Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3739
Gene name
LocationContig_24:38235..44134
Strand-
Gene length (bp)5899
Transcript length (bp)5736
Coding sequence length (bp)5736
Protein length (aa) 1912

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20222 DUF6581 Family of unknown function (DUF6581) 6.3E-103 1450 1859
PF04182 B-block_TFIIIC B-block binding subunit of TFIIIC 1.1E-11 141 201

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3739
MALDFEELIVHLLMLIACRGENGCTIDEIIRDIIEAVNPHCSSPLAPNLAPDTRKSLPDTACSTVWRWLADREDV
LVGRGREFNHLSLDELLSLPQASTTALAASSTSATSSDEAVRVFTTQATMWEAITGHGVDYKRVPKSEWQLLLGI
AGSRGQGILQGDLGRLTCQDKRSVPKRTDVLANKGYIIKRTTLVKGTKTSKMWLKALAPPVPKDSDSVPTPRPEF
DLSRQVLVENLDPVPWHHRWTGSDIDFEALATTLMAIVKEWGTLRLRDVKLKLGVLGQRWQMKVLAQTCRFLNAR
GAIQYVAAKLDNAIFKDCISFRRNMTAEDWQLFLSTGKRGRALLVPFGAEEEEEECRQQDRIESQLASKKLASQL
TPWTVEKPLPQTIVGMVQCSGPKGLSNSILRTLTLGQSFGRYLSSTTSAMTMGSEQPRQLAHLKLRSEHVRNGRD
SRLLFFVGEPDKGDAPASTCPQEEATTARAIEDLYGFLPAAQAGAETAEYQSLTNICIDGASVIGIGKNRGRRRR
NESGEGGTVSEKQEDGLLISDEALAETQMVQTRDNDEEQKKSRQQVEGQEKEEKEEQDGDEGEEAEEEAEEDQQL
SPRITRGKAKQQQTRSSSSSRLTHFKVGPSQPNGLLGQDVVSNSDSAANVSPKQTRSGRIKAQKRSDTHVDGQED
TGRNIDVADHVDRGEAASQGSSDKGRLQEQDEEQEKEQEDEDAYEETGEEVSQDEEPVAWPALRDRGSRGRGGKR
GKRGKRGRGSSRGRLRGGTSRTVRRPADAEASDPLPWKCSKCGKGWKNDVGLKYHVEKSQTACNQSYTAPPRREK
PSKPAADAPSRRLRRRRVHLGQENESDGSGSRLRRGGRGVEKQAKAEKKVKQQEAVMDRLGEMWKRLPPLIAKMD
PKAAAIVEAPGLVAWRKGAAARLLLQETGDQGLVSVFGPREAAERAPRAWDKGDSSQKGPEEDEEDADSKPRQSR
PGARKRMRASKTTDEAICSVIESLLEEQNGVMMGGWRLSKAVRAAWGPRFGDIAPPSDRECREAVKSMIKAKRVT
EQWHGFREGGGKGAIFSKCQLLLGPRVGAFSPAVLALVEKVKGSRPELIEGEAGDEESVSRRRMWRRGRRFLGDE
VVDLEAPVYAAKLASKRAGSGSGGGGGGGGGGGGGGGRAKRVKLSTARRGQDALALDDVLIAEPEREARAIVFVE
ANTWLGEASGDGQLGEAARETQAAWSMEQQALDEALRAGSAPCPDGYLFDRANTILGHAGSWPAINEGHFERVDG
SWTMRGWMPGPDWFRGASFVEQVDKRFVVRMQGRSQLGAAPVSRHERFLCRLRACRDVELAWTSLFASMGPMTLQ
INYSSGPLQQADAPAAETVWRPEEQLTPATLVGQSHGYESSASSLAEDDAWPEPTRLKTLPPSPSAPRGTARPRL
KRVALVSRALTALPSPLGDARQRQRPLGADQGQELMAAFIAVRALLGGTAKAVDWGLLMTLYPHVELVSLRRFWT
DALRRQGAYIANYTRLFHQRLIGAFEADELPVIDFDAIGDYDWRRLIAWTLDLARQEGPWVPASREALDRQYALQ
AASSARADWRETFFGATTSFFARYEAITSEPGAVPLTPARHAPAQPLLDAVDVAKSWVKALCGTSASRYSAQQVR
ARLRTLCPGDRQASSALFKTAVAQLQQQRVVARKSRMPPGHRPFGLSEWYVALLTRLAQASKYHDAAAFKARLDA
AFAARAPLPVPYTLSDGATMALTNLSAHGRICLGAVDVPHVPLGFEPGNYESRKFPKSYYHFALDATPTPTYQPT
PDIALVAAVQHEPPPCEGPEAALPQWVDIFGQPDAAWGRVVGAVCFLVATRGPMPCSAILAAMDPILHAFELHLV
VDWGRRTGLLVDAADGAAIGVAEWWWLAVPLIPRQT*
Coding >OphauB2|3739
ATGGCGCTGGATTTTGAGGAGCTGATTGTGCACTTGCTGATGCTGATTGCATGTCGCGGCGAGAATGGATGTACA
ATTGATGAGATTATAAGAGATATTATAGAGGCAGTGAATCCCCATTGTTCATCACCCCTGGCTCCGAATCTAGCT
CCAGACACCAGAAAGTCTTTGCCGGATACAGCATGTTCTACAGTGTGGCGCTGGCTGGCGGATCGAGAAGATGTA
TTGGTGGGCCGTGGGAGAGAATTCAACCATCTCTCACTTGATGAGCTCCTCAGCCTGCCCCAAGCTAGCACCACT
GCTTTGGCAGCAAGCAGCACCTCTGCCACCAGCAGCGATGAAGCCGTCAGGGTCTTCACAACACAAGCCACCATG
TGGGAGGCTATCACGGGCCACGGCGTCGACTACAAACGCGTACCCAAGTCTGAATGGCAGCTCCTTCTTGGCATT
GCAGGCAGCAGGGGCCAGGGGATCCTTCAGGGCGACTTGGGCCGCCTCACCTGCCAGGACAAGCGCTCGGTTCCC
AAGCGCACTGATGTGTTAGCCAACAAGGGCTACATCATCAAGAGGACGACACTAGTCAAGGGCACCAAGACGAGC
AAGATGTGGCTCAAGGCTTTGGCGCCGCCTGTGCCCAAAGATAGCGACAGTGTGCCTACACCTAGGCCTGAGTTT
GATCTCTCGCGGCAGGTGCTGGTGGAAAATCTGGATCCTGTGCCTTGGCACCATCGGTGGACGGGCAGCGACATT
GACTTTGAGGCTCTTGCCACGACGCTCATGGCTATTGTTAAGGAATGGGGTACATTGCGTCTACGGGATGTCAAG
CTGAAGTTGGGTGTCCTGGGTCAGCGCTGGCAGATGAAGGTGCTGGCACAGACGTGTCGATTTCTCAATGCTCGT
GGTGCTATTCAGTACGTGGCGGCTAAGCTTGACAATGCCATCTTCAAGGACTGTATTTCCTTTCGGCGAAACATG
ACGGCCGAGGACTGGCAACTCTTTTTATCCACGGGAAAACGAGGACGTGCTCTGCTAGTGCCGTTTGGAGCCGAG
GAGGAAGAAGAAGAATGCAGGCAACAAGACAGGATCGAGTCTCAGCTGGCGTCAAAAAAACTTGCCAGTCAGCTG
ACTCCGTGGACAGTGGAAAAGCCGTTGCCGCAGACGATTGTTGGCATGGTGCAGTGCAGCGGGCCAAAGGGCCTT
TCCAACTCTATTCTCCGAACGCTGACACTGGGCCAGTCTTTTGGCCGCTATCTCTCATCTACTACATCAGCCATG
ACAATGGGTAGCGAACAGCCACGGCAGCTGGCTCATCTGAAGCTGAGAAGCGAACATGTGAGAAACGGTAGAGAT
TCACGACTCTTGTTTTTTGTGGGAGAGCCAGACAAGGGGGATGCTCCTGCTTCCACATGTCCCCAAGAGGAAGCA
ACAACAGCTCGTGCCATTGAGGACTTGTATGGTTTTTTGCCTGCAGCTCAGGCAGGGGCAGAGACTGCAGAGTAT
CAGTCCCTGACAAATATTTGCATCGATGGAGCATCTGTGATTGGTATAGGTAAAAACCGGGGAAGGCGGAGAAGA
AATGAGTCAGGAGAAGGCGGCACAGTGTCTGAGAAGCAAGAGGATGGTTTGTTAATTTCGGATGAAGCTCTGGCT
GAGACTCAAATGGTACAAACAAGAGATAATGACGAGGAACAGAAGAAGTCTCGCCAGCAGGTAGAAGGGCAAGAG
AAGGAGGAAAAGGAAGAGCAAGATGGAGACGAGGGAGAAGAAGCAGAAGAGGAAGCAGAGGAGGATCAGCAGCTG
TCGCCTCGGATTACTCGCGGAAAGGCCAAGCAACAGCAGACCCGGTCATCTAGCTCCAGCAGATTAACACATTTC
AAGGTTGGCCCAAGTCAACCAAATGGTTTACTAGGCCAAGACGTCGTCTCCAACTCGGATAGCGCTGCAAATGTC
TCTCCAAAGCAGACGAGATCAGGTCGGATAAAGGCGCAGAAACGGTCCGATACCCATGTTGATGGACAAGAGGAT
ACGGGGCGAAATATAGACGTGGCAGACCATGTGGATAGGGGCGAAGCTGCAAGTCAAGGCTCGTCAGACAAAGGC
CGACTCCAGGAGCAAGACGAGGAGCAAGAAAAGGAGCAAGAAGATGAAGATGCATATGAGGAGACAGGAGAAGAG
GTCAGTCAGGATGAGGAGCCAGTAGCATGGCCGGCATTGCGTGACCGGGGCAGTCGAGGCAGAGGAGGAAAGCGA
GGAAAAAGAGGAAAACGGGGCAGAGGGTCGAGTCGTGGGCGGCTGCGTGGCGGCACGAGTAGGACAGTGCGACGA
CCAGCAGATGCCGAAGCGTCAGATCCGCTGCCGTGGAAATGCTCCAAGTGCGGCAAGGGATGGAAGAATGACGTT
GGCCTCAAGTATCATGTGGAAAAGTCACAGACTGCATGCAACCAATCATACACGGCGCCGCCGCGACGCGAGAAG
CCAAGCAAGCCAGCAGCGGATGCTCCTTCAAGAAGGCTGCGGCGACGACGTGTGCATCTGGGCCAGGAAAATGAG
AGCGATGGCTCGGGGAGCAGGCTGAGGCGTGGCGGCCGTGGGGTAGAGAAACAGGCCAAGGCAGAGAAGAAGGTG
AAGCAGCAGGAAGCAGTCATGGACCGGCTGGGTGAGATGTGGAAGAGACTACCGCCATTGATTGCCAAGATGGAC
CCCAAGGCGGCAGCCATTGTTGAGGCTCCAGGGCTGGTGGCATGGCGAAAGGGCGCTGCTGCTCGGCTCCTGCTG
CAAGAGACGGGGGACCAAGGGCTCGTTTCGGTCTTTGGGCCTCGAGAGGCGGCGGAGAGGGCGCCAAGGGCGTGG
GACAAGGGCGACAGCAGCCAAAAAGGGCCGGAAGAGGATGAAGAGGACGCGGATTCGAAGCCAAGGCAAAGTAGG
CCTGGCGCACGCAAACGCATGAGAGCAAGCAAGACGACAGACGAGGCCATCTGCAGCGTCATTGAGAGTCTGCTG
GAAGAGCAAAATGGCGTCATGATGGGCGGATGGCGGCTCTCCAAGGCCGTGAGGGCGGCATGGGGCCCGAGGTTT
GGCGACATTGCGCCGCCCAGCGATAGGGAGTGCCGGGAAGCAGTCAAGAGCATGATCAAGGCCAAGAGGGTAACG
GAGCAGTGGCACGGGTTTCGCGAAGGCGGCGGCAAAGGCGCCATCTTCTCCAAATGCCAGCTGCTGCTGGGACCG
CGGGTGGGCGCCTTTTCTCCGGCGGTGCTGGCGCTGGTGGAAAAGGTGAAGGGCTCGCGGCCCGAGCTGATTGAG
GGCGAGGCGGGCGACGAGGAGAGCGTGTCGCGGCGGCGCATGTGGCGGCGAGGGCGGCGCTTCCTGGGCGACGAG
GTGGTGGATCTGGAGGCGCCCGTGTATGCGGCCAAGTTGGCGAGCAAGAGGGCGGGCTCGGGCAGTGGTGGAGGA
GGTGGAGGAGGCGGAGGAGGCGGAGGAGGTGGTGGTAGGGCAAAGCGCGTCAAGCTGTCGACGGCGCGCAGAGGA
CAAGACGCGTTGGCGCTGGACGACGTGTTGATTGCGGAGCCGGAGCGGGAAGCAAGGGCCATTGTGTTTGTCGAG
GCGAATACGTGGCTGGGCGAGGCCTCGGGGGACGGGCAGCTGGGAGAGGCAGCTAGAGAGACACAGGCTGCATGG
AGCATGGAGCAGCAAGCCCTGGACGAGGCGCTGCGAGCAGGCTCGGCTCCTTGTCCCGACGGCTACCTCTTTGAC
AGGGCCAACACCATCCTGGGCCACGCAGGCAGCTGGCCGGCCATCAACGAGGGCCACTTTGAGCGCGTCGACGGC
AGCTGGACCATGCGGGGCTGGATGCCGGGCCCAGACTGGTTCCGCGGAGCCTCGTTTGTCGAGCAGGTGGACAAG
CGCTTCGTGGTGCGCATGCAGGGCCGCAGCCAGCTGGGCGCGGCGCCTGTCTCCCGCCATGAGCGCTTCCTGTGC
AGACTGCGCGCCTGTCGCGACGTGGAGCTGGCCTGGACGAGCTTGTTTGCCAGCATGGGCCCCATGACTCTTCAA
ATCAACTACTCGTCGGGCCCGCTTCAGCAGGCCGACGCGCCTGCGGCAGAGACGGTCTGGCGGCCCGAGGAGCAG
CTGACGCCGGCAACGCTCGTGGGCCAGAGCCACGGCTACGAATCGTCGGCTTCGTCGCTGGCCGAGGACGACGCG
TGGCCCGAGCCCACCAGACTCAAGACGCTGCCGCCGTCGCCGTCTGCTCCGCGCGGCACTGCCAGACCAAGGCTC
AAGCGCGTTGCCCTCGTCTCACGCGCGCTGACTGCTCTGCCCAGCCCACTCGGAGATGCTCGACAGCGCCAGCGA
CCCCTGGGCGCCGACCAAGGCCAGGAGCTCATGGCTGCCTTTATTGCCGTGCGGGCGCTGCTGGGCGGCACGGCA
AAGGCGGTTGACTGGGGCCTGCTCATGACGCTCTACCCACATGTCGAGCTCGTCAGCCTGCGCCGCTTCTGGACG
GATGCCTTGCGCCGCCAGGGCGCCTACATTGCCAACTACACGCGCCTCTTCCACCAGAGGCTGATTGGCGCCTTT
GAGGCGGACGAGCTGCCCGTCATTGACTTTGACGCCATTGGCGATTACGACTGGCGCCGCCTCATCGCCTGGACC
CTGGACCTGGCCCGCCAAGAGGGGCCGTGGGTGCCGGCATCGCGAGAGGCGCTCGACAGGCAGTATGCGCTGCAG
GCCGCCAGCAGCGCCAGGGCCGACTGGCGCGAGACCTTTTTTGGCGCCACCACGTCCTTTTTTGCCCGCTACGAG
GCCATTACGTCGGAGCCGGGCGCCGTGCCGCTGACGCCAGCCAGACACGCCCCAGCCCAGCCGCTGCTCGACGCC
GTCGACGTGGCCAAGTCGTGGGTCAAGGCGCTCTGTGGCACCAGCGCGTCGCGCTACTCGGCCCAGCAGGTGCGC
GCACGCCTGCGCACTCTTTGCCCCGGCGACCGCCAGGCCTCGTCGGCCCTCTTCAAGACGGCCGTGGCCCAGCTG
CAGCAGCAGCGTGTCGTGGCCCGCAAGAGCCGCATGCCGCCTGGCCACCGCCCCTTTGGCCTGAGCGAGTGGTAT
GTCGCCCTGCTGACGCGCCTGGCTCAGGCATCCAAGTACCACGACGCCGCCGCCTTTAAAGCCCGCCTCGACGCC
GCCTTTGCCGCCCGCGCGCCCCTGCCCGTGCCCTACACCCTGAGCGACGGCGCCACCATGGCCCTGACCAACCTC
AGCGCCCACGGCCGCATCTGCCTCGGAGCCGTCGACGTGCCTCATGTGCCCCTGGGCTTCGAGCCAGGCAACTAC
GAGAGCCGCAAGTTTCCAAAGTCGTACTACCACTTTGCCCTCGACGCCACTCCCACCCCCACATACCAGCCCACG
CCCGACATTGCCCTCGTTGCCGCCGTCCAGCACGAGCCGCCGCCCTGTGAGGGCCCCGAGGCCGCCCTGCCGCAA
TGGGTCGATATTTTTGGTCAGCCAGACGCCGCCTGGGGCCGAGTCGTTGGCGCCGTCTGCTTCCTCGTTGCCACG
CGCGGGCCCATGCCCTGCTCCGCCATCCTCGCCGCCATGGATCCCATTCTCCACGCCTTTGAGCTGCACCTTGTC
GTCGACTGGGGGCGGCGTACCGGCCTCTTGGTCGATGCTGCTGACGGTGCTGCCATTGGCGTCGCTGAGTGGTGG
TGGCTGGCTGTGCCTTTGATACCGCGGCAGACATGA
Transcript >OphauB2|3739
ATGGCGCTGGATTTTGAGGAGCTGATTGTGCACTTGCTGATGCTGATTGCATGTCGCGGCGAGAATGGATGTACA
ATTGATGAGATTATAAGAGATATTATAGAGGCAGTGAATCCCCATTGTTCATCACCCCTGGCTCCGAATCTAGCT
CCAGACACCAGAAAGTCTTTGCCGGATACAGCATGTTCTACAGTGTGGCGCTGGCTGGCGGATCGAGAAGATGTA
TTGGTGGGCCGTGGGAGAGAATTCAACCATCTCTCACTTGATGAGCTCCTCAGCCTGCCCCAAGCTAGCACCACT
GCTTTGGCAGCAAGCAGCACCTCTGCCACCAGCAGCGATGAAGCCGTCAGGGTCTTCACAACACAAGCCACCATG
TGGGAGGCTATCACGGGCCACGGCGTCGACTACAAACGCGTACCCAAGTCTGAATGGCAGCTCCTTCTTGGCATT
GCAGGCAGCAGGGGCCAGGGGATCCTTCAGGGCGACTTGGGCCGCCTCACCTGCCAGGACAAGCGCTCGGTTCCC
AAGCGCACTGATGTGTTAGCCAACAAGGGCTACATCATCAAGAGGACGACACTAGTCAAGGGCACCAAGACGAGC
AAGATGTGGCTCAAGGCTTTGGCGCCGCCTGTGCCCAAAGATAGCGACAGTGTGCCTACACCTAGGCCTGAGTTT
GATCTCTCGCGGCAGGTGCTGGTGGAAAATCTGGATCCTGTGCCTTGGCACCATCGGTGGACGGGCAGCGACATT
GACTTTGAGGCTCTTGCCACGACGCTCATGGCTATTGTTAAGGAATGGGGTACATTGCGTCTACGGGATGTCAAG
CTGAAGTTGGGTGTCCTGGGTCAGCGCTGGCAGATGAAGGTGCTGGCACAGACGTGTCGATTTCTCAATGCTCGT
GGTGCTATTCAGTACGTGGCGGCTAAGCTTGACAATGCCATCTTCAAGGACTGTATTTCCTTTCGGCGAAACATG
ACGGCCGAGGACTGGCAACTCTTTTTATCCACGGGAAAACGAGGACGTGCTCTGCTAGTGCCGTTTGGAGCCGAG
GAGGAAGAAGAAGAATGCAGGCAACAAGACAGGATCGAGTCTCAGCTGGCGTCAAAAAAACTTGCCAGTCAGCTG
ACTCCGTGGACAGTGGAAAAGCCGTTGCCGCAGACGATTGTTGGCATGGTGCAGTGCAGCGGGCCAAAGGGCCTT
TCCAACTCTATTCTCCGAACGCTGACACTGGGCCAGTCTTTTGGCCGCTATCTCTCATCTACTACATCAGCCATG
ACAATGGGTAGCGAACAGCCACGGCAGCTGGCTCATCTGAAGCTGAGAAGCGAACATGTGAGAAACGGTAGAGAT
TCACGACTCTTGTTTTTTGTGGGAGAGCCAGACAAGGGGGATGCTCCTGCTTCCACATGTCCCCAAGAGGAAGCA
ACAACAGCTCGTGCCATTGAGGACTTGTATGGTTTTTTGCCTGCAGCTCAGGCAGGGGCAGAGACTGCAGAGTAT
CAGTCCCTGACAAATATTTGCATCGATGGAGCATCTGTGATTGGTATAGGTAAAAACCGGGGAAGGCGGAGAAGA
AATGAGTCAGGAGAAGGCGGCACAGTGTCTGAGAAGCAAGAGGATGGTTTGTTAATTTCGGATGAAGCTCTGGCT
GAGACTCAAATGGTACAAACAAGAGATAATGACGAGGAACAGAAGAAGTCTCGCCAGCAGGTAGAAGGGCAAGAG
AAGGAGGAAAAGGAAGAGCAAGATGGAGACGAGGGAGAAGAAGCAGAAGAGGAAGCAGAGGAGGATCAGCAGCTG
TCGCCTCGGATTACTCGCGGAAAGGCCAAGCAACAGCAGACCCGGTCATCTAGCTCCAGCAGATTAACACATTTC
AAGGTTGGCCCAAGTCAACCAAATGGTTTACTAGGCCAAGACGTCGTCTCCAACTCGGATAGCGCTGCAAATGTC
TCTCCAAAGCAGACGAGATCAGGTCGGATAAAGGCGCAGAAACGGTCCGATACCCATGTTGATGGACAAGAGGAT
ACGGGGCGAAATATAGACGTGGCAGACCATGTGGATAGGGGCGAAGCTGCAAGTCAAGGCTCGTCAGACAAAGGC
CGACTCCAGGAGCAAGACGAGGAGCAAGAAAAGGAGCAAGAAGATGAAGATGCATATGAGGAGACAGGAGAAGAG
GTCAGTCAGGATGAGGAGCCAGTAGCATGGCCGGCATTGCGTGACCGGGGCAGTCGAGGCAGAGGAGGAAAGCGA
GGAAAAAGAGGAAAACGGGGCAGAGGGTCGAGTCGTGGGCGGCTGCGTGGCGGCACGAGTAGGACAGTGCGACGA
CCAGCAGATGCCGAAGCGTCAGATCCGCTGCCGTGGAAATGCTCCAAGTGCGGCAAGGGATGGAAGAATGACGTT
GGCCTCAAGTATCATGTGGAAAAGTCACAGACTGCATGCAACCAATCATACACGGCGCCGCCGCGACGCGAGAAG
CCAAGCAAGCCAGCAGCGGATGCTCCTTCAAGAAGGCTGCGGCGACGACGTGTGCATCTGGGCCAGGAAAATGAG
AGCGATGGCTCGGGGAGCAGGCTGAGGCGTGGCGGCCGTGGGGTAGAGAAACAGGCCAAGGCAGAGAAGAAGGTG
AAGCAGCAGGAAGCAGTCATGGACCGGCTGGGTGAGATGTGGAAGAGACTACCGCCATTGATTGCCAAGATGGAC
CCCAAGGCGGCAGCCATTGTTGAGGCTCCAGGGCTGGTGGCATGGCGAAAGGGCGCTGCTGCTCGGCTCCTGCTG
CAAGAGACGGGGGACCAAGGGCTCGTTTCGGTCTTTGGGCCTCGAGAGGCGGCGGAGAGGGCGCCAAGGGCGTGG
GACAAGGGCGACAGCAGCCAAAAAGGGCCGGAAGAGGATGAAGAGGACGCGGATTCGAAGCCAAGGCAAAGTAGG
CCTGGCGCACGCAAACGCATGAGAGCAAGCAAGACGACAGACGAGGCCATCTGCAGCGTCATTGAGAGTCTGCTG
GAAGAGCAAAATGGCGTCATGATGGGCGGATGGCGGCTCTCCAAGGCCGTGAGGGCGGCATGGGGCCCGAGGTTT
GGCGACATTGCGCCGCCCAGCGATAGGGAGTGCCGGGAAGCAGTCAAGAGCATGATCAAGGCCAAGAGGGTAACG
GAGCAGTGGCACGGGTTTCGCGAAGGCGGCGGCAAAGGCGCCATCTTCTCCAAATGCCAGCTGCTGCTGGGACCG
CGGGTGGGCGCCTTTTCTCCGGCGGTGCTGGCGCTGGTGGAAAAGGTGAAGGGCTCGCGGCCCGAGCTGATTGAG
GGCGAGGCGGGCGACGAGGAGAGCGTGTCGCGGCGGCGCATGTGGCGGCGAGGGCGGCGCTTCCTGGGCGACGAG
GTGGTGGATCTGGAGGCGCCCGTGTATGCGGCCAAGTTGGCGAGCAAGAGGGCGGGCTCGGGCAGTGGTGGAGGA
GGTGGAGGAGGCGGAGGAGGCGGAGGAGGTGGTGGTAGGGCAAAGCGCGTCAAGCTGTCGACGGCGCGCAGAGGA
CAAGACGCGTTGGCGCTGGACGACGTGTTGATTGCGGAGCCGGAGCGGGAAGCAAGGGCCATTGTGTTTGTCGAG
GCGAATACGTGGCTGGGCGAGGCCTCGGGGGACGGGCAGCTGGGAGAGGCAGCTAGAGAGACACAGGCTGCATGG
AGCATGGAGCAGCAAGCCCTGGACGAGGCGCTGCGAGCAGGCTCGGCTCCTTGTCCCGACGGCTACCTCTTTGAC
AGGGCCAACACCATCCTGGGCCACGCAGGCAGCTGGCCGGCCATCAACGAGGGCCACTTTGAGCGCGTCGACGGC
AGCTGGACCATGCGGGGCTGGATGCCGGGCCCAGACTGGTTCCGCGGAGCCTCGTTTGTCGAGCAGGTGGACAAG
CGCTTCGTGGTGCGCATGCAGGGCCGCAGCCAGCTGGGCGCGGCGCCTGTCTCCCGCCATGAGCGCTTCCTGTGC
AGACTGCGCGCCTGTCGCGACGTGGAGCTGGCCTGGACGAGCTTGTTTGCCAGCATGGGCCCCATGACTCTTCAA
ATCAACTACTCGTCGGGCCCGCTTCAGCAGGCCGACGCGCCTGCGGCAGAGACGGTCTGGCGGCCCGAGGAGCAG
CTGACGCCGGCAACGCTCGTGGGCCAGAGCCACGGCTACGAATCGTCGGCTTCGTCGCTGGCCGAGGACGACGCG
TGGCCCGAGCCCACCAGACTCAAGACGCTGCCGCCGTCGCCGTCTGCTCCGCGCGGCACTGCCAGACCAAGGCTC
AAGCGCGTTGCCCTCGTCTCACGCGCGCTGACTGCTCTGCCCAGCCCACTCGGAGATGCTCGACAGCGCCAGCGA
CCCCTGGGCGCCGACCAAGGCCAGGAGCTCATGGCTGCCTTTATTGCCGTGCGGGCGCTGCTGGGCGGCACGGCA
AAGGCGGTTGACTGGGGCCTGCTCATGACGCTCTACCCACATGTCGAGCTCGTCAGCCTGCGCCGCTTCTGGACG
GATGCCTTGCGCCGCCAGGGCGCCTACATTGCCAACTACACGCGCCTCTTCCACCAGAGGCTGATTGGCGCCTTT
GAGGCGGACGAGCTGCCCGTCATTGACTTTGACGCCATTGGCGATTACGACTGGCGCCGCCTCATCGCCTGGACC
CTGGACCTGGCCCGCCAAGAGGGGCCGTGGGTGCCGGCATCGCGAGAGGCGCTCGACAGGCAGTATGCGCTGCAG
GCCGCCAGCAGCGCCAGGGCCGACTGGCGCGAGACCTTTTTTGGCGCCACCACGTCCTTTTTTGCCCGCTACGAG
GCCATTACGTCGGAGCCGGGCGCCGTGCCGCTGACGCCAGCCAGACACGCCCCAGCCCAGCCGCTGCTCGACGCC
GTCGACGTGGCCAAGTCGTGGGTCAAGGCGCTCTGTGGCACCAGCGCGTCGCGCTACTCGGCCCAGCAGGTGCGC
GCACGCCTGCGCACTCTTTGCCCCGGCGACCGCCAGGCCTCGTCGGCCCTCTTCAAGACGGCCGTGGCCCAGCTG
CAGCAGCAGCGTGTCGTGGCCCGCAAGAGCCGCATGCCGCCTGGCCACCGCCCCTTTGGCCTGAGCGAGTGGTAT
GTCGCCCTGCTGACGCGCCTGGCTCAGGCATCCAAGTACCACGACGCCGCCGCCTTTAAAGCCCGCCTCGACGCC
GCCTTTGCCGCCCGCGCGCCCCTGCCCGTGCCCTACACCCTGAGCGACGGCGCCACCATGGCCCTGACCAACCTC
AGCGCCCACGGCCGCATCTGCCTCGGAGCCGTCGACGTGCCTCATGTGCCCCTGGGCTTCGAGCCAGGCAACTAC
GAGAGCCGCAAGTTTCCAAAGTCGTACTACCACTTTGCCCTCGACGCCACTCCCACCCCCACATACCAGCCCACG
CCCGACATTGCCCTCGTTGCCGCCGTCCAGCACGAGCCGCCGCCCTGTGAGGGCCCCGAGGCCGCCCTGCCGCAA
TGGGTCGATATTTTTGGTCAGCCAGACGCCGCCTGGGGCCGAGTCGTTGGCGCCGTCTGCTTCCTCGTTGCCACG
CGCGGGCCCATGCCCTGCTCCGCCATCCTCGCCGCCATGGATCCCATTCTCCACGCCTTTGAGCTGCACCTTGTC
GTCGACTGGGGGCGGCGTACCGGCCTCTTGGTCGATGCTGCTGACGGTGCTGCCATTGGCGTCGCTGAGTGGTGG
TGGCTGGCTGTGCCTTTGATACCGCGGCAGACATGA
Gene >OphauB2|3739
ATGGCGCTGGATTTTGAGGAGCTGATTGTGCACTTGCTGATGCTGATTGCATGTCGCGGCGAGAATGGTGAGTTT
ACCTGGCCGGTGGAAGGAGCAAGCAATCATAGCCTTGGAATATCGTGACGAATGTCAATAGCCAGTCTCATATGC
AACGTCTCTCACTCATCATTGCCCTTTTTAATCAGCAGCAAATATGCCGTTGGCTTTATGAGCTGACAGAGGTGC
AACAGGATGTACAATTGATGAGATTATAAGAGATATTATAGAGGCAGTGAATCCCCATTGTTCATCACCCCTGGC
TCCGAATCTAGCTCCAGACACCAGAAAGTCTTTGCCGGATACAGCATGTTCTACAGTGTGGCGCTGGCTGGCGGA
TCGAGAAGATGTATTGGTGGGCCGTGGGAGAGAATTCAACCATCTCTCACTTGATGAGCTCCTCAGCCTGCCCCA
AGCTAGCACCACTGCTTTGGCAGCAAGCAGCACCTCTGCCACCAGCAGCGATGAAGCCGTCAGGGTCTTCACAAC
ACAAGCCACCATGTGGGAGGCTATCACGGGCCACGGCGTCGACTACAAACGCGTACCCAAGTCTGAATGGCAGCT
CCTTCTTGGCATTGCAGGCAGCAGGGGCCAGGGGATCCTTCAGGGCGACTTGGGCCGCCTCACCTGCCAGGACAA
GCGCTCGGTTCCCAAGCGCACTGATGTGTTAGCCAACAAGGGCTACATCATCAAGAGGACGACACTAGTCAAGGG
CACCAAGACGAGCAAGATGTGGCTCAAGGCTTTGGCGCCGCCTGTGCCCAAAGATAGCGACAGTGTGCCTACACC
TAGGCCTGAGTTTGATCTCTCGCGGCAGGTGCTGGTGGAAAATCTGGATCCTGTGCCTTGGCACCATCGGTGGAC
GGGCAGCGACATTGACTTTGAGGCTCTTGCCACGACGCTCATGGCTATTGTTAAGGAATGGGGTACATTGCGTCT
ACGGGATGTCAAGCTGAAGTTGGGTGTCCTGGGTCAGCGCTGGCAGATGAAGGTGCTGGCACAGACGTGTCGATT
TCTCAATGCTCGTGGTGCTATTCAGTACGTGGCGGCTAAGCTTGACAATGCCATCTTCAAGGACTGTATTTCCTT
TCGGCGAAACATGACGGCCGAGGACTGGCAACTCTTTTTATCCACGGGAAAACGAGGACGTGCTCTGCTAGTGCC
GTTTGGAGCCGAGGAGGAAGAAGAAGAATGCAGGCAACAAGACAGGATCGAGTCTCAGCTGGCGTCAAAAAAACT
TGCCAGTCAGCTGACTCCGTGGACAGTGGAAAAGCCGTTGCCGCAGACGATTGTTGGCATGGTGCAGTGCAGCGG
GCCAAAGGGCCTTTCCAACTCTATTCTCCGAACGCTGACACTGGGCCAGTCTTTTGGCCGCTATCTCTCATCTAC
TACATCAGCCATGACAATGGGTAGCGAACAGCCACGGCAGCTGGCTCATCTGAAGCTGAGAAGCGAACATGTGAG
AAACGGTAGAGATTCACGACTCTTGTTTTTTGTGGGAGAGCCAGACAAGGGGGATGCTCCTGCTTCCACATGTCC
CCAAGAGGAAGCAACAACAGCTCGTGCCATTGAGGACTTGTATGGTTTTTTGCCTGCAGCTCAGGCAGGGGCAGA
GACTGCAGAGTATCAGTCCCTGACAAATATTTGCATCGATGGAGCATCTGTGATTGGTATAGGTAAAAACCGGGG
AAGGCGGAGAAGAAATGAGTCAGGAGAAGGCGGCACAGTGTCTGAGAAGCAAGAGGATGGTTTGTTAATTTCGGA
TGAAGCTCTGGCTGAGACTCAAATGGTACAAACAAGAGATAATGACGAGGAACAGAAGAAGTCTCGCCAGCAGGT
AGAAGGGCAAGAGAAGGAGGAAAAGGAAGAGCAAGATGGAGACGAGGGAGAAGAAGCAGAAGAGGAAGCAGAGGA
GGATCAGCAGCTGTCGCCTCGGATTACTCGCGGAAAGGCCAAGCAACAGCAGACCCGGTCATCTAGCTCCAGCAG
ATTAACACATTTCAAGGTTGGCCCAAGTCAACCAAATGGTTTACTAGGCCAAGACGTCGTCTCCAACTCGGATAG
CGCTGCAAATGTCTCTCCAAAGCAGACGAGATCAGGTCGGATAAAGGCGCAGAAACGGTCCGATACCCATGTTGA
TGGACAAGAGGATACGGGGCGAAATATAGACGTGGCAGACCATGTGGATAGGGGCGAAGCTGCAAGTCAAGGCTC
GTCAGACAAAGGCCGACTCCAGGAGCAAGACGAGGAGCAAGAAAAGGAGCAAGAAGATGAAGATGCATATGAGGA
GACAGGAGAAGAGGTCAGTCAGGATGAGGAGCCAGTAGCATGGCCGGCATTGCGTGACCGGGGCAGTCGAGGCAG
AGGAGGAAAGCGAGGAAAAAGAGGAAAACGGGGCAGAGGGTCGAGTCGTGGGCGGCTGCGTGGCGGCACGAGTAG
GACAGTGCGACGACCAGCAGATGCCGAAGCGTCAGATCCGCTGCCGTGGAAATGCTCCAAGTGCGGCAAGGGATG
GAAGAATGACGTTGGCCTCAAGTATCATGTGGAAAAGTCACAGACTGCATGCAACCAATCATACACGGCGCCGCC
GCGACGCGAGAAGCCAAGCAAGCCAGCAGCGGATGCTCCTTCAAGAAGGCTGCGGCGACGACGTGTGCATCTGGG
CCAGGAAAATGAGAGCGATGGCTCGGGGAGCAGGCTGAGGCGTGGCGGCCGTGGGGTAGAGAAACAGGCCAAGGC
AGAGAAGAAGGTGAAGCAGCAGGAAGCAGTCATGGACCGGCTGGGTGAGATGTGGAAGAGACTACCGCCATTGAT
TGCCAAGATGGACCCCAAGGCGGCAGCCATTGTTGAGGCTCCAGGGCTGGTGGCATGGCGAAAGGGCGCTGCTGC
TCGGCTCCTGCTGCAAGAGACGGGGGACCAAGGGCTCGTTTCGGTCTTTGGGCCTCGAGAGGCGGCGGAGAGGGC
GCCAAGGGCGTGGGACAAGGGCGACAGCAGCCAAAAAGGGCCGGAAGAGGATGAAGAGGACGCGGATTCGAAGCC
AAGGCAAAGTAGGCCTGGCGCACGCAAACGCATGAGAGCAAGCAAGACGACAGACGAGGCCATCTGCAGCGTCAT
TGAGAGTCTGCTGGAAGAGCAAAATGGCGTCATGATGGGCGGATGGCGGCTCTCCAAGGCCGTGAGGGCGGCATG
GGGCCCGAGGTTTGGCGACATTGCGCCGCCCAGCGATAGGGAGTGCCGGGAAGCAGTCAAGAGCATGATCAAGGC
CAAGAGGGTAACGGAGCAGTGGCACGGGTTTCGCGAAGGCGGCGGCAAAGGCGCCATCTTCTCCAAATGCCAGCT
GCTGCTGGGACCGCGGGTGGGCGCCTTTTCTCCGGCGGTGCTGGCGCTGGTGGAAAAGGTGAAGGGCTCGCGGCC
CGAGCTGATTGAGGGCGAGGCGGGCGACGAGGAGAGCGTGTCGCGGCGGCGCATGTGGCGGCGAGGGCGGCGCTT
CCTGGGCGACGAGGTGGTGGATCTGGAGGCGCCCGTGTATGCGGCCAAGTTGGCGAGCAAGAGGGCGGGCTCGGG
CAGTGGTGGAGGAGGTGGAGGAGGCGGAGGAGGCGGAGGAGGTGGTGGTAGGGCAAAGCGCGTCAAGCTGTCGAC
GGCGCGCAGAGGACAAGACGCGTTGGCGCTGGACGACGTGTTGATTGCGGAGCCGGAGCGGGAAGCAAGGGCCAT
TGTGTTTGTCGAGGCGAATACGTGGCTGGGCGAGGCCTCGGGGGACGGGCAGCTGGGAGAGGCAGCTAGAGAGAC
ACAGGCTGCATGGAGCATGGAGCAGCAAGCCCTGGACGAGGCGCTGCGAGCAGGCTCGGCTCCTTGTCCCGACGG
CTACCTCTTTGACAGGGCCAACACCATCCTGGGCCACGCAGGCAGCTGGCCGGCCATCAACGAGGGCCACTTTGA
GCGCGTCGACGGCAGCTGGACCATGCGGGGCTGGATGCCGGGCCCAGACTGGTTCCGCGGAGCCTCGTTTGTCGA
GCAGGTGGACAAGCGCTTCGTGGTGCGCATGCAGGGCCGCAGCCAGCTGGGCGCGGCGCCTGTCTCCCGCCATGA
GCGCTTCCTGTGCAGACTGCGCGCCTGTCGCGACGTGGAGCTGGCCTGGACGAGCTTGTTTGCCAGCATGGGCCC
CATGACTCTTCAAATCAACTACTCGTCGGGCCCGCTTCAGCAGGCCGACGCGCCTGCGGCAGAGACGGTCTGGCG
GCCCGAGGAGCAGCTGACGCCGGCAACGCTCGTGGGCCAGAGCCACGGCTACGAATCGTCGGCTTCGTCGCTGGC
CGAGGACGACGCGTGGCCCGAGCCCACCAGACTCAAGACGCTGCCGCCGTCGCCGTCTGCTCCGCGCGGCACTGC
CAGACCAAGGCTCAAGCGCGTTGCCCTCGTCTCACGCGCGCTGACTGCTCTGCCCAGCCCACTCGGAGATGCTCG
ACAGCGCCAGCGACCCCTGGGCGCCGACCAAGGCCAGGAGCTCATGGCTGCCTTTATTGCCGTGCGGGCGCTGCT
GGGCGGCACGGCAAAGGCGGTTGACTGGGGCCTGCTCATGACGCTCTACCCACATGTCGAGCTCGTCAGCCTGCG
CCGCTTCTGGACGGATGCCTTGCGCCGCCAGGGCGCCTACATTGCCAACTACACGCGCCTCTTCCACCAGAGGCT
GATTGGCGCCTTTGAGGCGGACGAGCTGCCCGTCATTGACTTTGACGCCATTGGCGATTACGACTGGCGCCGCCT
CATCGCCTGGACCCTGGACCTGGCCCGCCAAGAGGGGCCGTGGGTGCCGGCATCGCGAGAGGCGCTCGACAGGCA
GTATGCGCTGCAGGCCGCCAGCAGCGCCAGGGCCGACTGGCGCGAGACCTTTTTTGGCGCCACCACGTCCTTTTT
TGCCCGCTACGAGGCCATTACGTCGGAGCCGGGCGCCGTGCCGCTGACGCCAGCCAGACACGCCCCAGCCCAGCC
GCTGCTCGACGCCGTCGACGTGGCCAAGTCGTGGGTCAAGGCGCTCTGTGGCACCAGCGCGTCGCGCTACTCGGC
CCAGCAGGTGCGCGCACGCCTGCGCACTCTTTGCCCCGGCGACCGCCAGGCCTCGTCGGCCCTCTTCAAGACGGC
CGTGGCCCAGCTGCAGCAGCAGCGTGTCGTGGCCCGCAAGAGCCGCATGCCGCCTGGCCACCGCCCCTTTGGCCT
GAGCGAGTGGTATGTCGCCCTGCTGACGCGCCTGGCTCAGGCATCCAAGTACCACGACGCCGCCGCCTTTAAAGC
CCGCCTCGACGCCGCCTTTGCCGCCCGCGCGCCCCTGCCCGTGCCCTACACCCTGAGCGACGGCGCCACCATGGC
CCTGACCAACCTCAGCGCCCACGGCCGCATCTGCCTCGGAGCCGTCGACGTGCCTCATGTGCCCCTGGGCTTCGA
GCCAGGCAACTACGAGAGCCGCAAGTTTCCAAAGTCGTACTACCACTTTGCCCTCGACGCCACTCCCACCCCCAC
ATACCAGCCCACGCCCGACATTGCCCTCGTTGCCGCCGTCCAGCACGAGCCGCCGCCCTGTGAGGGCCCCGAGGC
CGCCCTGCCGCAATGGGTCGATATTTTTGGTCAGCCAGACGCCGCCTGGGGCCGAGTCGTTGGCGCCGTCTGCTT
CCTCGTTGCCACGCGCGGGCCCATGCCCTGCTCCGCCATCCTCGCCGCCATGGATCCCATTCTCCACGCCTTTGA
GCTGCACCTTGTCGTCGACTGGGGGCGGCGTACCGGCCTCTTGGTCGATGCTGCTGACGGTGCTGCCATTGGCGT
CGCTGAGTGGTGGTGGCTGGCTGTGCCTTTGATACCGCGGCAGACATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail