTCTCATTGCCGCCTTTATTCTCAGCACTATCCAAACTATCCAAAGACCTGCC
TCATGTTACTATTACCGTCTGAAGCGCAGTTTCAGCCAAGAGTCCGTCGACGAACGAGCCCGTAGAATTCTCTCC
GAGAACCCTCTTATTGATGGTCACATTGACTTTGCCGTCGTCTTGCGAGAGGCATATGGCAACCGTATTGACAAT
GCCCAGTGGGCTCAACACTTCGAAAATGGTACCCTCCCGGGTCACGTCGATCTCGCTCGTCTGAGAAAAGGCCTA
TCCGGCGGTGCCTTTTGGAGTGTTTTCGCCCCTTGCCCAGCCAAGGGTGATGATCTCTCAGATGGGAATCTCGCT
GCCAGTGTTCAATTCACCATGGACCAAATCGACGCCACAGACAGGGCTTTTAGTGCATATCCCGACGACTTCGCC
CTCAATATTGACAGTTCAGGAGCCCTCGACGCCTTTAAACACGGCAAGCTCATATCGCCGCTCGGGGTCGAGGGC
TTGCACCAGATTGGAAACTCGGTGGCGAATCTGCGCCTCTTCCATCGCCTTGGTGGGCGCTACGTGACTCTCACC
CATAATTGCCACAACAAATATGCCGATGCCGCCTGCCTCGAAAACCCTTTTAGAAAGGCAGAACCTCTTTGGAAT
GGCGTGAGCCCCTTGGGTCGGCAGCTTATTCACGAAATGAACCGCATTGGCATGATTGTCGACCTTTCTCACGTC
AGTGAAGAAACCATGACGGACATTTTGGGCGAACGCAGTGACTGGTCTGGATCCGAGGCGCCCATTATCTTCTCC
CACAGCTCAGTATGGGCTATTTGTCCGCATCCGCGCAACGTCAAAGACCATGTGCTGCAACGCGTCAAGCAGCAC
AATTCACTGGTCATGGTAAACATTAGTCCAGACTTCATCGCGTGCGTCGACAAGGGCAAGCAGAATGGGATCCCC
GAACCAGACCCCGAAAACGCAGATCTTGATCAGGTCGTTCGTCACATCATGTATATTGGCAACCTGATTGGCTAC
GATCATGTTGGCATTGGCACCGACTTTGATGGTATTCCGACCACGCCCCGAGGATTCGAGGATGTCTCAAAGTAC
CCAGATCTTGTGACGGCACTGCTACGCGCCGGCGTCGACGACTCAGACGTGGCAAAGATTGTGGGCCGTAACCTG
CTGCGCGTCTGGAAGGATGTCGATTCTGTGTCTGCAAAGATGAAGGCAAAGGGCGCTCCCGTCATGGAGGACAAC
AGGAAGCCAGTGTAA
Gene >OphauB2|3762
ATGGCCTCCTCCAAGACAGAAGCTCCTGCCAGACACCATGAGCAAGAGCATCGTGCCAAGAGCAACCGCAGCATC
ATCCTACGCGGCCTCGCTCTGTGTCTCATTGCCGCCTTTATTCTCAGCACTATCCAAACTATCCAAAGACCTGCC
TCATGTTACTATTACCGTCTGAAGCGCAGTTTCAGCCAAGAGTCCGTCGACGAACGAGCCCGTAGAATTCTCTCC
GAGAACCCTCTTATTGGTACGCCCTCCCATTCATTCCGTCTTGCCAGCTTTAATTGATGCGCCAGACTTGGGCCA
GATGGTCACATTGACTTTGCCGTCGTCTTGCGAGAGGCATATGGCAACCGTATTGACAATGCCCAGTGGGCTCAA
CACTTCGAAAATGGTACCCTCCCGGGTCACGTCGATCTCGCTCGTCTGAGAAAAGGCCTATCCGGCGGTGCCTTT
TGGAGTGTTTTCGCCCCTTGCCCAGCCAAGGGTGATGATCTCTCAGATGGGAATCTCGCTGCCAGTAACAAGCTT
AACTCCCGTACACGCTTCAGTAACATGCTTAGAGTGCTCATGTATTTACAGGTGTTCAATTCACCATGGACCAAA
TCGACGCCACAGACAGGGCTTTTAGTGCATATCCCGACGACTTCGCCCTCAATATTGACAGTTCAGGAGCCCTCG
ACGCCTTTAAACACGGCAAGCTCATATCGCCGCTCGGGGTCGAGGGCTTGCACCAGATTGGAAACTCGGTGGCGA
ATCTGCGCCTCTTCCATCGCCTTGGTGGGCGCTACGTGACTCTCACCCATAATTGCCACAACAAATATGCCGATG
CCGCCTGCCTCGAAAACCCTTTTAGAAAGGCAGAACCTCTTTGGAATGGCGTGAGCCCCTTGGGTCGGCAGCTTA
TTCACGAAATGAACCGCATTGGCATGATTGTCGACCTTTCTCACGTCAGGTCAGTTTGACCCCTTGCCTATCCTC
TCTTGAATTCCGGCTTCTGGTACACTTCATAATCGTCTTTGAGCCTCTTCGGTCATCTAACATGTAATTCGCTGG
GCAGTGAAGAAACCATGACGGACATTTTGGGCGAACGCAGTGACTGGTCTGGATCCGAGGCGCCCATTATCTTCT
CCCACAGCTCAGTATGGGCTATTTGTCCGCATCCGCGCAACGTCAAAGACCATGTGCTGCAACGCGTCAAGCAGC
ACAATTCACTGGTCATGGTAAACATTAGTCCAGACTTCATCGCGTGCGTCGACAAGGGCAAGCAGAATGGGATCC
CCGAACCAGACCCCGAAAACGCAGATCTTGATCAGGTCGTTCGTCACATCATGTATATTGGCAACCTGATTGGCT
ACGATCATGTTGGCATTGGCACCGACTTTGATGGTATTCCGACCACGCCCCGAGGATTCGAGGATGTCTCAAAGT
ACCCAGATCTTGTGACGGCACTGCTACGCGCCGGCGTCGACGACTCAGACGTGGCAAAGATTGTGGGCCGTAACC
TGCTGCGCGTCTGGAAGGATGTCGATTCTGTGTCTGCAAAGATGAAGGCAAAGGGCGCTCCCGTCATGGAGGACA
ACAGGAAGCCAGTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail