Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3746
Gene name
LocationContig_24:63490..66141
Strand+
Gene length (bp)2651
Transcript length (bp)2508
Coding sequence length (bp)2508
Protein length (aa) 836

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07780 Spb1_C Spb1 C-terminal domain 7.2E-83 621 830
PF01728 FtsJ FtsJ-like methyltransferase 9.7E-55 24 200
PF11861 DUF3381 Domain of unknown function (DUF3381) 2.6E-53 234 389

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q52C47|SPB1_MAGO7 AdoMet-dependent rRNA methyltransferase SPB1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=SPB1 PE=3 SV=2 1 835 0.0E+00
sp|Q9P6V8|SPB1_NEUCR AdoMet-dependent rRNA methyltransferase spb1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=spb1 PE=3 SV=2 1 833 0.0E+00
sp|Q5BH88|SPB1_EMENI AdoMet-dependent rRNA methyltransferase spb1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=spb1 PE=3 SV=1 1 835 0.0E+00
sp|Q4WVH3|SPB1_ASPFU AdoMet-dependent rRNA methyltransferase spb1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=spb1 PE=3 SV=1 1 834 0.0E+00
sp|Q751U1|SPB1_ASHGO AdoMet-dependent rRNA methyltransferase SPB1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SPB1 PE=3 SV=2 4 835 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q52C47|SPB1_MAGO7 AdoMet-dependent rRNA methyltransferase SPB1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=SPB1 PE=3 SV=2 1 835 0.0E+00
sp|Q9P6V8|SPB1_NEUCR AdoMet-dependent rRNA methyltransferase spb1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=spb1 PE=3 SV=2 1 833 0.0E+00
sp|Q5BH88|SPB1_EMENI AdoMet-dependent rRNA methyltransferase spb1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=spb1 PE=3 SV=1 1 835 0.0E+00
sp|Q4WVH3|SPB1_ASPFU AdoMet-dependent rRNA methyltransferase spb1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=spb1 PE=3 SV=1 1 834 0.0E+00
sp|Q751U1|SPB1_ASHGO AdoMet-dependent rRNA methyltransferase SPB1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SPB1 PE=3 SV=2 4 835 0.0E+00
sp|P25582|SPB1_YEAST 27S pre-rRNA (guanosine(2922)-2'-O)-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPB1 PE=1 SV=2 4 832 0.0E+00
sp|Q6CV12|SPB1_KLULA AdoMet-dependent rRNA methyltransferase SPB1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SPB1 PE=3 SV=1 4 832 0.0E+00
sp|O42832|SPB1_SCHPO AdoMet-dependent rRNA methyltransferase spb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spb1 PE=1 SV=2 4 835 0.0E+00
sp|Q6FX63|SPB1_CANGA AdoMet-dependent rRNA methyltransferase SPB1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SPB1 PE=3 SV=1 4 830 0.0E+00
sp|Q59KF3|SPB1_CANAL AdoMet-dependent rRNA methyltransferase SPB1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SPB1 PE=3 SV=1 4 835 0.0E+00
sp|Q6BNQ8|SPB1_DEBHA AdoMet-dependent rRNA methyltransferase SPB1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SPB1 PE=3 SV=2 4 835 0.0E+00
sp|Q6C9Q1|SPB1_YARLI AdoMet-dependent rRNA methyltransferase SPB1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SPB1 PE=3 SV=1 3 832 0.0E+00
sp|Q4P6G5|SPB1_USTMA AdoMet-dependent rRNA methyltransferase SPB1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SPB1 PE=3 SV=1 4 507 9.0E-162
sp|Q9DBE9|SPB1_MOUSE pre-rRNA processing protein FTSJ3 OS=Mus musculus GN=Ftsj3 PE=1 SV=1 1 472 2.0E-118
sp|Q5RJT2|SPB1_RAT pre-rRNA processing protein FTSJ3 OS=Rattus norvegicus GN=Ftsj3 PE=1 SV=1 1 472 3.0E-118
sp|Q5RAS1|SPB1_PONAB pre-rRNA processing protein FTSJ3 OS=Pongo abelii GN=FTSJ3 PE=2 SV=1 1 434 3.0E-116
sp|Q8IY81|SPB1_HUMAN pre-rRNA processing protein FTSJ3 OS=Homo sapiens GN=FTSJ3 PE=1 SV=2 1 434 1.0E-115
sp|Q54NX0|SPB1_DICDI Putative rRNA methyltransferase OS=Dictyostelium discoideum GN=fsjC PE=3 SV=1 4 323 5.0E-111
sp|O36015|TRM7_SCHPO Putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4F10.03c PE=3 SV=1 6 245 7.0E-45
sp|P38238|TRM7_YEAST tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRM7 PE=1 SV=1 6 210 1.0E-44
sp|Q9UET6|TRM7_HUMAN Putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase OS=Homo sapiens GN=FTSJ1 PE=1 SV=2 13 213 4.0E-43
sp|Q22031|TRM7_CAEEL Putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase OS=Caenorhabditis elegans GN=R74.7 PE=3 SV=3 6 208 1.0E-40
sp|P0CS78|SPB1_CRYNJ AdoMet-dependent rRNA methyltransferase SPB1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SPB1 PE=3 SV=1 612 829 1.0E-40
sp|P0CS79|SPB1_CRYNB AdoMet-dependent rRNA methyltransferase SPB1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SPB1 PE=3 SV=1 612 829 1.0E-40
sp|Q54VA8|TRM7_DICDI Putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase OS=Dictyostelium discoideum GN=fsjA PE=3 SV=1 6 213 4.0E-39
sp|A0B8A1|RLME_METTP Ribosomal RNA large subunit methyltransferase E OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=rlmE PE=3 SV=1 13 205 1.0E-37
sp|Q58771|RLME_METJA Ribosomal RNA large subunit methyltransferase E OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rlmE PE=3 SV=1 13 204 2.0E-37
sp|A4FYM2|RLME_METM5 Ribosomal RNA large subunit methyltransferase E OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rlmE PE=3 SV=1 13 238 1.0E-36
sp|A6UUK5|RLME_META3 Ribosomal RNA large subunit methyltransferase E OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=rlmE PE=3 SV=1 13 204 1.0E-36
sp|Q6LZL8|RLME_METMP Ribosomal RNA large subunit methyltransferase E OS=Methanococcus maripaludis (strain S2 / LL) GN=rlmE PE=3 SV=1 13 238 2.0E-36
sp|A9A6B9|RLME_METM6 Ribosomal RNA large subunit methyltransferase E OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=rlmE PE=3 SV=1 13 238 3.0E-36
sp|A6VJR0|RLME_METM7 Ribosomal RNA large subunit methyltransferase E OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rlmE PE=3 SV=1 13 238 5.0E-36
sp|A6USA0|RLME_METVS Ribosomal RNA large subunit methyltransferase E OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rlmE PE=3 SV=1 13 204 6.0E-36
sp|Q9VEP1|TRM71_DROME Putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase 1 OS=Drosophila melanogaster GN=CG5220 PE=2 SV=1 6 213 1.0E-35
sp|Q8TR92|RLME_METAC Ribosomal RNA large subunit methyltransferase E OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rlmE PE=3 SV=1 11 211 8.0E-35
sp|B9LSX2|RLME_HALLT Ribosomal RNA large subunit methyltransferase E OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=rlmE PE=3 SV=1 13 203 8.0E-35
sp|Q8PUP4|RLME_METMA Ribosomal RNA large subunit methyltransferase E OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rlmE PE=3 SV=1 11 211 1.0E-34
sp|Q9VDD9|TRM72_DROME Putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase 2 OS=Drosophila melanogaster GN=CG7009 PE=3 SV=1 9 208 6.0E-34
sp|Q466Q1|RLME_METBF Ribosomal RNA large subunit methyltransferase E OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=rlmE PE=3 SV=1 11 211 3.0E-33
sp|Q0W1F9|RLME_METAR Ribosomal RNA large subunit methyltransferase E OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=rlmE PE=3 SV=1 13 200 7.0E-33
sp|Q0BT08|RLME_GRABC Ribosomal RNA large subunit methyltransferase E OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=rlmE PE=3 SV=1 13 201 3.0E-31
sp|Q2NHD6|RLME_METST Ribosomal RNA large subunit methyltransferase E OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=rlmE PE=3 SV=1 15 205 4.0E-31
sp|Q12WR3|RLME_METBU Ribosomal RNA large subunit methyltransferase E OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=rlmE PE=3 SV=1 11 210 7.0E-31
sp|Q3IT24|RLME_NATPD Ribosomal RNA large subunit methyltransferase E OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=rlmE PE=3 SV=1 11 205 5.0E-30
sp|Q0A769|RLME_ALKEH Ribosomal RNA large subunit methyltransferase E OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=rlmE PE=3 SV=1 13 200 7.0E-30
sp|A5VFI9|RLME_SPHWW Ribosomal RNA large subunit methyltransferase E OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=rlmE PE=3 SV=1 13 202 9.0E-30
sp|A1K598|RLME_AZOSB Ribosomal RNA large subunit methyltransferase E OS=Azoarcus sp. (strain BH72) GN=rlmE PE=3 SV=1 13 196 1.0E-29
sp|Q3SJR5|RLME_THIDA Ribosomal RNA large subunit methyltransferase E OS=Thiobacillus denitrificans (strain ATCC 25259) GN=rlmE PE=3 SV=1 13 198 2.0E-29
sp|A0RV28|RLME_CENSY Ribosomal RNA large subunit methyltransferase E OS=Cenarchaeum symbiosum (strain A) GN=rlmE PE=3 SV=1 13 202 2.0E-29
sp|Q7NRI3|RLME_CHRVO Ribosomal RNA large subunit methyltransferase E OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=rlmE PE=3 SV=1 13 199 3.0E-29
sp|Q2GB53|RLME_NOVAD Ribosomal RNA large subunit methyltransferase E OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=rlmE PE=3 SV=1 13 202 4.0E-29
sp|Q5F9L0|RLME_NEIG1 Ribosomal RNA large subunit methyltransferase E OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=rlmE PE=3 SV=1 1 196 6.0E-29
sp|O28228|RLME_ARCFU Ribosomal RNA large subunit methyltransferase E OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rlmE PE=3 SV=1 9 201 8.0E-29
sp|Q7DDL2|RLME_NEIMB Ribosomal RNA large subunit methyltransferase E OS=Neisseria meningitidis serogroup B (strain MC58) GN=rlmE PE=3 SV=1 1 196 9.0E-29
sp|Q9JQX5|RLME_NEIMA Ribosomal RNA large subunit methyltransferase E OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=rlmE PE=3 SV=1 1 196 9.0E-29
sp|A9M3N1|RLME_NEIM0 Ribosomal RNA large subunit methyltransferase E OS=Neisseria meningitidis serogroup C (strain 053442) GN=rlmE PE=3 SV=1 1 196 9.0E-29
sp|Q5PAN0|RLME_ANAMM Ribosomal RNA large subunit methyltransferase E OS=Anaplasma marginale (strain St. Maries) GN=rlmE PE=3 SV=1 18 205 9.0E-29
sp|B9KIP4|RLME_ANAMF Ribosomal RNA large subunit methyltransferase E OS=Anaplasma marginale (strain Florida) GN=rlmE PE=3 SV=1 18 205 9.0E-29
sp|B4RK82|RLME_NEIG2 Ribosomal RNA large subunit methyltransferase E OS=Neisseria gonorrhoeae (strain NCCP11945) GN=rlmE PE=3 SV=1 1 196 1.0E-28
sp|A1KT57|RLME_NEIMF Ribosomal RNA large subunit methyltransferase E OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=rlmE PE=3 SV=1 1 196 1.0E-28
sp|A1TXM4|RLME_MARHV Ribosomal RNA large subunit methyltransferase E OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=rlmE PE=3 SV=1 13 202 2.0E-28
sp|A5G029|RLME_ACICJ Ribosomal RNA large subunit methyltransferase E OS=Acidiphilium cryptum (strain JF-5) GN=rlmE PE=3 SV=1 13 201 2.0E-28
sp|Q9HN40|RLME_HALSA Ribosomal RNA large subunit methyltransferase E OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rlmE PE=3 SV=1 11 198 2.0E-28
sp|B0R7G3|RLME_HALS3 Ribosomal RNA large subunit methyltransferase E OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=rlmE PE=3 SV=1 11 198 2.0E-28
sp|Q5UYP9|RLME_HALMA Ribosomal RNA large subunit methyltransferase E OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rlmE PE=3 SV=1 13 198 4.0E-28
sp|A5UKI5|RLME_METS3 Ribosomal RNA large subunit methyltransferase E OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=rlmE PE=3 SV=1 3 200 4.0E-28
sp|A1B962|RLME_PARDP Ribosomal RNA large subunit methyltransferase E OS=Paracoccus denitrificans (strain Pd 1222) GN=rlmE PE=3 SV=1 13 202 4.0E-28
sp|A7HSA5|RLME_PARL1 Ribosomal RNA large subunit methyltransferase E OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=rlmE PE=3 SV=1 13 202 7.0E-28
sp|Q2N843|RLME_ERYLH Ribosomal RNA large subunit methyltransferase E OS=Erythrobacter litoralis (strain HTCC2594) GN=rlmE PE=3 SV=1 13 202 8.0E-28
sp|Q5NQH8|RLME_ZYMMO Ribosomal RNA large subunit methyltransferase E OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=rlmE PE=3 SV=1 13 202 8.0E-28
sp|Q6G0S9|RLME_BARQU Ribosomal RNA large subunit methyltransferase E OS=Bartonella quintana (strain Toulouse) GN=rlmE PE=3 SV=1 13 202 9.0E-28
sp|Q5LSB0|RLME_RUEPO Ribosomal RNA large subunit methyltransferase E OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=rlmE PE=3 SV=1 13 202 2.0E-27
sp|Q1GPG3|RLME_SPHAL Ribosomal RNA large subunit methyltransferase E OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=rlmE PE=3 SV=1 13 202 2.0E-27
sp|Q5FNQ1|RLME_GLUOX Ribosomal RNA large subunit methyltransferase E OS=Gluconobacter oxydans (strain 621H) GN=rlmE PE=3 SV=1 13 206 2.0E-27
sp|A9IMA1|RLME_BART1 Ribosomal RNA large subunit methyltransferase E OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=rlmE PE=3 SV=1 13 206 2.0E-27
sp|A5VUZ8|RLME_BRUO2 Ribosomal RNA large subunit methyltransferase E OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=rlmE PE=3 SV=2 13 202 2.0E-27
sp|Q8FVY1|RLME_BRUSU Ribosomal RNA large subunit methyltransferase E OS=Brucella suis biovar 1 (strain 1330) GN=rlmE PE=3 SV=2 13 202 2.0E-27
sp|A9WYY2|RLME_BRUSI Ribosomal RNA large subunit methyltransferase E OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=rlmE PE=3 SV=1 13 202 2.0E-27
sp|Q8YCD5|RLME_BRUME Ribosomal RNA large subunit methyltransferase E OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=rlmE PE=3 SV=1 13 202 2.0E-27
sp|C0RLJ5|RLME_BRUMB Ribosomal RNA large subunit methyltransferase E OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=rlmE PE=3 SV=1 13 202 2.0E-27
sp|A9MBW8|RLME_BRUC2 Ribosomal RNA large subunit methyltransferase E OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=rlmE PE=3 SV=1 13 202 2.0E-27
sp|Q578H4|RLME_BRUAB Ribosomal RNA large subunit methyltransferase E OS=Brucella abortus biovar 1 (strain 9-941) GN=rlmE PE=3 SV=2 13 202 2.0E-27
sp|Q2YKU4|RLME_BRUA2 Ribosomal RNA large subunit methyltransferase E OS=Brucella abortus (strain 2308) GN=rlmE PE=3 SV=2 13 202 2.0E-27
sp|B2SAY0|RLME_BRUA1 Ribosomal RNA large subunit methyltransferase E OS=Brucella abortus (strain S19) GN=rlmE PE=3 SV=1 13 202 2.0E-27
sp|Q2KVR5|RLME_BORA1 Ribosomal RNA large subunit methyltransferase E OS=Bordetella avium (strain 197N) GN=rlmE PE=3 SV=1 13 203 3.0E-27
sp|Q2W0P2|RLME_MAGSA Ribosomal RNA large subunit methyltransferase E OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=rlmE PE=3 SV=1 13 202 4.0E-27
sp|Q5ZKM1|SPB1_CHICK pre-rRNA processing protein FTSJ3 OS=Gallus gallus GN=FTSJ3 PE=2 SV=2 654 825 4.0E-27
sp|A2SSW7|RLME_METLZ Ribosomal RNA large subunit methyltransferase E OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=rlmE PE=3 SV=1 13 200 4.0E-27
sp|Q607B2|RLME_METCA Ribosomal RNA large subunit methyltransferase E OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=rlmE PE=3 SV=1 13 205 4.0E-27
sp|A6X5L4|RLME_OCHA4 Ribosomal RNA large subunit methyltransferase E OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=rlmE PE=3 SV=1 13 202 4.0E-27
sp|O27801|RLME_METTH Ribosomal RNA large subunit methyltransferase E OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rlmE PE=3 SV=1 13 202 5.0E-27
sp|C1DFL6|RLME_AZOVD Ribosomal RNA large subunit methyltransferase E OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=rlmE PE=3 SV=1 13 202 5.0E-27
sp|A1W8H0|RLME_ACISJ Ribosomal RNA large subunit methyltransferase E OS=Acidovorax sp. (strain JS42) GN=rlmE PE=3 SV=2 13 201 6.0E-27
sp|A1URN3|RLME_BARBK Ribosomal RNA large subunit methyltransferase E OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=rlmE PE=3 SV=1 13 202 6.0E-27
sp|B7VJI4|RLME_VIBTL Ribosomal RNA large subunit methyltransferase E OS=Vibrio tasmaniensis (strain LGP32) GN=rlmE PE=3 SV=1 13 202 8.0E-27
sp|Q48E69|RLME_PSE14 Ribosomal RNA large subunit methyltransferase E OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=rlmE PE=3 SV=1 13 202 8.0E-27
sp|Q18E61|RLME_HALWD Ribosomal RNA large subunit methyltransferase E OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=rlmE PE=3 SV=1 13 196 1.0E-26
sp|Q164M8|RLME_ROSDO Ribosomal RNA large subunit methyltransferase E OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=rlmE PE=3 SV=1 13 202 2.0E-26
sp|Q3J2Q5|RLME_RHOS4 Ribosomal RNA large subunit methyltransferase E OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=rlmE PE=3 SV=1 13 202 3.0E-26
sp|A3PJK8|RLME_RHOS1 Ribosomal RNA large subunit methyltransferase E OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=rlmE PE=3 SV=1 13 202 3.0E-26
sp|P95454|RLME_PSEAE Ribosomal RNA large subunit methyltransferase E OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rlmE PE=3 SV=2 13 202 3.0E-26
sp|Q02FS0|RLME_PSEAB Ribosomal RNA large subunit methyltransferase E OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=rlmE PE=3 SV=1 13 202 3.0E-26
sp|B7V1G4|RLME_PSEA8 Ribosomal RNA large subunit methyltransferase E OS=Pseudomonas aeruginosa (strain LESB58) GN=rlmE PE=3 SV=1 13 202 3.0E-26
sp|A6VCK9|RLME_PSEA7 Ribosomal RNA large subunit methyltransferase E OS=Pseudomonas aeruginosa (strain PA7) GN=rlmE PE=3 SV=1 13 202 3.0E-26
sp|A7MZH4|RLME_VIBCB Ribosomal RNA large subunit methyltransferase E OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=rlmE PE=3 SV=1 13 202 4.0E-26
sp|Q4ZNQ4|RLME_PSEU2 Ribosomal RNA large subunit methyltransferase E OS=Pseudomonas syringae pv. syringae (strain B728a) GN=rlmE PE=3 SV=1 13 202 5.0E-26
sp|Q086I0|RLME_SHEFN Ribosomal RNA large subunit methyltransferase E OS=Shewanella frigidimarina (strain NCIMB 400) GN=rlmE PE=3 SV=1 13 201 5.0E-26
sp|A9A3M9|RLME_NITMS Ribosomal RNA large subunit methyltransferase E OS=Nitrosopumilus maritimus (strain SCM1) GN=rlmE PE=3 SV=1 11 200 5.0E-26
sp|Q6LUJ9|RLME_PHOPR Ribosomal RNA large subunit methyltransferase E OS=Photobacterium profundum GN=rlmE PE=3 SV=1 13 201 6.0E-26
sp|Q87WP7|RLME_PSESM Ribosomal RNA large subunit methyltransferase E OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=rlmE PE=3 SV=1 13 202 7.0E-26
sp|Q4FMX1|RLME_PELUB Ribosomal RNA large subunit methyltransferase E OS=Pelagibacter ubique (strain HTCC1062) GN=rlmE PE=3 SV=1 13 198 7.0E-26
sp|Q4KIG3|RLME_PSEF5 Ribosomal RNA large subunit methyltransferase E OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=rlmE PE=3 SV=1 13 202 8.0E-26
sp|B6J802|RLME_COXB1 Ribosomal RNA large subunit methyltransferase E OS=Coxiella burnetii (strain CbuK_Q154) GN=rlmE PE=3 SV=1 13 200 8.0E-26
sp|Q92RT9|RLME_RHIME Ribosomal RNA large subunit methyltransferase E OS=Rhizobium meliloti (strain 1021) GN=rlmE PE=3 SV=1 13 202 9.0E-26
sp|Q6G4Z3|RLME_BARHE Ribosomal RNA large subunit methyltransferase E OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=rlmE PE=3 SV=1 13 202 1.0E-25
sp|Q6MN40|RLME_BDEBA Ribosomal RNA large subunit methyltransferase E OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=rlmE PE=3 SV=1 13 196 1.0E-25
sp|C3LSP1|RLME_VIBCM Ribosomal RNA large subunit methyltransferase E OS=Vibrio cholerae serotype O1 (strain M66-2) GN=rlmE PE=3 SV=1 13 202 2.0E-25
sp|Q9KU87|RLME_VIBCH Ribosomal RNA large subunit methyltransferase E OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rlmE PE=3 SV=1 13 202 2.0E-25
sp|A5F937|RLME_VIBC3 Ribosomal RNA large subunit methyltransferase E OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=rlmE PE=3 SV=1 13 202 2.0E-25
sp|C3K267|RLME_PSEFS Ribosomal RNA large subunit methyltransferase E OS=Pseudomonas fluorescens (strain SBW25) GN=rlmE PE=3 SV=1 13 202 2.0E-25
sp|Q21H48|RLME_SACD2 Ribosomal RNA large subunit methyltransferase E OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=rlmE PE=3 SV=1 13 202 2.0E-25
sp|Q73IS9|RLME_WOLPM Ribosomal RNA large subunit methyltransferase E OS=Wolbachia pipientis wMel GN=rlmE PE=3 SV=1 13 204 2.0E-25
sp|Q2YBT1|RLME_NITMU Ribosomal RNA large subunit methyltransferase E OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=rlmE PE=3 SV=1 13 199 2.0E-25
sp|Q83BY4|RLME_COXBU Ribosomal RNA large subunit methyltransferase E OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=rlmE PE=3 SV=1 13 200 2.0E-25
sp|A9KGE6|RLME_COXBN Ribosomal RNA large subunit methyltransferase E OS=Coxiella burnetii (strain Dugway 5J108-111) GN=rlmE PE=3 SV=1 13 200 2.0E-25
sp|B6IZD5|RLME_COXB2 Ribosomal RNA large subunit methyltransferase E OS=Coxiella burnetii (strain CbuG_Q212) GN=rlmE PE=3 SV=1 13 200 2.0E-25
sp|A4XYE8|RLME_PSEMY Ribosomal RNA large subunit methyltransferase E OS=Pseudomonas mendocina (strain ymp) GN=rlmE PE=3 SV=1 13 202 2.0E-25
sp|Q12QI9|RLME_SHEDO Ribosomal RNA large subunit methyltransferase E OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=rlmE PE=3 SV=1 13 201 2.0E-25
sp|Q87LZ4|RLME_VIBPA Ribosomal RNA large subunit methyltransferase E OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rlmE PE=3 SV=1 13 202 2.0E-25
sp|A9N8M5|RLME_COXBR Ribosomal RNA large subunit methyltransferase E OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=rlmE PE=3 SV=1 13 200 2.0E-25
sp|Q7VZ56|RLME_BORPE Ribosomal RNA large subunit methyltransferase E OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=rlmE PE=3 SV=1 13 201 3.0E-25
sp|B0TZQ8|RLME_FRAP2 Ribosomal RNA large subunit methyltransferase E OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=rlmE PE=3 SV=1 15 202 3.0E-25
sp|A1TQF0|RLME_ACIAC Ribosomal RNA large subunit methyltransferase E OS=Acidovorax citrulli (strain AAC00-1) GN=rlmE PE=3 SV=1 13 201 3.0E-25
sp|Q7W8R6|RLME_BORPA Ribosomal RNA large subunit methyltransferase E OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=rlmE PE=3 SV=1 13 201 3.0E-25
sp|Q7WMD3|RLME_BORBR Ribosomal RNA large subunit methyltransferase E OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=rlmE PE=3 SV=1 13 201 3.0E-25
sp|B0VEE9|RLME_ACIBY Ribosomal RNA large subunit methyltransferase E OS=Acinetobacter baumannii (strain AYE) GN=rlmE PE=3 SV=1 13 199 4.0E-25
sp|A3M851|RLME_ACIBT Ribosomal RNA large subunit methyltransferase E OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=rlmE PE=3 SV=2 13 199 4.0E-25
sp|B0VSM4|RLME_ACIBS Ribosomal RNA large subunit methyltransferase E OS=Acinetobacter baumannii (strain SDF) GN=rlmE PE=3 SV=1 13 199 4.0E-25
sp|B2HXD3|RLME_ACIBC Ribosomal RNA large subunit methyltransferase E OS=Acinetobacter baumannii (strain ACICU) GN=rlmE PE=3 SV=1 13 199 4.0E-25
sp|B7I636|RLME_ACIB5 Ribosomal RNA large subunit methyltransferase E OS=Acinetobacter baumannii (strain AB0057) GN=rlmE PE=3 SV=1 13 199 4.0E-25
sp|B7GY18|RLME_ACIB3 Ribosomal RNA large subunit methyltransferase E OS=Acinetobacter baumannii (strain AB307-0294) GN=rlmE PE=3 SV=1 13 199 4.0E-25
sp|A4SJQ7|RLME_AERS4 Ribosomal RNA large subunit methyltransferase E OS=Aeromonas salmonicida (strain A449) GN=rlmE PE=3 SV=1 13 201 4.0E-25
sp|Q2SMM1|RLME_HAHCH Ribosomal RNA large subunit methyltransferase E OS=Hahella chejuensis (strain KCTC 2396) GN=rlmE PE=3 SV=1 13 202 4.0E-25
sp|A8FYS8|RLME_SHESH Ribosomal RNA large subunit methyltransferase E OS=Shewanella sediminis (strain HAW-EB3) GN=rlmE PE=3 SV=1 13 201 4.0E-25
sp|B1KRR8|RLME_SHEWM Ribosomal RNA large subunit methyltransferase E OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=rlmE PE=3 SV=1 13 201 5.0E-25
sp|A3QGV3|RLME_SHELP Ribosomal RNA large subunit methyltransferase E OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=rlmE PE=3 SV=1 13 201 6.0E-25
sp|A1RGW7|RLME_SHESW Ribosomal RNA large subunit methyltransferase E OS=Shewanella sp. (strain W3-18-1) GN=rlmE PE=3 SV=1 13 201 6.0E-25
sp|A4Y9C8|RLME_SHEPC Ribosomal RNA large subunit methyltransferase E OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=rlmE PE=3 SV=1 13 201 6.0E-25
sp|A1WXX3|RLME_HALHL Ribosomal RNA large subunit methyltransferase E OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=rlmE PE=3 SV=1 13 199 6.0E-25
sp|Q8EHM3|RLME_SHEON Ribosomal RNA large subunit methyltransferase E OS=Shewanella oneidensis (strain MR-1) GN=rlmE PE=3 SV=1 13 201 7.0E-25
sp|Q0HXS3|RLME_SHESR Ribosomal RNA large subunit methyltransferase E OS=Shewanella sp. (strain MR-7) GN=rlmE PE=3 SV=1 13 201 1.0E-24
sp|O62251|MRM2_CAEEL rRNA methyltransferase 2, mitochondrial OS=Caenorhabditis elegans GN=F45G2.9 PE=3 SV=1 19 201 1.0E-24
sp|A9HYV0|RLME_BORPD Ribosomal RNA large subunit methyltransferase E OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=rlmE PE=3 SV=1 13 202 1.0E-24
sp|A0LGZ0|RLME_SYNFM Ribosomal RNA large subunit methyltransferase E OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=rlmE PE=3 SV=1 13 196 1.0E-24
sp|B8CKG5|RLME_SHEPW Ribosomal RNA large subunit methyltransferase E OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=rlmE PE=3 SV=1 13 201 2.0E-24
sp|Q30YX3|RLME_DESAG Ribosomal RNA large subunit methyltransferase E OS=Desulfovibrio alaskensis (strain G20) GN=rlmE PE=3 SV=1 13 202 2.0E-24
sp|A1VQI6|RLME_POLNA Ribosomal RNA large subunit methyltransferase E OS=Polaromonas naphthalenivorans (strain CJ2) GN=rlmE PE=3 SV=1 13 201 2.0E-24
sp|Q1H387|RLME_METFK Ribosomal RNA large subunit methyltransferase E OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=rlmE PE=3 SV=1 13 196 2.0E-24
sp|A1S454|RLME_SHEAM Ribosomal RNA large subunit methyltransferase E OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=rlmE PE=3 SV=1 13 201 2.0E-24
sp|Q1IF51|RLME_PSEE4 Ribosomal RNA large subunit methyltransferase E OS=Pseudomonas entomophila (strain L48) GN=rlmE PE=3 SV=1 13 202 2.0E-24
sp|Q0HLG9|RLME_SHESM Ribosomal RNA large subunit methyltransferase E OS=Shewanella sp. (strain MR-4) GN=rlmE PE=3 SV=1 13 201 3.0E-24
sp|A0KTY8|RLME_SHESA Ribosomal RNA large subunit methyltransferase E OS=Shewanella sp. (strain ANA-3) GN=rlmE PE=3 SV=1 13 201 3.0E-24
sp|Q3J823|RLME_NITOC Ribosomal RNA large subunit methyltransferase E OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=rlmE PE=3 SV=1 13 198 3.0E-24
sp|Q2FNX6|RLME_METHJ Ribosomal RNA large subunit methyltransferase E OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=rlmE PE=3 SV=1 13 200 3.0E-24
sp|Q21WW8|RLME_RHOFT Ribosomal RNA large subunit methyltransferase E OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=rlmE PE=3 SV=1 13 201 3.0E-24
sp|C4L8Y1|RLME_TOLAT Ribosomal RNA large subunit methyltransferase E OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=rlmE PE=3 SV=1 13 201 3.0E-24
sp|A1ST38|RLME_PSYIN Ribosomal RNA large subunit methyltransferase E OS=Psychromonas ingrahamii (strain 37) GN=rlmE PE=3 SV=1 13 202 4.0E-24
sp|Q1LSK2|RLME_BAUCH Ribosomal RNA large subunit methyltransferase E OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=rlmE PE=3 SV=1 13 201 4.0E-24
sp|B8GNX9|RLME_THISH Ribosomal RNA large subunit methyltransferase E OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=rlmE PE=3 SV=1 13 202 4.0E-24
sp|B0TQB0|RLME_SHEHH Ribosomal RNA large subunit methyltransferase E OS=Shewanella halifaxensis (strain HAW-EB4) GN=rlmE PE=3 SV=1 13 201 5.0E-24
sp|Q138J5|RLME_RHOPS Ribosomal RNA large subunit methyltransferase E OS=Rhodopseudomonas palustris (strain BisB5) GN=rlmE PE=3 SV=1 13 212 5.0E-24
sp|Q2GDL7|RLME_NEOSM Ribosomal RNA large subunit methyltransferase E OS=Neorickettsia sennetsu (strain Miyayama) GN=rlmE PE=3 SV=1 13 199 5.0E-24
sp|Q3KI92|RLME_PSEPF Ribosomal RNA large subunit methyltransferase E OS=Pseudomonas fluorescens (strain Pf0-1) GN=rlmE PE=3 SV=1 13 202 5.0E-24
sp|Q0C187|RLME_HYPNA Ribosomal RNA large subunit methyltransferase E OS=Hyphomonas neptunium (strain ATCC 15444) GN=rlmE PE=3 SV=1 13 201 7.0E-24
sp|Q2IV68|RLME_RHOP2 Ribosomal RNA large subunit methyltransferase E OS=Rhodopseudomonas palustris (strain HaA2) GN=rlmE PE=3 SV=1 13 202 7.0E-24
sp|Q47HI2|RLME_DECAR Ribosomal RNA large subunit methyltransferase E OS=Dechloromonas aromatica (strain RCB) GN=rlmE PE=3 SV=1 13 201 8.0E-24
sp|A1WEE7|RLME_VEREI Ribosomal RNA large subunit methyltransferase E OS=Verminephrobacter eiseniae (strain EF01-2) GN=rlmE PE=3 SV=1 13 209 8.0E-24
sp|A6U6F0|RLME_SINMW Ribosomal RNA large subunit methyltransferase E OS=Sinorhizobium medicae (strain WSM419) GN=rlmE PE=3 SV=1 13 202 8.0E-24
sp|Q0AQH3|RLME_MARMM Ribosomal RNA large subunit methyltransferase E OS=Maricaulis maris (strain MCS10) GN=rlmE PE=3 SV=1 13 202 9.0E-24
sp|B4F2B2|RLME_PROMH Ribosomal RNA large subunit methyltransferase E OS=Proteus mirabilis (strain HI4320) GN=rlmE PE=3 SV=1 13 199 9.0E-24
sp|A8H748|RLME_SHEPA Ribosomal RNA large subunit methyltransferase E OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=rlmE PE=3 SV=1 13 201 1.0E-23
sp|B0T8J6|RLME_CAUSK Ribosomal RNA large subunit methyltransferase E OS=Caulobacter sp. (strain K31) GN=rlmE PE=3 SV=2 13 202 1.0E-23
sp|Q2KC36|RLME_RHIEC Ribosomal RNA large subunit methyltransferase E OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=rlmE PE=3 SV=1 13 204 1.0E-23
sp|A7IDJ5|RLME_XANP2 Ribosomal RNA large subunit methyltransferase E OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=rlmE PE=3 SV=1 13 202 1.0E-23
sp|C3MGQ4|RLME_RHISN Ribosomal RNA large subunit methyltransferase E OS=Rhizobium sp. (strain NGR234) GN=rlmE PE=3 SV=1 13 202 1.0E-23
sp|B9JSD2|RLME_AGRVS Ribosomal RNA large subunit methyltransferase E OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=rlmE PE=3 SV=1 13 202 1.0E-23
sp|Q6F8N1|RLME_ACIAD Ribosomal RNA large subunit methyltransferase E OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=rlmE PE=3 SV=1 13 199 1.0E-23
sp|Q0VSS9|RLME_ALCBS Ribosomal RNA large subunit methyltransferase E OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=rlmE PE=3 SV=1 13 201 2.0E-23
sp|B1XXG3|RLME_LEPCP Ribosomal RNA large subunit methyltransferase E OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=rlmE PE=3 SV=1 13 202 2.0E-23
sp|Q1RHG3|RLME_RICBR Ribosomal RNA large subunit methyltransferase E OS=Rickettsia bellii (strain RML369-C) GN=rlmE PE=3 SV=1 13 197 2.0E-23
sp|A8GV60|RLME_RICB8 Ribosomal RNA large subunit methyltransferase E OS=Rickettsia bellii (strain OSU 85-389) GN=rlmE PE=3 SV=1 13 197 2.0E-23
sp|B5XSW2|RLME_KLEP3 Ribosomal RNA large subunit methyltransferase E OS=Klebsiella pneumoniae (strain 342) GN=rlmE PE=3 SV=1 13 201 2.0E-23
sp|B3PLQ4|RLME_CELJU Ribosomal RNA large subunit methyltransferase E OS=Cellvibrio japonicus (strain Ueda107) GN=rlmE PE=3 SV=1 13 206 2.0E-23
sp|C5CKU4|RLME_VARPS Ribosomal RNA large subunit methyltransferase E OS=Variovorax paradoxus (strain S110) GN=rlmE PE=3 SV=1 13 202 3.0E-23
sp|Q1GHF1|RLME_RUEST Ribosomal RNA large subunit methyltransferase E OS=Ruegeria sp. (strain TM1040) GN=rlmE PE=3 SV=1 13 202 3.0E-23
sp|P57463|RLME_BUCAI Ribosomal RNA large subunit methyltransferase E OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=rlmE PE=3 SV=1 4 196 3.0E-23
sp|A6TEJ8|RLME_KLEP7 Ribosomal RNA large subunit methyltransferase E OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=rlmE PE=3 SV=1 13 201 3.0E-23
sp|Q129M4|RLME_POLSJ Ribosomal RNA large subunit methyltransferase E OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=rlmE PE=3 SV=1 13 201 3.0E-23
sp|Q7MI01|RLME_VIBVY Ribosomal RNA large subunit methyltransferase E OS=Vibrio vulnificus (strain YJ016) GN=rlmE PE=3 SV=1 13 202 3.0E-23
sp|Q8DBW7|RLME_VIBVU Ribosomal RNA large subunit methyltransferase E OS=Vibrio vulnificus (strain CMCP6) GN=rlmE PE=3 SV=1 13 202 3.0E-23
sp|A9KZX9|RLME_SHEB9 Ribosomal RNA large subunit methyltransferase E OS=Shewanella baltica (strain OS195) GN=rlmE PE=3 SV=1 13 201 4.0E-23
sp|A6WRH7|RLME_SHEB8 Ribosomal RNA large subunit methyltransferase E OS=Shewanella baltica (strain OS185) GN=rlmE PE=3 SV=1 13 201 4.0E-23
sp|A3D7L4|RLME_SHEB5 Ribosomal RNA large subunit methyltransferase E OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=rlmE PE=3 SV=1 13 201 4.0E-23
sp|B8E6M4|RLME_SHEB2 Ribosomal RNA large subunit methyltransferase E OS=Shewanella baltica (strain OS223) GN=rlmE PE=3 SV=1 13 201 4.0E-23
sp|B1J262|RLME_PSEPW Ribosomal RNA large subunit methyltransferase E OS=Pseudomonas putida (strain W619) GN=rlmE PE=3 SV=1 13 202 4.0E-23
sp|B3PQL4|RLME_RHIE6 Ribosomal RNA large subunit methyltransferase E OS=Rhizobium etli (strain CIAT 652) GN=rlmE PE=3 SV=1 13 204 5.0E-23
sp|Q2GGT6|RLME_EHRCR Ribosomal RNA large subunit methyltransferase E OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=rlmE PE=3 SV=1 13 201 5.0E-23
sp|B2JFN9|RLME_BURP8 Ribosomal RNA large subunit methyltransferase E OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=rlmE PE=3 SV=1 13 204 5.0E-23
sp|A0KNF1|RLME_AERHH Ribosomal RNA large subunit methyltransferase E OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=rlmE PE=3 SV=1 13 201 5.0E-23
sp|A5WCU8|RLME_PSYWF Ribosomal RNA large subunit methyltransferase E OS=Psychrobacter sp. (strain PRwf-1) GN=rlmE PE=3 SV=1 13 197 5.0E-23
sp|Q88DV0|RLME_PSEPK Ribosomal RNA large subunit methyltransferase E OS=Pseudomonas putida (strain KT2440) GN=rlmE PE=3 SV=1 13 202 6.0E-23
sp|A5W995|RLME_PSEP1 Ribosomal RNA large subunit methyltransferase E OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=rlmE PE=3 SV=1 13 202 6.0E-23
sp|Q5GS59|RLME_WOLTR Ribosomal RNA large subunit methyltransferase E OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=rlmE PE=3 SV=1 13 200 6.0E-23
sp|A0LC14|RLME_MAGMM Ribosomal RNA large subunit methyltransferase E OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=rlmE PE=3 SV=1 13 202 7.0E-23
sp|B0KHY6|RLME_PSEPG Ribosomal RNA large subunit methyltransferase E OS=Pseudomonas putida (strain GB-1) GN=rlmE PE=3 SV=1 13 202 7.0E-23
sp|A9MP28|RLME_SALAR Ribosomal RNA large subunit methyltransferase E OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=rlmE PE=3 SV=1 13 199 7.0E-23
sp|Q8ZLS7|RLME_SALTY Ribosomal RNA large subunit methyltransferase E OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rlmE PE=3 SV=1 13 199 8.0E-23
sp|B4TWE7|RLME_SALSV Ribosomal RNA large subunit methyltransferase E OS=Salmonella schwarzengrund (strain CVM19633) GN=rlmE PE=3 SV=1 13 199 8.0E-23
sp|A9N744|RLME_SALPB Ribosomal RNA large subunit methyltransferase E OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=rlmE PE=3 SV=1 13 199 8.0E-23
sp|B4T708|RLME_SALNS Ribosomal RNA large subunit methyltransferase E OS=Salmonella newport (strain SL254) GN=rlmE PE=3 SV=1 13 199 8.0E-23
sp|B4TJ16|RLME_SALHS Ribosomal RNA large subunit methyltransferase E OS=Salmonella heidelberg (strain SL476) GN=rlmE PE=3 SV=1 13 199 8.0E-23
sp|B5REP5|RLME_SALG2 Ribosomal RNA large subunit methyltransferase E OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=rlmE PE=3 SV=1 13 199 8.0E-23
sp|B5R0H0|RLME_SALEP Ribosomal RNA large subunit methyltransferase E OS=Salmonella enteritidis PT4 (strain P125109) GN=rlmE PE=3 SV=1 13 199 8.0E-23
sp|B5FI23|RLME_SALDC Ribosomal RNA large subunit methyltransferase E OS=Salmonella dublin (strain CT_02021853) GN=rlmE PE=3 SV=1 13 199 8.0E-23
sp|B5F6U7|RLME_SALA4 Ribosomal RNA large subunit methyltransferase E OS=Salmonella agona (strain SL483) GN=rlmE PE=3 SV=1 13 199 8.0E-23
sp|Q3YX62|RLME_SHISS Ribosomal RNA large subunit methyltransferase E OS=Shigella sonnei (strain Ss046) GN=rlmE PE=3 SV=1 13 199 8.0E-23
sp|P0C0S0|RLME_SHIFL Ribosomal RNA large subunit methyltransferase E OS=Shigella flexneri GN=rlmE PE=3 SV=1 13 199 8.0E-23
sp|Q0T0A5|RLME_SHIF8 Ribosomal RNA large subunit methyltransferase E OS=Shigella flexneri serotype 5b (strain 8401) GN=rlmE PE=3 SV=1 13 199 8.0E-23
sp|Q31W56|RLME_SHIBS Ribosomal RNA large subunit methyltransferase E OS=Shigella boydii serotype 4 (strain Sb227) GN=rlmE PE=3 SV=1 13 199 8.0E-23
sp|B2U1Z8|RLME_SHIB3 Ribosomal RNA large subunit methyltransferase E OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=rlmE PE=3 SV=1 13 199 8.0E-23
sp|B7LR46|RLME_ESCF3 Ribosomal RNA large subunit methyltransferase E OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=rlmE PE=3 SV=1 13 199 8.0E-23
sp|Q1R6F9|RLME_ECOUT Ribosomal RNA large subunit methyltransferase E OS=Escherichia coli (strain UTI89 / UPEC) GN=rlmE PE=3 SV=1 13 199 8.0E-23
sp|B1LFS9|RLME_ECOSM Ribosomal RNA large subunit methyltransferase E OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=rlmE PE=3 SV=1 13 199 8.0E-23
sp|B6I1Q2|RLME_ECOSE Ribosomal RNA large subunit methyltransferase E OS=Escherichia coli (strain SE11) GN=rlmE PE=3 SV=1 13 199 8.0E-23
sp|B7NDG3|RLME_ECOLU Ribosomal RNA large subunit methyltransferase E OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=rlmE PE=3 SV=1 13 199 8.0E-23
sp|P0C0R7|RLME_ECOLI Ribosomal RNA large subunit methyltransferase E OS=Escherichia coli (strain K12) GN=rlmE PE=1 SV=1 13 199 8.0E-23
sp|B1IQU4|RLME_ECOLC Ribosomal RNA large subunit methyltransferase E OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rlmE PE=3 SV=1 13 199 8.0E-23
sp|P0C0R9|RLME_ECOL6 Ribosomal RNA large subunit methyltransferase E OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rlmE PE=3 SV=1 13 199 8.0E-23
sp|Q0TCT1|RLME_ECOL5 Ribosomal RNA large subunit methyltransferase E OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rlmE PE=3 SV=1 13 199 8.0E-23
sp|A1AG82|RLME_ECOK1 Ribosomal RNA large subunit methyltransferase E OS=Escherichia coli O1:K1 / APEC GN=rlmE PE=3 SV=1 13 199 8.0E-23
sp|A8A4Z3|RLME_ECOHS Ribosomal RNA large subunit methyltransferase E OS=Escherichia coli O9:H4 (strain HS) GN=rlmE PE=3 SV=1 13 199 8.0E-23
sp|B1XGY9|RLME_ECODH Ribosomal RNA large subunit methyltransferase E OS=Escherichia coli (strain K12 / DH10B) GN=rlmE PE=3 SV=1 13 199 8.0E-23
sp|C4ZSR8|RLME_ECOBW Ribosomal RNA large subunit methyltransferase E OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=rlmE PE=3 SV=1 13 199 8.0E-23
sp|B7M085|RLME_ECO8A Ribosomal RNA large subunit methyltransferase E OS=Escherichia coli O8 (strain IAI1) GN=rlmE PE=3 SV=1 13 199 8.0E-23
sp|B7N363|RLME_ECO81 Ribosomal RNA large subunit methyltransferase E OS=Escherichia coli O81 (strain ED1a) GN=rlmE PE=3 SV=1 13 199 8.0E-23
sp|B7NKP6|RLME_ECO7I Ribosomal RNA large subunit methyltransferase E OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=rlmE PE=3 SV=1 13 199 8.0E-23
sp|B5YS68|RLME_ECO5E Ribosomal RNA large subunit methyltransferase E OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=rlmE PE=3 SV=1 13 199 8.0E-23
sp|P0C0R8|RLME_ECO57 Ribosomal RNA large subunit methyltransferase E OS=Escherichia coli O157:H7 GN=rlmE PE=3 SV=1 13 199 8.0E-23
sp|B7LHP2|RLME_ECO55 Ribosomal RNA large subunit methyltransferase E OS=Escherichia coli (strain 55989 / EAEC) GN=rlmE PE=3 SV=1 13 199 8.0E-23
sp|B7MBU8|RLME_ECO45 Ribosomal RNA large subunit methyltransferase E OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=rlmE PE=3 SV=1 13 199 8.0E-23
sp|B7UJ72|RLME_ECO27 Ribosomal RNA large subunit methyltransferase E OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=rlmE PE=3 SV=1 13 199 8.0E-23
sp|A7ZS75|RLME_ECO24 Ribosomal RNA large subunit methyltransferase E OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=rlmE PE=3 SV=1 13 199 8.0E-23
sp|A8AQ68|RLME_CITK8 Ribosomal RNA large subunit methyltransferase E OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=rlmE PE=3 SV=1 13 199 8.0E-23
sp|C0PZ62|RLME_SALPC Ribosomal RNA large subunit methyltransferase E OS=Salmonella paratyphi C (strain RKS4594) GN=rlmE PE=3 SV=1 13 199 8.0E-23
sp|Q57JH1|RLME_SALCH Ribosomal RNA large subunit methyltransferase E OS=Salmonella choleraesuis (strain SC-B67) GN=rlmE PE=3 SV=1 13 199 8.0E-23
sp|Q1Q955|RLME_PSYCK Ribosomal RNA large subunit methyltransferase E OS=Psychrobacter cryohalolentis (strain K5) GN=rlmE PE=3 SV=1 13 197 9.0E-23
sp|Q11L51|RLME_CHESB Ribosomal RNA large subunit methyltransferase E OS=Chelativorans sp. (strain BNC1) GN=rlmE PE=3 SV=1 13 202 1.0E-22
sp|B5BGK3|RLME_SALPK Ribosomal RNA large subunit methyltransferase E OS=Salmonella paratyphi A (strain AKU_12601) GN=rlmE PE=3 SV=1 13 199 1.0E-22
sp|Q5PLC1|RLME_SALPA Ribosomal RNA large subunit methyltransferase E OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=rlmE PE=3 SV=1 13 199 1.0E-22
sp|Q4UKG2|RLME_RICFE Ribosomal RNA large subunit methyltransferase E OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=rlmE PE=3 SV=1 13 197 1.0E-22
sp|Q32BF4|RLME_SHIDS Ribosomal RNA large subunit methyltransferase E OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rlmE PE=3 SV=1 13 199 1.0E-22
sp|Q8Z3H3|RLME_SALTI Ribosomal RNA large subunit methyltransferase E OS=Salmonella typhi GN=rlmE PE=3 SV=1 13 199 1.0E-22
sp|Q1ML15|RLME_RHIL3 Ribosomal RNA large subunit methyltransferase E OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=rlmE PE=3 SV=1 13 204 1.0E-22
sp|Q2SUW0|RLME_BURTA Ribosomal RNA large subunit methyltransferase E OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=rlmE PE=3 SV=1 13 204 1.0E-22
sp|Q5QXK8|RLME_IDILO Ribosomal RNA large subunit methyltransferase E OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=rlmE PE=3 SV=1 13 201 1.0E-22
sp|C5BFB0|RLME_EDWI9 Ribosomal RNA large subunit methyltransferase E OS=Edwardsiella ictaluri (strain 93-146) GN=rlmE PE=3 SV=1 13 199 1.0E-22
sp|Q1D841|RLME_MYXXD Ribosomal RNA large subunit methyltransferase E OS=Myxococcus xanthus (strain DK 1622) GN=rlmE PE=3 SV=1 13 203 1.0E-22
sp|A4VNP3|RLME_PSEU5 Ribosomal RNA large subunit methyltransferase E OS=Pseudomonas stutzeri (strain A1501) GN=rlmE PE=3 SV=2 13 202 1.0E-22
sp|A7MIM8|RLME_CROS8 Ribosomal RNA large subunit methyltransferase E OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=rlmE PE=3 SV=2 13 199 2.0E-22
sp|A9BML0|RLME_DELAS Ribosomal RNA large subunit methyltransferase E OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=rlmE PE=3 SV=1 13 201 2.0E-22
sp|Q39HN2|RLME_BURL3 Ribosomal RNA large subunit methyltransferase E OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=rlmE PE=3 SV=1 13 204 2.0E-22
sp|B6JHM9|RLME_OLICO Ribosomal RNA large subunit methyltransferase E OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=rlmE PE=3 SV=1 13 202 2.0E-22
sp|Q4FQX1|RLME_PSYA2 Ribosomal RNA large subunit methyltransferase E OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=rlmE PE=3 SV=1 13 197 2.0E-22
sp|A1VC40|RLME_DESVV Ribosomal RNA large subunit methyltransferase E OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=rlmE PE=3 SV=1 13 202 2.0E-22
sp|Q729T9|RLME_DESVH Ribosomal RNA large subunit methyltransferase E OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=rlmE PE=3 SV=1 13 202 2.0E-22
sp|Q63V86|RLME_BURPS Ribosomal RNA large subunit methyltransferase E OS=Burkholderia pseudomallei (strain K96243) GN=rlmE PE=3 SV=1 13 204 2.0E-22
sp|A3N853|RLME_BURP6 Ribosomal RNA large subunit methyltransferase E OS=Burkholderia pseudomallei (strain 668) GN=rlmE PE=3 SV=1 13 204 2.0E-22
sp|Q3JTT5|RLME_BURP1 Ribosomal RNA large subunit methyltransferase E OS=Burkholderia pseudomallei (strain 1710b) GN=rlmE PE=3 SV=2 13 204 2.0E-22
sp|A3NTW3|RLME_BURP0 Ribosomal RNA large subunit methyltransferase E OS=Burkholderia pseudomallei (strain 1106a) GN=rlmE PE=3 SV=1 13 204 2.0E-22
sp|A1V319|RLME_BURMS Ribosomal RNA large subunit methyltransferase E OS=Burkholderia mallei (strain SAVP1) GN=rlmE PE=3 SV=2 13 204 2.0E-22
sp|Q62L80|RLME_BURMA Ribosomal RNA large subunit methyltransferase E OS=Burkholderia mallei (strain ATCC 23344) GN=rlmE PE=3 SV=1 13 204 2.0E-22
sp|A2S3Q7|RLME_BURM9 Ribosomal RNA large subunit methyltransferase E OS=Burkholderia mallei (strain NCTC 10229) GN=rlmE PE=3 SV=1 13 204 2.0E-22
sp|A3MIQ3|RLME_BURM7 Ribosomal RNA large subunit methyltransferase E OS=Burkholderia mallei (strain NCTC 10247) GN=rlmE PE=3 SV=1 13 204 2.0E-22
sp|B5ZR94|RLME_RHILW Ribosomal RNA large subunit methyltransferase E OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=rlmE PE=3 SV=1 13 204 2.0E-22
sp|Q8UHR0|RLME_AGRFC Ribosomal RNA large subunit methyltransferase E OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=rlmE PE=3 SV=2 13 208 2.0E-22
sp|Q2GKK2|RLME_ANAPZ Ribosomal RNA large subunit methyltransferase E OS=Anaplasma phagocytophilum (strain HZ) GN=rlmE PE=3 SV=1 13 202 3.0E-22
sp|Q3IE64|RLME_PSEHT Ribosomal RNA large subunit methyltransferase E OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=rlmE PE=3 SV=1 13 201 3.0E-22
sp|B5FA72|RLME_VIBFM Ribosomal RNA large subunit methyltransferase E OS=Vibrio fischeri (strain MJ11) GN=rlmE PE=3 SV=1 13 202 3.0E-22
sp|C6DKI3|RLME_PECCP Ribosomal RNA large subunit methyltransferase E OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=rlmE PE=3 SV=1 13 199 4.0E-22
sp|Q1QSY2|RLME_CHRSD Ribosomal RNA large subunit methyltransferase E OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=rlmE PE=3 SV=1 13 202 4.0E-22
sp|Q5E7M3|RLME_VIBF1 Ribosomal RNA large subunit methyltransferase E OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=rlmE PE=3 SV=1 13 202 4.0E-22
sp|B4E5F3|RLME_BURCJ Ribosomal RNA large subunit methyltransferase E OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=rlmE PE=3 SV=1 13 204 4.0E-22
sp|A0K6C1|RLME_BURCH Ribosomal RNA large subunit methyltransferase E OS=Burkholderia cenocepacia (strain HI2424) GN=rlmE PE=3 SV=1 13 204 4.0E-22
sp|B1JZE9|RLME_BURCC Ribosomal RNA large subunit methyltransferase E OS=Burkholderia cenocepacia (strain MC0-3) GN=rlmE PE=3 SV=1 13 204 4.0E-22
sp|Q1BXD0|RLME_BURCA Ribosomal RNA large subunit methyltransferase E OS=Burkholderia cenocepacia (strain AU 1054) GN=rlmE PE=3 SV=1 13 204 4.0E-22
sp|A8EXN1|RLME_RICCK Ribosomal RNA large subunit methyltransferase E OS=Rickettsia canadensis (strain McKiel) GN=rlmE PE=3 SV=1 13 197 5.0E-22
sp|C0QX75|RLME_BRAHW Ribosomal RNA large subunit methyltransferase E OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=rlmE PE=3 SV=1 13 201 5.0E-22
sp|A4WEZ0|RLME_ENT38 Ribosomal RNA large subunit methyltransferase E OS=Enterobacter sp. (strain 638) GN=rlmE PE=3 SV=1 13 199 5.0E-22
sp|A9ACL8|RLME_BURM1 Ribosomal RNA large subunit methyltransferase E OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=rlmE PE=3 SV=1 13 204 7.0E-22
sp|A4JDA6|RLME_BURVG Ribosomal RNA large subunit methyltransferase E OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=rlmE PE=3 SV=1 13 204 8.0E-22
sp|B1YMW2|RLME_BURA4 Ribosomal RNA large subunit methyltransferase E OS=Burkholderia ambifaria (strain MC40-6) GN=rlmE PE=3 SV=1 13 204 9.0E-22
sp|Q13W47|RLME_BURXL Ribosomal RNA large subunit methyltransferase E OS=Burkholderia xenovorans (strain LB400) GN=rlmE PE=3 SV=1 13 203 1.0E-21
sp|Q0BGJ2|RLME_BURCM Ribosomal RNA large subunit methyltransferase E OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=rlmE PE=3 SV=1 13 204 1.0E-21
sp|Q9A7V4|RLME_CAUCR Ribosomal RNA large subunit methyltransferase E OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=rlmE PE=3 SV=1 13 202 1.0E-21
sp|B2SZR9|RLME_BURPP Ribosomal RNA large subunit methyltransferase E OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=rlmE PE=3 SV=1 13 203 1.0E-21
sp|Q7MYY0|RLME_PHOLL Ribosomal RNA large subunit methyltransferase E OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=rlmE PE=3 SV=1 13 199 1.0E-21
sp|A7I848|RLME_METB6 Ribosomal RNA large subunit methyltransferase E OS=Methanoregula boonei (strain 6A8) GN=rlmE PE=3 SV=1 13 202 2.0E-21
sp|B1JMH7|RLME_YERPY Ribosomal RNA large subunit methyltransferase E OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=rlmE PE=3 SV=1 13 199 2.0E-21
sp|Q66F67|RLME_YERPS Ribosomal RNA large subunit methyltransferase E OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=rlmE PE=3 SV=1 13 199 2.0E-21
sp|A4TRJ0|RLME_YERPP Ribosomal RNA large subunit methyltransferase E OS=Yersinia pestis (strain Pestoides F) GN=rlmE PE=3 SV=1 13 199 2.0E-21
sp|Q1CEK6|RLME_YERPN Ribosomal RNA large subunit methyltransferase E OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=rlmE PE=3 SV=1 13 199 2.0E-21
sp|Q8ZBB5|RLME_YERPE Ribosomal RNA large subunit methyltransferase E OS=Yersinia pestis GN=rlmE PE=3 SV=1 13 199 2.0E-21
sp|B2K2P8|RLME_YERPB Ribosomal RNA large subunit methyltransferase E OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=rlmE PE=3 SV=1 13 199 2.0E-21
sp|Q1CC00|RLME_YERPA Ribosomal RNA large subunit methyltransferase E OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=rlmE PE=3 SV=1 13 199 2.0E-21
sp|A7FMS9|RLME_YERP3 Ribosomal RNA large subunit methyltransferase E OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=rlmE PE=3 SV=1 13 199 2.0E-21
sp|A0Q526|RLME_FRATN Ribosomal RNA large subunit methyltransferase E OS=Francisella tularensis subsp. novicida (strain U112) GN=rlmE PE=3 SV=1 13 202 3.0E-21
sp|A8G900|RLME_SERP5 Ribosomal RNA large subunit methyltransferase E OS=Serratia proteamaculans (strain 568) GN=rlmE PE=3 SV=1 13 199 3.0E-21
sp|A4YSS3|RLME_BRASO Ribosomal RNA large subunit methyltransferase E OS=Bradyrhizobium sp. (strain ORS278) GN=rlmE PE=3 SV=1 13 207 3.0E-21
sp|A5CX75|RLME_VESOH Ribosomal RNA large subunit methyltransferase E OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=rlmE PE=3 SV=1 13 204 3.0E-21
sp|Q983F8|RLME_RHILO Ribosomal RNA large subunit methyltransferase E OS=Rhizobium loti (strain MAFF303099) GN=rlmE PE=3 SV=1 13 202 4.0E-21
sp|B9J9U0|RLME_AGRRK Ribosomal RNA large subunit methyltransferase E OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=rlmE PE=3 SV=1 13 202 4.0E-21
sp|Q8XZ79|RLME_RALSO Ribosomal RNA large subunit methyltransferase E OS=Ralstonia solanacearum (strain GMI1000) GN=rlmE PE=3 SV=1 13 203 4.0E-21
sp|A4IYP4|RLME_FRATW Ribosomal RNA large subunit methyltransferase E OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=rlmE PE=3 SV=1 13 202 5.0E-21
sp|Q5NGD3|RLME_FRATT Ribosomal RNA large subunit methyltransferase E OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=rlmE PE=3 SV=1 13 202 5.0E-21
sp|B2SF85|RLME_FRATM Ribosomal RNA large subunit methyltransferase E OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=rlmE PE=3 SV=1 13 202 5.0E-21
sp|Q14HT5|RLME_FRAT1 Ribosomal RNA large subunit methyltransferase E OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=rlmE PE=3 SV=1 13 202 5.0E-21
sp|B6END5|RLME_ALISL Ribosomal RNA large subunit methyltransferase E OS=Aliivibrio salmonicida (strain LFI1238) GN=rlmE PE=3 SV=1 13 202 6.0E-21
sp|Q5P1G0|RLME_AROAE Ribosomal RNA large subunit methyltransferase E OS=Aromatoleum aromaticum (strain EbN1) GN=rlmE PE=3 SV=1 13 202 6.0E-21
sp|Q28QW4|RLME_JANSC Ribosomal RNA large subunit methyltransferase E OS=Jannaschia sp. (strain CCS1) GN=rlmE PE=3 SV=1 13 202 6.0E-21
sp|A8GMD3|RLME_RICAH Ribosomal RNA large subunit methyltransferase E OS=Rickettsia akari (strain Hartford) GN=rlmE PE=3 SV=1 13 196 7.0E-21
sp|Q6D9B9|RLME_PECAS Ribosomal RNA large subunit methyltransferase E OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=rlmE PE=3 SV=1 13 199 8.0E-21
sp|A5EHP2|RLME_BRASB Ribosomal RNA large subunit methyltransferase E OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=rlmE PE=3 SV=1 13 202 1.0E-20
sp|Q820A2|RLME_NITEU Ribosomal RNA large subunit methyltransferase E OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=rlmE PE=3 SV=1 13 196 1.0E-20
sp|Q2IPT3|RLME_ANADE Ribosomal RNA large subunit methyltransferase E OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=rlmE PE=3 SV=1 13 202 1.0E-20
sp|Q15VJ6|RLME_PSEA6 Ribosomal RNA large subunit methyltransferase E OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=rlmE PE=3 SV=1 13 201 1.0E-20
sp|A4SXL6|RLME_POLSQ Ribosomal RNA large subunit methyltransferase E OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=rlmE PE=3 SV=1 13 204 1.0E-20
sp|Q0BNB8|RLME_FRATO Ribosomal RNA large subunit methyltransferase E OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=rlmE PE=3 SV=1 13 202 1.0E-20
sp|Q2A4Z7|RLME_FRATH Ribosomal RNA large subunit methyltransferase E OS=Francisella tularensis subsp. holarctica (strain LVS) GN=rlmE PE=3 SV=1 13 202 1.0E-20
sp|A7NAC9|RLME_FRATF Ribosomal RNA large subunit methyltransferase E OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=rlmE PE=3 SV=1 13 202 1.0E-20
sp|Q7VQM8|RLME_BLOFL Ribosomal RNA large subunit methyltransferase E OS=Blochmannia floridanus GN=rlmE PE=3 SV=1 12 207 1.0E-20
sp|B8FL12|RLME_DESAA Ribosomal RNA large subunit methyltransferase E OS=Desulfatibacillum alkenivorans (strain AK-01) GN=rlmE PE=3 SV=1 5 196 1.0E-20
sp|A1AW32|RLME_RUTMC Ribosomal RNA large subunit methyltransferase E OS=Ruthia magnifica subsp. Calyptogena magnifica GN=rlmE PE=3 SV=1 13 201 1.0E-20
sp|Q89AF1|RLME_BUCBP Ribosomal RNA large subunit methyltransferase E OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=rlmE PE=3 SV=1 25 201 2.0E-20
sp|A1JIW2|RLME_YERE8 Ribosomal RNA large subunit methyltransferase E OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=rlmE PE=3 SV=1 13 199 2.0E-20
sp|Q1MRQ0|RLME_LAWIP Ribosomal RNA large subunit methyltransferase E OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=rlmE PE=3 SV=1 13 201 2.0E-20
sp|B2VGT0|RLME_ERWT9 Ribosomal RNA large subunit methyltransferase E OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=rlmE PE=3 SV=1 13 199 3.0E-20
sp|Q0K8Y4|RLME_CUPNH Ribosomal RNA large subunit methyltransferase E OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=rlmE PE=3 SV=1 13 202 3.0E-20
sp|A3CVJ3|RLME_METMJ Ribosomal RNA large subunit methyltransferase E OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=rlmE PE=3 SV=1 13 202 3.0E-20
sp|Q0AHC6|RLME_NITEC Ribosomal RNA large subunit methyltransferase E OS=Nitrosomonas eutropha (strain C91) GN=rlmE PE=3 SV=1 13 196 3.0E-20
sp|Q2NW30|RLME_SODGM Ribosomal RNA large subunit methyltransferase E OS=Sodalis glossinidius (strain morsitans) GN=rlmE PE=3 SV=1 13 199 3.0E-20
sp|A8II77|RLME_AZOC5 Ribosomal RNA large subunit methyltransferase E OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=rlmE PE=3 SV=1 13 202 5.0E-20
sp|B3QFD2|RLME_RHOPT Ribosomal RNA large subunit methyltransferase E OS=Rhodopseudomonas palustris (strain TIE-1) GN=rlmE PE=3 SV=1 13 202 5.0E-20
sp|Q6N7Q9|RLME_RHOPA Ribosomal RNA large subunit methyltransferase E OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=rlmE PE=3 SV=1 13 202 5.0E-20
sp|Q07LH9|RLME_RHOP5 Ribosomal RNA large subunit methyltransferase E OS=Rhodopseudomonas palustris (strain BisA53) GN=rlmE PE=3 SV=1 13 203 5.0E-20
sp|A2SF90|RLME_METPP Ribosomal RNA large subunit methyltransferase E OS=Methylibium petroleiphilum (strain PM1) GN=rlmE PE=3 SV=1 13 202 5.0E-20
sp|C6C068|RLME_DESAD Ribosomal RNA large subunit methyltransferase E OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=rlmE PE=3 SV=1 13 202 5.0E-20
sp|B2UGQ0|RLME_RALPJ Ribosomal RNA large subunit methyltransferase E OS=Ralstonia pickettii (strain 12J) GN=rlmE PE=3 SV=1 13 203 7.0E-20
sp|C4K7K8|RLME_HAMD5 Ribosomal RNA large subunit methyltransferase E OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=rlmE PE=3 SV=1 13 201 8.0E-20
sp|Q212R3|RLME_RHOPB Ribosomal RNA large subunit methyltransferase E OS=Rhodopseudomonas palustris (strain BisB18) GN=rlmE PE=3 SV=1 13 202 8.0E-20
sp|B3R1S2|RLME_CUPTR Ribosomal RNA large subunit methyltransferase E OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=rlmE PE=3 SV=1 13 201 1.0E-19
sp|Q2RXU5|RLME_RHORT Ribosomal RNA large subunit methyltransferase E OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=rlmE PE=3 SV=1 13 202 1.0E-19
sp|Q3SQN7|RLME_NITWN Ribosomal RNA large subunit methyltransferase E OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=rlmE PE=3 SV=1 13 205 1.0E-19
sp|Q1LLA8|RLME_CUPMC Ribosomal RNA large subunit methyltransferase E OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=rlmE PE=3 SV=1 13 202 2.0E-19
sp|Q97C13|RLME_THEVO Ribosomal RNA large subunit methyltransferase E OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=rlmE PE=1 SV=1 11 203 2.0E-19
sp|Q9HIH4|RLME_THEAC Ribosomal RNA large subunit methyltransferase E OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rlmE PE=3 SV=1 13 202 2.0E-19
sp|A9FQE4|RLME_SORC5 Ribosomal RNA large subunit methyltransferase E OS=Sorangium cellulosum (strain So ce56) GN=rlmE PE=3 SV=1 11 196 3.0E-19
sp|B8GG79|RLME_METPE Ribosomal RNA large subunit methyltransferase E OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=rlmE PE=3 SV=1 13 200 3.0E-19
sp|Q1QKB6|RLME_NITHX Ribosomal RNA large subunit methyltransferase E OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=rlmE PE=3 SV=1 13 202 4.0E-19
sp|A7H9A5|RLME_ANADF Ribosomal RNA large subunit methyltransferase E OS=Anaeromyxobacter sp. (strain Fw109-5) GN=rlmE PE=3 SV=1 13 200 4.0E-19
sp|C3PMK3|RLME_RICAE Ribosomal RNA large subunit methyltransferase E OS=Rickettsia africae (strain ESF-5) GN=rlmE PE=3 SV=1 13 197 4.0E-19
sp|B8DNJ4|RLME_DESVM Ribosomal RNA large subunit methyltransferase E OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=rlmE PE=3 SV=1 13 202 5.0E-19
sp|Q8P9Y1|RLME_XANCP Ribosomal RNA large subunit methyltransferase E OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=rlmE PE=3 SV=2 13 202 6.0E-19
sp|B0RTZ3|RLME_XANCB Ribosomal RNA large subunit methyltransferase E OS=Xanthomonas campestris pv. campestris (strain B100) GN=rlmE PE=3 SV=1 13 202 6.0E-19
sp|Q4UTQ4|RLME_XANC8 Ribosomal RNA large subunit methyltransferase E OS=Xanthomonas campestris pv. campestris (strain 8004) GN=rlmE PE=3 SV=2 13 202 6.0E-19
sp|Q47YJ3|RLME_COLP3 Ribosomal RNA large subunit methyltransferase E OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=rlmE PE=3 SV=1 13 202 7.0E-19
sp|Q46Z98|RLME_CUPPJ Ribosomal RNA large subunit methyltransferase E OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=rlmE PE=3 SV=1 13 201 9.0E-19
sp|Q9CNJ3|RLME_PASMU Ribosomal RNA large subunit methyltransferase E OS=Pasteurella multocida (strain Pm70) GN=rlmE PE=3 SV=1 13 202 1.0E-18
sp|Q89N72|RLME_BRADU Ribosomal RNA large subunit methyltransferase E OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=rlmE PE=3 SV=1 13 202 2.0E-18
sp|A5EXB6|RLME_DICNV Ribosomal RNA large subunit methyltransferase E OS=Dichelobacter nodosus (strain VCS1703A) GN=rlmE PE=3 SV=1 19 200 2.0E-18
sp|Q9VDT6|MRM2_DROME rRNA methyltransferase 2, mitochondrial OS=Drosophila melanogaster GN=CG11447 PE=2 SV=1 13 202 2.0E-18
sp|A6VPC2|RLME_ACTSZ Ribosomal RNA large subunit methyltransferase E OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=rlmE PE=3 SV=1 13 201 2.0E-18
sp|A6T081|RLME_JANMA Ribosomal RNA large subunit methyltransferase E OS=Janthinobacterium sp. (strain Marseille) GN=rlmE PE=3 SV=1 13 203 2.0E-18
sp|Q92J64|RLME_RICCN Ribosomal RNA large subunit methyltransferase E OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=rlmE PE=3 SV=1 13 197 3.0E-18
sp|Q6L1E2|RLME_PICTO Ribosomal RNA large subunit methyltransferase E OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=rlmE PE=3 SV=1 11 196 3.0E-18
sp|Q8K9G7|RLME_BUCAP Ribosomal RNA large subunit methyltransferase E OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=rlmE PE=3 SV=1 13 196 3.0E-18
sp|A8GQZ0|RLME_RICRS Ribosomal RNA large subunit methyltransferase E OS=Rickettsia rickettsii (strain Sheila Smith) GN=rlmE PE=3 SV=1 13 197 4.0E-18
sp|B0BWD8|RLME_RICRO Ribosomal RNA large subunit methyltransferase E OS=Rickettsia rickettsii (strain Iowa) GN=rlmE PE=3 SV=1 13 197 4.0E-18
sp|Q65TZ0|RLME_MANSM Ribosomal RNA large subunit methyltransferase E OS=Mannheimia succiniciproducens (strain MBEL55E) GN=rlmE PE=3 SV=1 13 202 4.0E-18
sp|Q9CPY0|MRM2_MOUSE rRNA methyltransferase 2, mitochondrial OS=Mus musculus GN=Ftsj2 PE=1 SV=1 13 205 4.0E-18
sp|Q9ZE00|RLME_RICPR Ribosomal RNA large subunit methyltransferase E OS=Rickettsia prowazekii (strain Madrid E) GN=rlmE PE=3 SV=1 13 196 4.0E-18
sp|Q68XK5|RLME_RICTY Ribosomal RNA large subunit methyltransferase E OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=rlmE PE=3 SV=1 13 196 4.0E-18
sp|B8F4C0|RLME_HAEPS Ribosomal RNA large subunit methyltransferase E OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=rlmE PE=3 SV=1 13 202 5.0E-18
sp|C4K0Q4|RLME_RICPU Ribosomal RNA large subunit methyltransferase E OS=Rickettsia peacockii (strain Rustic) GN=rlmE PE=3 SV=1 13 197 6.0E-18
sp|Q31HG6|RLME_THICR Ribosomal RNA large subunit methyltransferase E OS=Thiomicrospira crunogena (strain XCL-2) GN=rlmE PE=3 SV=1 13 202 6.0E-18
sp|B0BUF3|RLME_ACTPJ Ribosomal RNA large subunit methyltransferase E OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=rlmE PE=3 SV=1 13 202 6.0E-18
sp|B3H123|RLME_ACTP7 Ribosomal RNA large subunit methyltransferase E OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=rlmE PE=3 SV=1 13 202 6.0E-18
sp|A3MZW0|RLME_ACTP2 Ribosomal RNA large subunit methyltransferase E OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=rlmE PE=3 SV=1 13 202 6.0E-18
sp|B2S3S1|RLME_TREPS Ribosomal RNA large subunit methyltransferase E OS=Treponema pallidum subsp. pallidum (strain SS14) GN=rlmE PE=3 SV=1 11 202 7.0E-18
sp|O83687|RLME_TREPA Ribosomal RNA large subunit methyltransferase E OS=Treponema pallidum (strain Nichols) GN=rlmE PE=3 SV=1 11 202 7.0E-18
sp|A5IHX0|RLME_LEGPC Ribosomal RNA large subunit methyltransferase E OS=Legionella pneumophila (strain Corby) GN=rlmE PE=3 SV=2 13 200 9.0E-18
sp|Q5ZRT1|RLME_LEGPH Ribosomal RNA large subunit methyltransferase E OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=rlmE PE=3 SV=2 13 200 1.0E-17
sp|Q5X1A0|RLME_LEGPA Ribosomal RNA large subunit methyltransferase E OS=Legionella pneumophila (strain Paris) GN=rlmE PE=3 SV=1 13 200 1.0E-17
sp|Q4QKJ2|RLME_HAEI8 Ribosomal RNA large subunit methyltransferase E OS=Haemophilus influenzae (strain 86-028NP) GN=rlmE PE=3 SV=1 13 202 1.0E-17
sp|C0QGP2|RLME_DESAH Ribosomal RNA large subunit methyltransferase E OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=rlmE PE=3 SV=1 13 199 1.0E-17
sp|B5ENR5|RLME_ACIF5 Ribosomal RNA large subunit methyltransferase E OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=rlmE PE=3 SV=1 5 207 2.0E-17
sp|B7J8G6|RLME_ACIF2 Ribosomal RNA large subunit methyltransferase E OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=rlmE PE=3 SV=1 5 207 2.0E-17
sp|Q87F66|RLME_XYLFT Ribosomal RNA large subunit methyltransferase E OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=rlmE PE=3 SV=1 13 199 2.0E-17
sp|B2I696|RLME_XYLF2 Ribosomal RNA large subunit methyltransferase E OS=Xylella fastidiosa (strain M23) GN=rlmE PE=3 SV=1 13 199 2.0E-17
sp|B4SRA0|RLME_STRM5 Ribosomal RNA large subunit methyltransferase E OS=Stenotrophomonas maltophilia (strain R551-3) GN=rlmE PE=3 SV=1 13 202 2.0E-17
sp|B2FKA1|RLME_STRMK Ribosomal RNA large subunit methyltransferase E OS=Stenotrophomonas maltophilia (strain K279a) GN=rlmE PE=3 SV=1 13 202 2.0E-17
sp|Q5WT13|RLME_LEGPL Ribosomal RNA large subunit methyltransferase E OS=Legionella pneumophila (strain Lens) GN=rlmE PE=3 SV=1 13 200 2.0E-17
sp|Q0I2R1|RLME_HAES1 Ribosomal RNA large subunit methyltransferase E OS=Haemophilus somnus (strain 129Pt) GN=rlmE PE=3 SV=1 13 200 4.0E-17
sp|P45162|RLME_HAEIN Ribosomal RNA large subunit methyltransferase E OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rlmE PE=3 SV=1 13 202 6.0E-17
sp|B0U1F2|RLME_XYLFM Ribosomal RNA large subunit methyltransferase E OS=Xylella fastidiosa (strain M12) GN=rlmE PE=3 SV=1 13 199 7.0E-17
sp|Q9PH52|RLME_XYLFA Ribosomal RNA large subunit methyltransferase E OS=Xylella fastidiosa (strain 9a5c) GN=rlmE PE=3 SV=1 13 199 7.0E-17
sp|P78860|MRM2_SCHPO rRNA methyltransferase 2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrm2 PE=2 SV=2 13 197 8.0E-17
sp|A4G4B0|RLME_HERAR Ribosomal RNA large subunit methyltransferase E OS=Herminiimonas arsenicoxydans GN=rlmE PE=3 SV=1 13 203 8.0E-17
sp|Q7VLF2|RLME_HAEDU Ribosomal RNA large subunit methyltransferase E OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=rlmE PE=3 SV=1 13 202 1.0E-16
sp|Q5GYL7|RLME_XANOR Ribosomal RNA large subunit methyltransferase E OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=rlmE PE=3 SV=2 13 199 1.0E-16
sp|B2SUB8|RLME_XANOP Ribosomal RNA large subunit methyltransferase E OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=rlmE PE=3 SV=1 13 199 1.0E-16
sp|Q2P1M0|RLME_XANOM Ribosomal RNA large subunit methyltransferase E OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=rlmE PE=3 SV=1 13 199 1.0E-16
sp|Q3BUR8|RLME_XANC5 Ribosomal RNA large subunit methyltransferase E OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=rlmE PE=3 SV=1 13 199 2.0E-16
sp|Q8PLQ8|RLME_XANAC Ribosomal RNA large subunit methyltransferase E OS=Xanthomonas axonopodis pv. citri (strain 306) GN=rlmE PE=3 SV=1 13 199 2.0E-16
sp|Q6AJ42|RLME_DESPS Ribosomal RNA large subunit methyltransferase E OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=rlmE PE=3 SV=1 13 205 2.0E-16
sp|Q9UI43|MRM2_HUMAN rRNA methyltransferase 2, mitochondrial OS=Homo sapiens GN=FTSJ2 PE=1 SV=1 13 204 2.0E-16
sp|Q3YRW8|RLME_EHRCJ Ribosomal RNA large subunit methyltransferase E OS=Ehrlichia canis (strain Jake) GN=rlmE PE=3 SV=1 35 201 3.0E-16
sp|B5RRD2|RLME_BORRA Ribosomal RNA large subunit methyltransferase E OS=Borrelia recurrentis (strain A1) GN=rlmE PE=3 SV=1 12 200 3.0E-16
sp|B5RLD9|RLME_BORDL Ribosomal RNA large subunit methyltransferase E OS=Borrelia duttonii (strain Ly) GN=rlmE PE=3 SV=1 12 200 3.0E-16
sp|Q73L97|RLME_TREDE Ribosomal RNA large subunit methyltransferase E OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=rlmE PE=3 SV=1 13 202 3.0E-15
sp|Q057J5|RLME_BUCCC Ribosomal RNA large subunit methyltransferase E OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=rlmE PE=3 SV=1 13 201 4.0E-15
sp|Q493U3|RLME_BLOPB Ribosomal RNA large subunit methyltransferase E OS=Blochmannia pennsylvanicus (strain BPEN) GN=rlmE PE=3 SV=1 5 198 5.0E-15
sp|Q8D2X0|RLME_WIGBR Ribosomal RNA large subunit methyltransferase E OS=Wigglesworthia glossinidia brevipalpis GN=rlmE PE=3 SV=1 13 201 1.0E-14
sp|Q8KTR0|RLME_TREPR Ribosomal RNA large subunit methyltransferase E OS=Tremblaya princeps GN=rlmE PE=3 SV=1 10 199 6.0E-14
sp|A8ZT18|RLME_DESOH Ribosomal RNA large subunit methyltransferase E OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=rlmE PE=3 SV=1 8 200 1.0E-12
sp|P53123|MRM2_YEAST rRNA methyltransferase 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRM2 PE=1 SV=1 13 106 2.0E-12
sp|Q0SNJ8|RLME_BORAP Ribosomal RNA large subunit methyltransferase E OS=Borrelia afzelii (strain PKo) GN=rlmE PE=3 SV=1 13 200 9.0E-12
sp|Q661V2|RLME_BORBP Ribosomal RNA large subunit methyltransferase E OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=rlmE PE=3 SV=1 13 200 2.0E-11
sp|B7J1P0|RLME_BORBZ Ribosomal RNA large subunit methyltransferase E OS=Borrelia burgdorferi (strain ZS7) GN=rlmE PE=3 SV=1 13 200 4.0E-11
sp|O51293|RLME_BORBU Ribosomal RNA large subunit methyltransferase E OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=rlmE PE=3 SV=2 13 200 7.0E-11
sp|Q5FEH6|RLME_EHRRW Ribosomal RNA large subunit methyltransferase E OS=Ehrlichia ruminantium (strain Welgevonden) GN=rlmE PE=3 SV=1 77 201 2.0E-06
sp|Q5FH15|RLME_EHRRG Ribosomal RNA large subunit methyltransferase E OS=Ehrlichia ruminantium (strain Gardel) GN=rlmE PE=3 SV=1 77 201 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005634 nucleus Yes
GO:0008168 methyltransferase activity Yes
GO:0006364 rRNA processing Yes
GO:0032259 methylation Yes
GO:0034641 cellular nitrogen compound metabolic process No
GO:0003824 catalytic activity No
GO:0110165 cellular anatomical entity No
GO:1901360 organic cyclic compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0043226 organelle No
GO:0090304 nucleic acid metabolic process No
GO:0006396 RNA processing No
GO:0003674 molecular_function No
GO:0008150 biological_process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0005575 cellular_component No
GO:0043170 macromolecule metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0034470 ncRNA processing No
GO:0043227 membrane-bounded organelle No
GO:0016072 rRNA metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0044238 primary metabolic process No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0043231 intracellular membrane-bounded organelle No
GO:0016740 transferase activity No
GO:0046483 heterocycle metabolic process No
GO:0034660 ncRNA metabolic process No
GO:0016070 RNA metabolic process No
GO:0043229 intracellular organelle No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 64 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3746
MAIQKKHGKGRLDKWYKLAKEKGYRARAAFKLIQLNKKYGFLEKSKVLLDLCAAPGSWCQVAAEVMPINSLIVGV
DLSPIKPIPKVITFQSDITTEKCRATIRQHFKTWKADTVLHDGAPNVGTAWVQDSFNQAELSLQAMKLATEFLIE
GGTFVTKVFRSKDYNPFLWVLNQLFTKVEATKPPSSRNVSAEIFVVCRGFKAPKRIDPRFLDPKSVFAELSGATP
NNEAKVFNPEAKKRKREGYDEGDYTQFKQVPASEFIQTTDPIAILGTCNKLSFEQGLDDDVALAALNRLPETTPE
IRTCCQDLKVLGRKDFKLLLKWRLRAREIFGFSKKEEEEDETQEVADVEPMDEELKIQEELQSLKDKETSKKKRE
RRRENERKQREIVRMQLNMVAPMDIGMEESATGGDRAMFSIKTVDKTNAMTRLSRGKMAMLTVKEKQQEADLVTP
GEEADDHSQEDGDGDQLERDLDSMYESYRERKAEADAKYRAKKARQEHEDDDEWEGLSASEQSSDHSDSSELDED
DDSSNEDDQEPPSCLLRDLDGSVPTTNGLSRRAAAFFSQEIFQELAPLVSEPEEGKVAKEPSSEISSRQKKSDRA
SESIIAKSDAKSQRSLNLEDDEDQKDFEVVKHAEDDDWENVVRRRPDAQLDIDIVTAEAMTLAHQLATGQKTMHD
AKDDGYNKHAFRDRDGLPEWFLDDETKHDKPLKPITKCAAQAIKDKLRAFNARPIKKVREAKARKKFKEAQKLEK
LKKKSDMLANDEGMTEKEKAESIQRLLRQASRKKPSQAAKLVVARGLNRGIQGRPKGVKGRYRMVDPRMKKELRA
QKRISQRKKR*
Coding >OphauB2|3746
ATGGCCATCCAGAAGAAGCACGGCAAAGGCCGTCTAGACAAGTGGTACAAGCTTGCCAAAGAAAAGGGCTACCGT
GCCAGAGCCGCCTTCAAATTAATCCAGCTTAACAAAAAGTATGGCTTCTTGGAGAAGAGCAAGGTCTTACTGGAT
CTTTGCGCCGCGCCAGGGTCTTGGTGTCAGGTGGCGGCAGAAGTCATGCCCATCAACAGCCTCATCGTCGGCGTC
GACTTGTCCCCAATAAAACCAATTCCAAAAGTTATCACCTTCCAGAGCGATATTACAACGGAAAAGTGTCGCGCC
ACCATCCGCCAACATTTCAAGACATGGAAGGCCGATACCGTCTTGCACGATGGTGCCCCCAATGTTGGTACCGCT
TGGGTACAAGACTCGTTCAACCAGGCAGAGCTCTCTCTACAGGCCATGAAGCTGGCAACCGAGTTCCTGATTGAA
GGGGGCACTTTTGTCACCAAAGTTTTCCGCTCAAAAGACTACAACCCCTTTCTTTGGGTCTTGAATCAGCTCTTC
ACCAAAGTCGAAGCCACCAAGCCACCATCCTCAAGAAACGTCTCTGCAGAAATCTTCGTCGTCTGTAGAGGCTTC
AAGGCCCCAAAACGCATTGATCCTCGTTTTCTGGACCCGAAATCTGTCTTTGCTGAGCTTTCAGGCGCAACGCCC
AACAACGAGGCCAAAGTGTTCAATCCAGAGGCCAAGAAACGTAAACGTGAGGGTTACGATGAAGGCGACTATACG
CAGTTCAAGCAAGTGCCAGCCAGCGAATTCATCCAGACGACAGATCCCATTGCCATCCTAGGCACTTGCAATAAA
CTCAGTTTTGAGCAAGGACTAGATGACGACGTCGCTTTGGCTGCACTCAACAGGCTTCCTGAAACGACACCCGAA
ATTCGAACATGTTGCCAAGACCTCAAGGTGTTGGGCCGCAAAGACTTCAAACTTCTACTTAAATGGCGATTAAGA
GCAAGGGAAATCTTTGGTTTCTCCAAAAAAGAGGAAGAAGAGGACGAGACGCAAGAAGTAGCTGATGTGGAGCCA
ATGGACGAAGAACTCAAGATTCAAGAAGAGCTGCAGAGCCTCAAAGACAAGGAAACTTCGAAAAAGAAGCGCGAA
AGACGTAGAGAGAACGAGCGCAAACAACGAGAAATCGTCCGCATGCAGCTCAACATGGTTGCTCCCATGGACATT
GGTATGGAAGAGTCGGCCACAGGCGGAGACAGAGCCATGTTTTCAATCAAAACTGTCGACAAGACGAATGCCATG
ACCCGCCTCTCGCGCGGCAAAATGGCCATGTTGACCGTCAAAGAGAAGCAGCAAGAAGCCGATTTGGTAACCCCA
GGAGAAGAAGCCGACGACCATAGTCAAGAAGATGGCGACGGAGATCAATTGGAACGAGACCTCGATTCCATGTAC
GAGAGCTACCGCGAACGCAAAGCCGAAGCCGATGCCAAATATCGTGCCAAAAAGGCAAGACAGGAACATGAAGAC
GACGACGAGTGGGAGGGGCTCTCAGCCAGTGAGCAATCTTCTGATCACAGTGACTCCAGCGAGTTGGACGAGGAT
GACGACTCTTCGAACGAGGATGATCAAGAACCTCCAAGTTGTTTATTAAGAGACCTCGATGGTTCGGTACCAACA
ACCAATGGCTTGTCCAGGCGAGCGGCGGCATTTTTCAGCCAGGAAATCTTTCAAGAACTTGCTCCTCTTGTCTCC
GAACCAGAAGAAGGCAAGGTTGCGAAAGAACCAAGTAGCGAAATCTCATCAAGACAAAAAAAATCCGACAGAGCT
AGCGAATCTATCATAGCCAAATCGGACGCAAAGTCTCAACGTTCATTGAATTTGGAGGATGACGAGGATCAAAAA
GATTTCGAGGTGGTCAAGCATGCAGAGGACGACGATTGGGAAAATGTGGTTCGTCGGCGTCCTGATGCCCAGCTG
GACATCGACATAGTCACAGCAGAAGCCATGACCCTAGCGCATCAGCTGGCCACAGGGCAAAAGACTATGCACGAT
GCAAAAGACGACGGATACAACAAGCACGCTTTCCGGGACCGTGATGGGCTACCAGAGTGGTTTCTCGATGACGAG
ACAAAGCATGATAAGCCACTGAAGCCCATTACAAAATGTGCGGCGCAGGCAATCAAGGATAAGTTGCGAGCGTTC
AACGCACGCCCCATCAAAAAGGTGCGCGAAGCCAAGGCGCGAAAGAAGTTCAAGGAGGCGCAAAAACTGGAAAAG
CTCAAGAAGAAGTCGGATATGCTGGCAAATGATGAGGGCATGACGGAAAAAGAAAAGGCTGAGAGCATACAAAGG
CTACTAAGACAGGCCAGCCGCAAGAAGCCGTCACAAGCAGCCAAGTTGGTGGTGGCACGGGGTCTCAATAGGGGC
ATCCAGGGCAGGCCAAAAGGAGTCAAGGGACGGTACCGTATGGTGGATCCTAGGATGAAGAAGGAGCTGAGAGCG
CAGAAACGGATATCTCAGCGCAAGAAGAGGTAA
Transcript >OphauB2|3746
ATGGCCATCCAGAAGAAGCACGGCAAAGGCCGTCTAGACAAGTGGTACAAGCTTGCCAAAGAAAAGGGCTACCGT
GCCAGAGCCGCCTTCAAATTAATCCAGCTTAACAAAAAGTATGGCTTCTTGGAGAAGAGCAAGGTCTTACTGGAT
CTTTGCGCCGCGCCAGGGTCTTGGTGTCAGGTGGCGGCAGAAGTCATGCCCATCAACAGCCTCATCGTCGGCGTC
GACTTGTCCCCAATAAAACCAATTCCAAAAGTTATCACCTTCCAGAGCGATATTACAACGGAAAAGTGTCGCGCC
ACCATCCGCCAACATTTCAAGACATGGAAGGCCGATACCGTCTTGCACGATGGTGCCCCCAATGTTGGTACCGCT
TGGGTACAAGACTCGTTCAACCAGGCAGAGCTCTCTCTACAGGCCATGAAGCTGGCAACCGAGTTCCTGATTGAA
GGGGGCACTTTTGTCACCAAAGTTTTCCGCTCAAAAGACTACAACCCCTTTCTTTGGGTCTTGAATCAGCTCTTC
ACCAAAGTCGAAGCCACCAAGCCACCATCCTCAAGAAACGTCTCTGCAGAAATCTTCGTCGTCTGTAGAGGCTTC
AAGGCCCCAAAACGCATTGATCCTCGTTTTCTGGACCCGAAATCTGTCTTTGCTGAGCTTTCAGGCGCAACGCCC
AACAACGAGGCCAAAGTGTTCAATCCAGAGGCCAAGAAACGTAAACGTGAGGGTTACGATGAAGGCGACTATACG
CAGTTCAAGCAAGTGCCAGCCAGCGAATTCATCCAGACGACAGATCCCATTGCCATCCTAGGCACTTGCAATAAA
CTCAGTTTTGAGCAAGGACTAGATGACGACGTCGCTTTGGCTGCACTCAACAGGCTTCCTGAAACGACACCCGAA
ATTCGAACATGTTGCCAAGACCTCAAGGTGTTGGGCCGCAAAGACTTCAAACTTCTACTTAAATGGCGATTAAGA
GCAAGGGAAATCTTTGGTTTCTCCAAAAAAGAGGAAGAAGAGGACGAGACGCAAGAAGTAGCTGATGTGGAGCCA
ATGGACGAAGAACTCAAGATTCAAGAAGAGCTGCAGAGCCTCAAAGACAAGGAAACTTCGAAAAAGAAGCGCGAA
AGACGTAGAGAGAACGAGCGCAAACAACGAGAAATCGTCCGCATGCAGCTCAACATGGTTGCTCCCATGGACATT
GGTATGGAAGAGTCGGCCACAGGCGGAGACAGAGCCATGTTTTCAATCAAAACTGTCGACAAGACGAATGCCATG
ACCCGCCTCTCGCGCGGCAAAATGGCCATGTTGACCGTCAAAGAGAAGCAGCAAGAAGCCGATTTGGTAACCCCA
GGAGAAGAAGCCGACGACCATAGTCAAGAAGATGGCGACGGAGATCAATTGGAACGAGACCTCGATTCCATGTAC
GAGAGCTACCGCGAACGCAAAGCCGAAGCCGATGCCAAATATCGTGCCAAAAAGGCAAGACAGGAACATGAAGAC
GACGACGAGTGGGAGGGGCTCTCAGCCAGTGAGCAATCTTCTGATCACAGTGACTCCAGCGAGTTGGACGAGGAT
GACGACTCTTCGAACGAGGATGATCAAGAACCTCCAAGTTGTTTATTAAGAGACCTCGATGGTTCGGTACCAACA
ACCAATGGCTTGTCCAGGCGAGCGGCGGCATTTTTCAGCCAGGAAATCTTTCAAGAACTTGCTCCTCTTGTCTCC
GAACCAGAAGAAGGCAAGGTTGCGAAAGAACCAAGTAGCGAAATCTCATCAAGACAAAAAAAATCCGACAGAGCT
AGCGAATCTATCATAGCCAAATCGGACGCAAAGTCTCAACGTTCATTGAATTTGGAGGATGACGAGGATCAAAAA
GATTTCGAGGTGGTCAAGCATGCAGAGGACGACGATTGGGAAAATGTGGTTCGTCGGCGTCCTGATGCCCAGCTG
GACATCGACATAGTCACAGCAGAAGCCATGACCCTAGCGCATCAGCTGGCCACAGGGCAAAAGACTATGCACGAT
GCAAAAGACGACGGATACAACAAGCACGCTTTCCGGGACCGTGATGGGCTACCAGAGTGGTTTCTCGATGACGAG
ACAAAGCATGATAAGCCACTGAAGCCCATTACAAAATGTGCGGCGCAGGCAATCAAGGATAAGTTGCGAGCGTTC
AACGCACGCCCCATCAAAAAGGTGCGCGAAGCCAAGGCGCGAAAGAAGTTCAAGGAGGCGCAAAAACTGGAAAAG
CTCAAGAAGAAGTCGGATATGCTGGCAAATGATGAGGGCATGACGGAAAAAGAAAAGGCTGAGAGCATACAAAGG
CTACTAAGACAGGCCAGCCGCAAGAAGCCGTCACAAGCAGCCAAGTTGGTGGTGGCACGGGGTCTCAATAGGGGC
ATCCAGGGCAGGCCAAAAGGAGTCAAGGGACGGTACCGTATGGTGGATCCTAGGATGAAGAAGGAGCTGAGAGCG
CAGAAACGGATATCTCAGCGCAAGAAGAGGTAA
Gene >OphauB2|3746
ATGGCCATCCAGAAGAAGCACGGCAAAGGCCGTCTAGACAAGTGGTACAAGCTTGCCAAAGAAAAGGGCTACCGT
GCCAGAGCCGCCTTCAAATTAATCCAGCTTAACAAAAAGTATGGCTTCTTGGAGAAGAGCAAGGTCTTACTGGAT
CTTTGCGCCGCGCCAGGGGTGAGTTTTCCTGACTTGAAGCTAGCCTGAAGCGATTATGAAGCGATTCTGACCTGG
TAATCACAGTCTTGGTGTCAGGTGGCGGCAGAAGTCATGCCCATCAACAGCCTCATCGTCGGCGTCGACTTGTCC
CCAATAAAACCAATTCCAAAAGTTATCACCTTCCAGAGCGATATTACAACGGAAAAGTGTCGCGCCACCATCCGC
CAACATTTCAAGACATGGAAGGCCGATACCGTCTTGCACGATGGTGCCCCCAATGTTGGTACCGCTTGGGTACAA
GACTCGTTCAACCAGGCAGAGCTCTCTCTACAGGCCATGAAGCTGGCAACCGAGTTCCTGATTGAAGGGGGCACT
TTTGTCACCAAAGTTTTCCGCTCAAAAGACTACAACCCCTTTCTTTGGGTCTTGAATCAGCTCTTCACCAAAGTC
GAAGCCACCAAGCCACCATCCTCAAGAAACGTCTCTGCAGAAATCTTCGTCGTCTGTAGAGGCTTCAAGGCCCCA
AAACGCATTGATCCTCGTTTTCTGGACCCGAAATCTGTCTTTGCTGAGCTTTCAGGCGCAACGCCCAACAACGAG
GCCAAAGTGTTCAATCCAGAGGCCAAGAAACGTAAACGTGAGGGTTACGATGAAGGCGACTATACGCAGTTCAAG
CAAGTGCCAGCCAGCGAATTCATCCAGACGACAGATCCCATTGCCATCCTAGGCACTTGCAATAAACTCAGTTTT
GAGCAAGGACTAGATGACGACGTCGCTTTGGCTGCACTCAACAGGCTTCCTGAAACGACACCCGAAATTCGAACA
TGTTGCCAAGACCTCAAGGTGTTGGGCCGCAAAGACTTCAAACTTCTACTTAAATGGCGATTAAGAGCAAGGGAA
ATCTTTGGTTTCTCCAAAAAAGAGGAAGAAGAGGACGAGACGCAAGAAGTAGCTGATGTGGAGCCAATGGACGAA
GAACTCAAGATTCAAGAAGAGCTGCAGAGCCTCAAAGACAAGGAAACTTCGAAAAAGAAGCGCGAAAGACGTAGA
GAGAACGAGCGCAAACAACGAGAAATCGTCCGCATGCAGCTCAACATGGTTGCTCCCATGGACATTGGTATGGAA
GAGTCGGCCACAGGCGGAGACAGAGCCATGTTTTCAATCAAAACTGTCGACAAGACGAATGCCATGACCCGCCTC
TCGCGCGGCAAAATGGCCATGTTGACCGTCAAAGAGAAGCAGCAAGAAGCCGATTTGGTAACCCCAGGAGAAGAA
GCCGACGACCATAGTCAAGAAGATGGCGACGGAGATCAATTGGAACGAGACCTCGATTCCATGTACGAGAGCTAC
CGCGAACGCAAAGCCGAAGCCGATGCCAAATATCGTGCCAAAAAGGCAAGACAGGAACATGAAGACGACGACGAG
TGGGAGGGGCTCTCAGCCAGTGAGCAATCTTCTGATCACAGTGACTCCAGCGAGTTGGACGAGGATGACGACTCT
TCGAACGAGGATGATCAAGAACCTCCAAGTTGTTTATTAAGAGACCTCGATGGTTCGGTACCAACAACCAATGGC
TTGTCCAGGCGAGCGGCGGCATTTTTCAGCCAGGAAATCTTTCAAGAACTTGCTCCTCTTGTCTCCGAACCAGAA
GAAGGCAAGGTTGCGAAAGAACCAAGTAGCGAAATCTCATCAAGACAAAAAAAATCCGACAGAGCTAGCGAATCT
ATCATAGCCAAATCGGACGCAAAGTCTCAACGTTCATTGAATTTGGAGGATGACGAGGATCAAAAAGATTTCGAG
GTGGTCAAGCATGCAGAGGACGACGATTGGGAAAATGTGGTTCGTCGGCGTCCTGATGCCCAGCTGGGTATGTAA
ACTGCTACACTCTCAATTTCCTTATTTACCTCGACTGAAATTGGAATTTGGCTGCTGACATGAAGATAGACATCG
ACATAGTCACAGCAGAAGCCATGACCCTAGCGCATCAGCTGGCCACAGGGCAAAAGACTATGCACGATGCAAAAG
ACGACGGATACAACAAGCACGCTTTCCGGGACCGTGATGGGCTACCAGAGTGGTTTCTCGATGACGAGACAAAGC
ATGATAAGCCACTGAAGCCCATTACAAAATGTGCGGCGCAGGCAATCAAGGATAAGTTGCGAGCGTTCAACGCAC
GCCCCATCAAAAAGGTGCGCGAAGCCAAGGCGCGAAAGAAGTTCAAGGAGGCGCAAAAACTGGAAAAGCTCAAGA
AGAAGTCGGATATGCTGGCAAATGATGAGGGCATGACGGAAAAAGAAAAGGCTGAGAGCATACAAAGGCTACTAA
GACAGGCCAGCCGCAAGAAGCCGTCACAAGCAGCCAAGTTGGTGGTGGCACGGGGTCTCAATAGGGGCATCCAGG
GCAGGCCAAAAGGAGTCAAGGGACGGTACCGTATGGTGGATCCTAGGATGAAGAAGGAGCTGAGAGCGCAGAAAC
GGATATCTCAGCGCAAGAAGAGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail