Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3758
Gene name
LocationContig_24:98610..99606
Strand+
Gene length (bp)996
Transcript length (bp)822
Coding sequence length (bp)822
Protein length (aa) 274

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20520 Ac45-VOA1_TM V0 complex accessory subunit Ac45/VOA1 transmembrane domain 4.9E-19 223 262

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7R6|BIG1_SCHPO Protein big1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=big1 PE=3 SV=1 218 261 1.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 225 247 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3758
MRLYALSGALALSTAVNAALSDSSPWLLFSTAKFQDTLNTNQIQTSSAVLKHSKEILASCPTEHYLVVSQPGVHG
AELGRTGSCAMPHLCRAIEDARVKSRFTVAEVVGHVTHPGIAQHIRESCAQKNKGVTVQHVDLVSIPREDRTSAL
FSNDATLASSLDAITSRNSFTIIFYSPPGEPVYEAEFSDSLHIEMKRDMHSMPMRRQDNDSKRDTRPLFEKYQFF
TPGVFMGIVTTLILLSILSVGIRALSSLQVSYGAFEKENGPAAHKKYQ*
Coding >OphauB2|3758
ATGCGTCTATACGCACTCTCTGGCGCTCTGGCGCTGTCTACAGCGGTCAATGCCGCGCTATCAGACTCGAGCCCA
TGGCTCTTATTCTCCACAGCCAAGTTTCAAGACACTTTGAATACAAATCAAATTCAAACTAGCTCAGCCGTACTG
AAGCACTCCAAGGAGATTCTGGCATCCTGTCCGACGGAGCACTATCTCGTTGTTTCGCAGCCTGGCGTGCATGGT
GCCGAGCTGGGCCGGACGGGGAGCTGTGCGATGCCGCATCTTTGCCGTGCCATCGAGGATGCGCGTGTCAAGAGT
CGATTTACTGTGGCTGAGGTTGTTGGCCATGTGACGCATCCAGGCATTGCCCAGCATATTCGAGAGTCTTGCGCC
CAGAAGAACAAGGGGGTGACTGTCCAACATGTTGACCTTGTGTCGATTCCTCGAGAGGACCGAACCAGTGCACTG
TTTAGCAATGATGCGACACTTGCTAGTAGCTTGGATGCCATCACGTCGAGAAACAGTTTCACCATCATCTTTTAC
TCCCCTCCTGGCGAGCCAGTGTACGAAGCAGAGTTCAGTGACTCGCTACACATAGAAATGAAGCGCGACATGCAC
TCAATGCCCATGCGGCGCCAGGACAACGACTCGAAGCGAGATACTCGTCCCCTATTCGAAAAGTACCAATTCTTC
ACCCCAGGTGTTTTTATGGGCATCGTTACGACCCTGATTCTGCTTTCAATCCTCAGTGTTGGCATCAGGGCTTTG
TCGAGTCTTCAGGTGTCGTACGGGGCCTTTGAGAAGGAGAATGGACCGGCTGCCCACAAGAAATATCAGTGA
Transcript >OphauB2|3758
ATGCGTCTATACGCACTCTCTGGCGCTCTGGCGCTGTCTACAGCGGTCAATGCCGCGCTATCAGACTCGAGCCCA
TGGCTCTTATTCTCCACAGCCAAGTTTCAAGACACTTTGAATACAAATCAAATTCAAACTAGCTCAGCCGTACTG
AAGCACTCCAAGGAGATTCTGGCATCCTGTCCGACGGAGCACTATCTCGTTGTTTCGCAGCCTGGCGTGCATGGT
GCCGAGCTGGGCCGGACGGGGAGCTGTGCGATGCCGCATCTTTGCCGTGCCATCGAGGATGCGCGTGTCAAGAGT
CGATTTACTGTGGCTGAGGTTGTTGGCCATGTGACGCATCCAGGCATTGCCCAGCATATTCGAGAGTCTTGCGCC
CAGAAGAACAAGGGGGTGACTGTCCAACATGTTGACCTTGTGTCGATTCCTCGAGAGGACCGAACCAGTGCACTG
TTTAGCAATGATGCGACACTTGCTAGTAGCTTGGATGCCATCACGTCGAGAAACAGTTTCACCATCATCTTTTAC
TCCCCTCCTGGCGAGCCAGTGTACGAAGCAGAGTTCAGTGACTCGCTACACATAGAAATGAAGCGCGACATGCAC
TCAATGCCCATGCGGCGCCAGGACAACGACTCGAAGCGAGATACTCGTCCCCTATTCGAAAAGTACCAATTCTTC
ACCCCAGGTGTTTTTATGGGCATCGTTACGACCCTGATTCTGCTTTCAATCCTCAGTGTTGGCATCAGGGCTTTG
TCGAGTCTTCAGGTGTCGTACGGGGCCTTTGAGAAGGAGAATGGACCGGCTGCCCACAAGAAATATCAGTGA
Gene >OphauB2|3758
ATGCGTCTATACGCACTCTCTGGCGCTCTGGCGCTGTCTACAGCGGTCAATGCCGCGCTATCAGACTCGAGCCCA
TGGCTCTTATTCTCCACAGCCAAGTGAGAGCCTCCCTCCTCTCCACCCTCAGAATTCAAGAGCAGCCAACTAACG
ACGCTGCAAGGTTTCAAGACACTTTGAATACAAATCAAATTCAAACTAGCTCAGCCGTACTGAAGCACTCCAAGG
AGATTCTGGCATCCTGTCCGACGGAGCACTATCTCGTTGTTTCGCAGCCTGGCGTGCATGGTGCCGAGCTGGGCC
GGACGGGGAGCTGTGCGATGCCGCATCTTTGCCGTGCCATCGAGGATGCGCGTGTCAAGAGTCGATTTACTGTGG
CTGAGGTTGTTGGCCATGTGACGCATCCAGGCATTGCCCAGCATATTCGAGAGTCTTGCGCCCAGAAGAACAAGG
GGGTGACTGTCCAACATGTTGACCTTGTGTCGATTCCTCGAGAGGACCGAACCAGTGCACTGTTTAGCAATGGTA
GGGTGGATGTATCTACTCCTGTGGCTGAGAATTTTGCTGACAGATATGCCAAGATGCGACACTTGCTAGTAGCTT
GGATGCCATCACGTCGAGAAACAGTTTCACCATCATCTTTTACTCCCCTCCTGGCGAGCCAGTGTACGAAGCAGA
GTTCAGTGACTCGCTACACATAGAAATGAAGCGCGACATGCACTCAATGCCCATGCGGCGCCAGGACAACGACTC
GAAGCGAGATACTCGTCCCCTATTCGAAAAGTACCAATTCTTCACCCCAGGTACGTCCCGGCTATAAGTCCCTCG
CGGCCAGAATTTGCATGTTGACTCTATCTAGGTGTTTTTATGGGCATCGTTACGACCCTGATTCTGCTTTCAATC
CTCAGTGTTGGCATCAGGGCTTTGTCGAGTCTTCAGGTGTCGTACGGGGCCTTTGAGAAGGAGAATGGACCGGCT
GCCCACAAGAAATATCAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail