Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3747
Gene name
LocationContig_24:66228..67541
Strand-
Gene length (bp)1313
Transcript length (bp)1065
Coding sequence length (bp)1065
Protein length (aa) 355

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13621 Cupin_8 Cupin-like domain 1.7E-70 58 331

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0C872|JMJD7_MOUSE JmjC domain-containing protein 7 OS=Mus musculus GN=Jmjd7 PE=1 SV=1 25 331 1.0E-48
sp|P0C870|JMJD7_HUMAN JmjC domain-containing protein 7 OS=Homo sapiens GN=JMJD7 PE=1 SV=1 25 331 4.0E-47
sp|Q54CS7|JMJCE_DICDI JmjC domain-containing protein E OS=Dictyostelium discoideum GN=jcdE PE=3 SV=2 29 348 9.0E-40
sp|Q8BK58|HBAP1_MOUSE HSPB1-associated protein 1 OS=Mus musculus GN=Hspbap1 PE=1 SV=2 84 330 8.0E-09
sp|Q8RWR1|JMJ30_ARATH Putative lysine-specific demethylase JMJD5 OS=Arabidopsis thaliana GN=JMJD5 PE=2 SV=1 48 330 3.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0C872|JMJD7_MOUSE JmjC domain-containing protein 7 OS=Mus musculus GN=Jmjd7 PE=1 SV=1 25 331 1.0E-48
sp|P0C870|JMJD7_HUMAN JmjC domain-containing protein 7 OS=Homo sapiens GN=JMJD7 PE=1 SV=1 25 331 4.0E-47
sp|Q54CS7|JMJCE_DICDI JmjC domain-containing protein E OS=Dictyostelium discoideum GN=jcdE PE=3 SV=2 29 348 9.0E-40
sp|Q8BK58|HBAP1_MOUSE HSPB1-associated protein 1 OS=Mus musculus GN=Hspbap1 PE=1 SV=2 84 330 8.0E-09
sp|Q8RWR1|JMJ30_ARATH Putative lysine-specific demethylase JMJD5 OS=Arabidopsis thaliana GN=JMJD5 PE=2 SV=1 48 330 3.0E-08
sp|Q5BKC6|HBAP1_RAT HSPB1-associated protein 1 OS=Rattus norvegicus GN=Hspbap1 PE=1 SV=1 84 330 5.0E-08
sp|Q58CU3|HBAP1_BOVIN HSPB1-associated protein 1 OS=Bos taurus GN=HSPBAP1 PE=2 SV=1 84 330 6.0E-08
sp|Q9CXT6|KDM8_MOUSE Lysine-specific demethylase 8 OS=Mus musculus GN=Kdm8 PE=2 SV=1 56 308 1.0E-07
sp|Q96EW2|HBAP1_HUMAN HSPB1-associated protein 1 OS=Homo sapiens GN=HSPBAP1 PE=1 SV=1 75 330 3.0E-07
sp|Q6AXL5|HBAP1_DANRE HSPB1-associated protein 1 homolog OS=Danio rerio GN=hspbap1 PE=2 SV=2 194 330 3.0E-07
sp|Q497B8|KDM8_RAT Lysine-specific demethylase 8 OS=Rattus norvegicus GN=Kdm8 PE=2 SV=1 56 308 4.0E-07
sp|Q1JP61|KDM8_BOVIN Lysine-specific demethylase 8 OS=Bos taurus GN=KDM8 PE=2 SV=1 62 308 2.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3747
MAALGAARDAVGDAVGDAARDAARDAALDAAFTHLVTAFNDLNGPSLVELHSEPSPLEFMRFVARNSPFVIRRAA
AHWNATLKWTGAHLVAALDGQTINVAVTPNGNADAPTFSPHHNATLFAKPHEESQFFKDFLTYIVKQESDATFDQ
TAEVRYAQTQNDNLRDEYSPLFPDAQKDIPFVRIALQRPPDAINLWIGNSRSVTAIHKDNFENIYVQIRGRKHFT
LFPPLCQPCMNEKMLPSATYIRHANSSLSLQLDDDAQPVPFATWDPDEPEFHTTQWSSLARPMRVTLEPGDMLYL
PAMWYHKVTQSCIPDDEPFVAAINYWYDMEYSGTLYPLASFLRKLGQFPTSEEP*
Coding >OphauB2|3747
ATGGCGGCCCTGGGTGCAGCCCGTGATGCAGTCGGTGATGCAGTCGGTGATGCAGCCCGTGATGCAGCCCGTGAT
GCAGCCCTTGATGCAGCCTTTACCCATCTCGTCACCGCCTTCAACGACCTCAACGGCCCCTCGCTTGTCGAGCTC
CATTCCGAGCCGAGCCCTCTCGAGTTTATGCGATTTGTTGCCCGCAACTCGCCTTTTGTTATCCGCCGCGCCGCT
GCCCATTGGAATGCCACCCTGAAATGGACTGGTGCACATCTCGTAGCCGCCCTCGACGGCCAGACCATCAATGTT
GCCGTCACTCCCAACGGCAATGCCGACGCTCCAACTTTTTCGCCTCACCACAACGCAACCCTCTTCGCCAAGCCT
CATGAGGAATCTCAGTTCTTCAAAGACTTTCTCACCTATATTGTCAAACAGGAATCAGATGCTACTTTTGACCAA
ACCGCCGAGGTGAGGTATGCACAGACCCAAAACGATAATCTGCGTGACGAGTACTCGCCTCTCTTCCCCGATGCT
CAAAAAGACATTCCCTTTGTCCGCATTGCCCTTCAAAGACCCCCAGACGCCATTAATCTCTGGATCGGAAACTCG
CGCTCCGTCACAGCCATTCACAAAGACAACTTTGAAAACATCTATGTCCAAATCCGCGGCCGCAAGCATTTTACC
CTCTTTCCTCCACTGTGTCAGCCATGCATGAATGAAAAAATGCTGCCTTCAGCCACCTATATTCGCCATGCCAAT
AGCAGCCTATCTCTCCAGCTTGATGACGATGCCCAACCCGTCCCCTTTGCCACTTGGGATCCCGATGAACCCGAG
TTCCATACTACGCAATGGTCCTCATTGGCAAGGCCCATGCGTGTCACGCTGGAGCCAGGCGATATGCTCTATCTT
CCAGCCATGTGGTATCACAAAGTCACGCAATCCTGCATACCGGATGACGAGCCGTTCGTTGCCGCAATAAATTAC
TGGTACGACATGGAATATAGCGGGACGCTCTACCCGTTGGCTTCATTTCTACGCAAACTTGGCCAGTTCCCCACA
AGCGAGGAACCATAA
Transcript >OphauB2|3747
ATGGCGGCCCTGGGTGCAGCCCGTGATGCAGTCGGTGATGCAGTCGGTGATGCAGCCCGTGATGCAGCCCGTGAT
GCAGCCCTTGATGCAGCCTTTACCCATCTCGTCACCGCCTTCAACGACCTCAACGGCCCCTCGCTTGTCGAGCTC
CATTCCGAGCCGAGCCCTCTCGAGTTTATGCGATTTGTTGCCCGCAACTCGCCTTTTGTTATCCGCCGCGCCGCT
GCCCATTGGAATGCCACCCTGAAATGGACTGGTGCACATCTCGTAGCCGCCCTCGACGGCCAGACCATCAATGTT
GCCGTCACTCCCAACGGCAATGCCGACGCTCCAACTTTTTCGCCTCACCACAACGCAACCCTCTTCGCCAAGCCT
CATGAGGAATCTCAGTTCTTCAAAGACTTTCTCACCTATATTGTCAAACAGGAATCAGATGCTACTTTTGACCAA
ACCGCCGAGGTGAGGTATGCACAGACCCAAAACGATAATCTGCGTGACGAGTACTCGCCTCTCTTCCCCGATGCT
CAAAAAGACATTCCCTTTGTCCGCATTGCCCTTCAAAGACCCCCAGACGCCATTAATCTCTGGATCGGAAACTCG
CGCTCCGTCACAGCCATTCACAAAGACAACTTTGAAAACATCTATGTCCAAATCCGCGGCCGCAAGCATTTTACC
CTCTTTCCTCCACTGTGTCAGCCATGCATGAATGAAAAAATGCTGCCTTCAGCCACCTATATTCGCCATGCCAAT
AGCAGCCTATCTCTCCAGCTTGATGACGATGCCCAACCCGTCCCCTTTGCCACTTGGGATCCCGATGAACCCGAG
TTCCATACTACGCAATGGTCCTCATTGGCAAGGCCCATGCGTGTCACGCTGGAGCCAGGCGATATGCTCTATCTT
CCAGCCATGTGGTATCACAAAGTCACGCAATCCTGCATACCGGATGACGAGCCGTTCGTTGCCGCAATAAATTAC
TGGTACGACATGGAATATAGCGGGACGCTCTACCCGTTGGCTTCATTTCTACGCAAACTTGGCCAGTTCCCCACA
AGCGAGGAACCATAA
Gene >OphauB2|3747
ATGGCGGCCCTGGGTGCAGCCCGTGATGCAGTCGGTGATGCAGTCGGTGATGCAGCCCGTGATGCAGCCCGTGAT
GCAGCCCTTGATGCAGCCTTTACCCATCTCGTCACCGCCTTCAACGACCTCAACGGCCCCTCGCTTGTCGAGCTC
CATTCCGAGCCGAGCCCTCTCGAGTTTATGCGATTTGTTGCCCGCAACTCGCCTTTTGTTATCCGCCGCGCCGCT
GCCCATTGGAATGCCACCCTGAAATGGACTGGTGCACATCTCGTAGCCGCCCTCGACGGCCAGACCATCAATGTT
GCCGTCACTCCCAACGGGTACGTCGCTTGCCCCTTCTCTTCCAATACTCTACTCTGTTTGACTGACGACTCTAGC
AATGCCGACGCTCCAACTTTTTCGCCTCACCACAACGCAACCCTCTTCGCCAAGCCTCATGAGGAATCTCAGTTC
TTCAAAGACTTTCTCACCTATATTGTCAAACAGGAATCAGATGCTACTTTTGACCAAACCGCCGAGGTGAGGTAT
GCACAGACCCGTCAGTCTCATCTCCTCTCACTCAATCTCACTGAAACTCACCAAGTCCTTGAAGAAAACGATAAT
CTGCGTGACGAGTACTCGCCTCTCTTCCCCGATGCTCAAAAAGACATTCCCTTTGTCCGCATTGCCCTTCAAAGA
CCCCCAGACGCCATTAATCTCTGGATCGGAAACTCGCGCTCCGTCACAGCCATTCACAAAGACAACTTTGAAAAC
ATCTATGTCCAAATCCGCGGCCGCAAGCATTTTACCCTCTTTCCTCCACTGTGTCAGCCATGCATGAATGAAAAA
ATGCTGCCTTCAGCCACCTATATTCGCCATGCCAATAGCAGCCTATCTCTCCAGCTTGATGACGATGCCCAACCC
GTCCCCTTTGCCACTTGGGATCCCGATGAACCCGAGTTCCATACTACGCAATGGTCCTCATTGGCAAGGCCCATG
CGTGTCACGCTGGAGCCAGGCGATATGCTCTATCTTCCAGCCATGTGGTGAGTCAAAATCGTGGCCCATTGTAAA
ACTCCGCTCACACCTTGTTATTAATCGAAACAGGTATCACAAAGTCACGCAATCCTGCATACCGGATGACGAGCC
GTTCGTTGCCGCAATAAATTACTGGTCAGTTGACCTTCATCTGACCTTTCCACGGTTCACTTGCTGTCCTCCTGA
CACTTATAATGCTGACTCGAACCAGGTACGACATGGAATATAGCGGGACGCTCTACCCGTTGGCTTCATTTCTAC
GCAAACTTGGCCAGTTCCCCACAAGCGAGGAACCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail