Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3739
Gene name
LocationContig_24:38235..44134
Strand-
Gene length (bp)5899
Transcript length (bp)5736
Coding sequence length (bp)5736
Protein length (aa) 1912

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20222 DUF6581 Family of unknown function (DUF6581) 6.3E-103 1450 1859
PF04182 B-block_TFIIIC B-block binding subunit of TFIIIC 1.1E-11 141 201

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup378
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7576
Ophiocordyceps australis map64 (Brazil) OphauB2|3739 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|04740
Ophiocordyceps camponoti-floridani Ophcf2|04741
Ophiocordyceps camponoti-rufipedis Ophun1|1
Ophiocordyceps camponoti-rufipedis Ophun1|2
Ophiocordyceps kimflemingae Ophio5|4150
Ophiocordyceps kimflemingae Ophio5|4151
Ophiocordyceps subramaniannii Hirsu2|1081

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3739
MALDFEELIVHLLMLIACRGENGCTIDEIIRDIIEAVNPHCSSPLAPNLAPDTRKSLPDTACSTVWRWLADREDV
LVGRGREFNHLSLDELLSLPQASTTALAASSTSATSSDEAVRVFTTQATMWEAITGHGVDYKRVPKSEWQLLLGI
AGSRGQGILQGDLGRLTCQDKRSVPKRTDVLANKGYIIKRTTLVKGTKTSKMWLKALAPPVPKDSDSVPTPRPEF
DLSRQVLVENLDPVPWHHRWTGSDIDFEALATTLMAIVKEWGTLRLRDVKLKLGVLGQRWQMKVLAQTCRFLNAR
GAIQYVAAKLDNAIFKDCISFRRNMTAEDWQLFLSTGKRGRALLVPFGAEEEEEECRQQDRIESQLASKKLASQL
TPWTVEKPLPQTIVGMVQCSGPKGLSNSILRTLTLGQSFGRYLSSTTSAMTMGSEQPRQLAHLKLRSEHVRNGRD
SRLLFFVGEPDKGDAPASTCPQEEATTARAIEDLYGFLPAAQAGAETAEYQSLTNICIDGASVIGIGKNRGRRRR
NESGEGGTVSEKQEDGLLISDEALAETQMVQTRDNDEEQKKSRQQVEGQEKEEKEEQDGDEGEEAEEEAEEDQQL
SPRITRGKAKQQQTRSSSSSRLTHFKVGPSQPNGLLGQDVVSNSDSAANVSPKQTRSGRIKAQKRSDTHVDGQED
TGRNIDVADHVDRGEAASQGSSDKGRLQEQDEEQEKEQEDEDAYEETGEEVSQDEEPVAWPALRDRGSRGRGGKR
GKRGKRGRGSSRGRLRGGTSRTVRRPADAEASDPLPWKCSKCGKGWKNDVGLKYHVEKSQTACNQSYTAPPRREK
PSKPAADAPSRRLRRRRVHLGQENESDGSGSRLRRGGRGVEKQAKAEKKVKQQEAVMDRLGEMWKRLPPLIAKMD
PKAAAIVEAPGLVAWRKGAAARLLLQETGDQGLVSVFGPREAAERAPRAWDKGDSSQKGPEEDEEDADSKPRQSR
PGARKRMRASKTTDEAICSVIESLLEEQNGVMMGGWRLSKAVRAAWGPRFGDIAPPSDRECREAVKSMIKAKRVT
EQWHGFREGGGKGAIFSKCQLLLGPRVGAFSPAVLALVEKVKGSRPELIEGEAGDEESVSRRRMWRRGRRFLGDE
VVDLEAPVYAAKLASKRAGSGSGGGGGGGGGGGGGGGRAKRVKLSTARRGQDALALDDVLIAEPEREARAIVFVE
ANTWLGEASGDGQLGEAARETQAAWSMEQQALDEALRAGSAPCPDGYLFDRANTILGHAGSWPAINEGHFERVDG
SWTMRGWMPGPDWFRGASFVEQVDKRFVVRMQGRSQLGAAPVSRHERFLCRLRACRDVELAWTSLFASMGPMTLQ
INYSSGPLQQADAPAAETVWRPEEQLTPATLVGQSHGYESSASSLAEDDAWPEPTRLKTLPPSPSAPRGTARPRL
KRVALVSRALTALPSPLGDARQRQRPLGADQGQELMAAFIAVRALLGGTAKAVDWGLLMTLYPHVELVSLRRFWT
DALRRQGAYIANYTRLFHQRLIGAFEADELPVIDFDAIGDYDWRRLIAWTLDLARQEGPWVPASREALDRQYALQ
AASSARADWRETFFGATTSFFARYEAITSEPGAVPLTPARHAPAQPLLDAVDVAKSWVKALCGTSASRYSAQQVR
ARLRTLCPGDRQASSALFKTAVAQLQQQRVVARKSRMPPGHRPFGLSEWYVALLTRLAQASKYHDAAAFKARLDA
AFAARAPLPVPYTLSDGATMALTNLSAHGRICLGAVDVPHVPLGFEPGNYESRKFPKSYYHFALDATPTPTYQPT
PDIALVAAVQHEPPPCEGPEAALPQWVDIFGQPDAAWGRVVGAVCFLVATRGPMPCSAILAAMDPILHAFELHLV
VDWGRRTGLLVDAADGAAIGVAEWWWLAVPLIPRQT*
Coding >OphauB2|3739
ATGGCGCTGGATTTTGAGGAGCTGATTGTGCACTTGCTGATGCTGATTGCATGTCGCGGCGAGAATGGATGTACA
ATTGATGAGATTATAAGAGATATTATAGAGGCAGTGAATCCCCATTGTTCATCACCCCTGGCTCCGAATCTAGCT
CCAGACACCAGAAAGTCTTTGCCGGATACAGCATGTTCTACAGTGTGGCGCTGGCTGGCGGATCGAGAAGATGTA
TTGGTGGGCCGTGGGAGAGAATTCAACCATCTCTCACTTGATGAGCTCCTCAGCCTGCCCCAAGCTAGCACCACT
GCTTTGGCAGCAAGCAGCACCTCTGCCACCAGCAGCGATGAAGCCGTCAGGGTCTTCACAACACAAGCCACCATG
TGGGAGGCTATCACGGGCCACGGCGTCGACTACAAACGCGTACCCAAGTCTGAATGGCAGCTCCTTCTTGGCATT
GCAGGCAGCAGGGGCCAGGGGATCCTTCAGGGCGACTTGGGCCGCCTCACCTGCCAGGACAAGCGCTCGGTTCCC
AAGCGCACTGATGTGTTAGCCAACAAGGGCTACATCATCAAGAGGACGACACTAGTCAAGGGCACCAAGACGAGC
AAGATGTGGCTCAAGGCTTTGGCGCCGCCTGTGCCCAAAGATAGCGACAGTGTGCCTACACCTAGGCCTGAGTTT
GATCTCTCGCGGCAGGTGCTGGTGGAAAATCTGGATCCTGTGCCTTGGCACCATCGGTGGACGGGCAGCGACATT
GACTTTGAGGCTCTTGCCACGACGCTCATGGCTATTGTTAAGGAATGGGGTACATTGCGTCTACGGGATGTCAAG
CTGAAGTTGGGTGTCCTGGGTCAGCGCTGGCAGATGAAGGTGCTGGCACAGACGTGTCGATTTCTCAATGCTCGT
GGTGCTATTCAGTACGTGGCGGCTAAGCTTGACAATGCCATCTTCAAGGACTGTATTTCCTTTCGGCGAAACATG
ACGGCCGAGGACTGGCAACTCTTTTTATCCACGGGAAAACGAGGACGTGCTCTGCTAGTGCCGTTTGGAGCCGAG
GAGGAAGAAGAAGAATGCAGGCAACAAGACAGGATCGAGTCTCAGCTGGCGTCAAAAAAACTTGCCAGTCAGCTG
ACTCCGTGGACAGTGGAAAAGCCGTTGCCGCAGACGATTGTTGGCATGGTGCAGTGCAGCGGGCCAAAGGGCCTT
TCCAACTCTATTCTCCGAACGCTGACACTGGGCCAGTCTTTTGGCCGCTATCTCTCATCTACTACATCAGCCATG
ACAATGGGTAGCGAACAGCCACGGCAGCTGGCTCATCTGAAGCTGAGAAGCGAACATGTGAGAAACGGTAGAGAT
TCACGACTCTTGTTTTTTGTGGGAGAGCCAGACAAGGGGGATGCTCCTGCTTCCACATGTCCCCAAGAGGAAGCA
ACAACAGCTCGTGCCATTGAGGACTTGTATGGTTTTTTGCCTGCAGCTCAGGCAGGGGCAGAGACTGCAGAGTAT
CAGTCCCTGACAAATATTTGCATCGATGGAGCATCTGTGATTGGTATAGGTAAAAACCGGGGAAGGCGGAGAAGA
AATGAGTCAGGAGAAGGCGGCACAGTGTCTGAGAAGCAAGAGGATGGTTTGTTAATTTCGGATGAAGCTCTGGCT
GAGACTCAAATGGTACAAACAAGAGATAATGACGAGGAACAGAAGAAGTCTCGCCAGCAGGTAGAAGGGCAAGAG
AAGGAGGAAAAGGAAGAGCAAGATGGAGACGAGGGAGAAGAAGCAGAAGAGGAAGCAGAGGAGGATCAGCAGCTG
TCGCCTCGGATTACTCGCGGAAAGGCCAAGCAACAGCAGACCCGGTCATCTAGCTCCAGCAGATTAACACATTTC
AAGGTTGGCCCAAGTCAACCAAATGGTTTACTAGGCCAAGACGTCGTCTCCAACTCGGATAGCGCTGCAAATGTC
TCTCCAAAGCAGACGAGATCAGGTCGGATAAAGGCGCAGAAACGGTCCGATACCCATGTTGATGGACAAGAGGAT
ACGGGGCGAAATATAGACGTGGCAGACCATGTGGATAGGGGCGAAGCTGCAAGTCAAGGCTCGTCAGACAAAGGC
CGACTCCAGGAGCAAGACGAGGAGCAAGAAAAGGAGCAAGAAGATGAAGATGCATATGAGGAGACAGGAGAAGAG
GTCAGTCAGGATGAGGAGCCAGTAGCATGGCCGGCATTGCGTGACCGGGGCAGTCGAGGCAGAGGAGGAAAGCGA
GGAAAAAGAGGAAAACGGGGCAGAGGGTCGAGTCGTGGGCGGCTGCGTGGCGGCACGAGTAGGACAGTGCGACGA
CCAGCAGATGCCGAAGCGTCAGATCCGCTGCCGTGGAAATGCTCCAAGTGCGGCAAGGGATGGAAGAATGACGTT
GGCCTCAAGTATCATGTGGAAAAGTCACAGACTGCATGCAACCAATCATACACGGCGCCGCCGCGACGCGAGAAG
CCAAGCAAGCCAGCAGCGGATGCTCCTTCAAGAAGGCTGCGGCGACGACGTGTGCATCTGGGCCAGGAAAATGAG
AGCGATGGCTCGGGGAGCAGGCTGAGGCGTGGCGGCCGTGGGGTAGAGAAACAGGCCAAGGCAGAGAAGAAGGTG
AAGCAGCAGGAAGCAGTCATGGACCGGCTGGGTGAGATGTGGAAGAGACTACCGCCATTGATTGCCAAGATGGAC
CCCAAGGCGGCAGCCATTGTTGAGGCTCCAGGGCTGGTGGCATGGCGAAAGGGCGCTGCTGCTCGGCTCCTGCTG
CAAGAGACGGGGGACCAAGGGCTCGTTTCGGTCTTTGGGCCTCGAGAGGCGGCGGAGAGGGCGCCAAGGGCGTGG
GACAAGGGCGACAGCAGCCAAAAAGGGCCGGAAGAGGATGAAGAGGACGCGGATTCGAAGCCAAGGCAAAGTAGG
CCTGGCGCACGCAAACGCATGAGAGCAAGCAAGACGACAGACGAGGCCATCTGCAGCGTCATTGAGAGTCTGCTG
GAAGAGCAAAATGGCGTCATGATGGGCGGATGGCGGCTCTCCAAGGCCGTGAGGGCGGCATGGGGCCCGAGGTTT
GGCGACATTGCGCCGCCCAGCGATAGGGAGTGCCGGGAAGCAGTCAAGAGCATGATCAAGGCCAAGAGGGTAACG
GAGCAGTGGCACGGGTTTCGCGAAGGCGGCGGCAAAGGCGCCATCTTCTCCAAATGCCAGCTGCTGCTGGGACCG
CGGGTGGGCGCCTTTTCTCCGGCGGTGCTGGCGCTGGTGGAAAAGGTGAAGGGCTCGCGGCCCGAGCTGATTGAG
GGCGAGGCGGGCGACGAGGAGAGCGTGTCGCGGCGGCGCATGTGGCGGCGAGGGCGGCGCTTCCTGGGCGACGAG
GTGGTGGATCTGGAGGCGCCCGTGTATGCGGCCAAGTTGGCGAGCAAGAGGGCGGGCTCGGGCAGTGGTGGAGGA
GGTGGAGGAGGCGGAGGAGGCGGAGGAGGTGGTGGTAGGGCAAAGCGCGTCAAGCTGTCGACGGCGCGCAGAGGA
CAAGACGCGTTGGCGCTGGACGACGTGTTGATTGCGGAGCCGGAGCGGGAAGCAAGGGCCATTGTGTTTGTCGAG
GCGAATACGTGGCTGGGCGAGGCCTCGGGGGACGGGCAGCTGGGAGAGGCAGCTAGAGAGACACAGGCTGCATGG
AGCATGGAGCAGCAAGCCCTGGACGAGGCGCTGCGAGCAGGCTCGGCTCCTTGTCCCGACGGCTACCTCTTTGAC
AGGGCCAACACCATCCTGGGCCACGCAGGCAGCTGGCCGGCCATCAACGAGGGCCACTTTGAGCGCGTCGACGGC
AGCTGGACCATGCGGGGCTGGATGCCGGGCCCAGACTGGTTCCGCGGAGCCTCGTTTGTCGAGCAGGTGGACAAG
CGCTTCGTGGTGCGCATGCAGGGCCGCAGCCAGCTGGGCGCGGCGCCTGTCTCCCGCCATGAGCGCTTCCTGTGC
AGACTGCGCGCCTGTCGCGACGTGGAGCTGGCCTGGACGAGCTTGTTTGCCAGCATGGGCCCCATGACTCTTCAA
ATCAACTACTCGTCGGGCCCGCTTCAGCAGGCCGACGCGCCTGCGGCAGAGACGGTCTGGCGGCCCGAGGAGCAG
CTGACGCCGGCAACGCTCGTGGGCCAGAGCCACGGCTACGAATCGTCGGCTTCGTCGCTGGCCGAGGACGACGCG
TGGCCCGAGCCCACCAGACTCAAGACGCTGCCGCCGTCGCCGTCTGCTCCGCGCGGCACTGCCAGACCAAGGCTC
AAGCGCGTTGCCCTCGTCTCACGCGCGCTGACTGCTCTGCCCAGCCCACTCGGAGATGCTCGACAGCGCCAGCGA
CCCCTGGGCGCCGACCAAGGCCAGGAGCTCATGGCTGCCTTTATTGCCGTGCGGGCGCTGCTGGGCGGCACGGCA
AAGGCGGTTGACTGGGGCCTGCTCATGACGCTCTACCCACATGTCGAGCTCGTCAGCCTGCGCCGCTTCTGGACG
GATGCCTTGCGCCGCCAGGGCGCCTACATTGCCAACTACACGCGCCTCTTCCACCAGAGGCTGATTGGCGCCTTT
GAGGCGGACGAGCTGCCCGTCATTGACTTTGACGCCATTGGCGATTACGACTGGCGCCGCCTCATCGCCTGGACC
CTGGACCTGGCCCGCCAAGAGGGGCCGTGGGTGCCGGCATCGCGAGAGGCGCTCGACAGGCAGTATGCGCTGCAG
GCCGCCAGCAGCGCCAGGGCCGACTGGCGCGAGACCTTTTTTGGCGCCACCACGTCCTTTTTTGCCCGCTACGAG
GCCATTACGTCGGAGCCGGGCGCCGTGCCGCTGACGCCAGCCAGACACGCCCCAGCCCAGCCGCTGCTCGACGCC
GTCGACGTGGCCAAGTCGTGGGTCAAGGCGCTCTGTGGCACCAGCGCGTCGCGCTACTCGGCCCAGCAGGTGCGC
GCACGCCTGCGCACTCTTTGCCCCGGCGACCGCCAGGCCTCGTCGGCCCTCTTCAAGACGGCCGTGGCCCAGCTG
CAGCAGCAGCGTGTCGTGGCCCGCAAGAGCCGCATGCCGCCTGGCCACCGCCCCTTTGGCCTGAGCGAGTGGTAT
GTCGCCCTGCTGACGCGCCTGGCTCAGGCATCCAAGTACCACGACGCCGCCGCCTTTAAAGCCCGCCTCGACGCC
GCCTTTGCCGCCCGCGCGCCCCTGCCCGTGCCCTACACCCTGAGCGACGGCGCCACCATGGCCCTGACCAACCTC
AGCGCCCACGGCCGCATCTGCCTCGGAGCCGTCGACGTGCCTCATGTGCCCCTGGGCTTCGAGCCAGGCAACTAC
GAGAGCCGCAAGTTTCCAAAGTCGTACTACCACTTTGCCCTCGACGCCACTCCCACCCCCACATACCAGCCCACG
CCCGACATTGCCCTCGTTGCCGCCGTCCAGCACGAGCCGCCGCCCTGTGAGGGCCCCGAGGCCGCCCTGCCGCAA
TGGGTCGATATTTTTGGTCAGCCAGACGCCGCCTGGGGCCGAGTCGTTGGCGCCGTCTGCTTCCTCGTTGCCACG
CGCGGGCCCATGCCCTGCTCCGCCATCCTCGCCGCCATGGATCCCATTCTCCACGCCTTTGAGCTGCACCTTGTC
GTCGACTGGGGGCGGCGTACCGGCCTCTTGGTCGATGCTGCTGACGGTGCTGCCATTGGCGTCGCTGAGTGGTGG
TGGCTGGCTGTGCCTTTGATACCGCGGCAGACATGA
Transcript >OphauB2|3739
ATGGCGCTGGATTTTGAGGAGCTGATTGTGCACTTGCTGATGCTGATTGCATGTCGCGGCGAGAATGGATGTACA
ATTGATGAGATTATAAGAGATATTATAGAGGCAGTGAATCCCCATTGTTCATCACCCCTGGCTCCGAATCTAGCT
CCAGACACCAGAAAGTCTTTGCCGGATACAGCATGTTCTACAGTGTGGCGCTGGCTGGCGGATCGAGAAGATGTA
TTGGTGGGCCGTGGGAGAGAATTCAACCATCTCTCACTTGATGAGCTCCTCAGCCTGCCCCAAGCTAGCACCACT
GCTTTGGCAGCAAGCAGCACCTCTGCCACCAGCAGCGATGAAGCCGTCAGGGTCTTCACAACACAAGCCACCATG
TGGGAGGCTATCACGGGCCACGGCGTCGACTACAAACGCGTACCCAAGTCTGAATGGCAGCTCCTTCTTGGCATT
GCAGGCAGCAGGGGCCAGGGGATCCTTCAGGGCGACTTGGGCCGCCTCACCTGCCAGGACAAGCGCTCGGTTCCC
AAGCGCACTGATGTGTTAGCCAACAAGGGCTACATCATCAAGAGGACGACACTAGTCAAGGGCACCAAGACGAGC
AAGATGTGGCTCAAGGCTTTGGCGCCGCCTGTGCCCAAAGATAGCGACAGTGTGCCTACACCTAGGCCTGAGTTT
GATCTCTCGCGGCAGGTGCTGGTGGAAAATCTGGATCCTGTGCCTTGGCACCATCGGTGGACGGGCAGCGACATT
GACTTTGAGGCTCTTGCCACGACGCTCATGGCTATTGTTAAGGAATGGGGTACATTGCGTCTACGGGATGTCAAG
CTGAAGTTGGGTGTCCTGGGTCAGCGCTGGCAGATGAAGGTGCTGGCACAGACGTGTCGATTTCTCAATGCTCGT
GGTGCTATTCAGTACGTGGCGGCTAAGCTTGACAATGCCATCTTCAAGGACTGTATTTCCTTTCGGCGAAACATG
ACGGCCGAGGACTGGCAACTCTTTTTATCCACGGGAAAACGAGGACGTGCTCTGCTAGTGCCGTTTGGAGCCGAG
GAGGAAGAAGAAGAATGCAGGCAACAAGACAGGATCGAGTCTCAGCTGGCGTCAAAAAAACTTGCCAGTCAGCTG
ACTCCGTGGACAGTGGAAAAGCCGTTGCCGCAGACGATTGTTGGCATGGTGCAGTGCAGCGGGCCAAAGGGCCTT
TCCAACTCTATTCTCCGAACGCTGACACTGGGCCAGTCTTTTGGCCGCTATCTCTCATCTACTACATCAGCCATG
ACAATGGGTAGCGAACAGCCACGGCAGCTGGCTCATCTGAAGCTGAGAAGCGAACATGTGAGAAACGGTAGAGAT
TCACGACTCTTGTTTTTTGTGGGAGAGCCAGACAAGGGGGATGCTCCTGCTTCCACATGTCCCCAAGAGGAAGCA
ACAACAGCTCGTGCCATTGAGGACTTGTATGGTTTTTTGCCTGCAGCTCAGGCAGGGGCAGAGACTGCAGAGTAT
CAGTCCCTGACAAATATTTGCATCGATGGAGCATCTGTGATTGGTATAGGTAAAAACCGGGGAAGGCGGAGAAGA
AATGAGTCAGGAGAAGGCGGCACAGTGTCTGAGAAGCAAGAGGATGGTTTGTTAATTTCGGATGAAGCTCTGGCT
GAGACTCAAATGGTACAAACAAGAGATAATGACGAGGAACAGAAGAAGTCTCGCCAGCAGGTAGAAGGGCAAGAG
AAGGAGGAAAAGGAAGAGCAAGATGGAGACGAGGGAGAAGAAGCAGAAGAGGAAGCAGAGGAGGATCAGCAGCTG
TCGCCTCGGATTACTCGCGGAAAGGCCAAGCAACAGCAGACCCGGTCATCTAGCTCCAGCAGATTAACACATTTC
AAGGTTGGCCCAAGTCAACCAAATGGTTTACTAGGCCAAGACGTCGTCTCCAACTCGGATAGCGCTGCAAATGTC
TCTCCAAAGCAGACGAGATCAGGTCGGATAAAGGCGCAGAAACGGTCCGATACCCATGTTGATGGACAAGAGGAT
ACGGGGCGAAATATAGACGTGGCAGACCATGTGGATAGGGGCGAAGCTGCAAGTCAAGGCTCGTCAGACAAAGGC
CGACTCCAGGAGCAAGACGAGGAGCAAGAAAAGGAGCAAGAAGATGAAGATGCATATGAGGAGACAGGAGAAGAG
GTCAGTCAGGATGAGGAGCCAGTAGCATGGCCGGCATTGCGTGACCGGGGCAGTCGAGGCAGAGGAGGAAAGCGA
GGAAAAAGAGGAAAACGGGGCAGAGGGTCGAGTCGTGGGCGGCTGCGTGGCGGCACGAGTAGGACAGTGCGACGA
CCAGCAGATGCCGAAGCGTCAGATCCGCTGCCGTGGAAATGCTCCAAGTGCGGCAAGGGATGGAAGAATGACGTT
GGCCTCAAGTATCATGTGGAAAAGTCACAGACTGCATGCAACCAATCATACACGGCGCCGCCGCGACGCGAGAAG
CCAAGCAAGCCAGCAGCGGATGCTCCTTCAAGAAGGCTGCGGCGACGACGTGTGCATCTGGGCCAGGAAAATGAG
AGCGATGGCTCGGGGAGCAGGCTGAGGCGTGGCGGCCGTGGGGTAGAGAAACAGGCCAAGGCAGAGAAGAAGGTG
AAGCAGCAGGAAGCAGTCATGGACCGGCTGGGTGAGATGTGGAAGAGACTACCGCCATTGATTGCCAAGATGGAC
CCCAAGGCGGCAGCCATTGTTGAGGCTCCAGGGCTGGTGGCATGGCGAAAGGGCGCTGCTGCTCGGCTCCTGCTG
CAAGAGACGGGGGACCAAGGGCTCGTTTCGGTCTTTGGGCCTCGAGAGGCGGCGGAGAGGGCGCCAAGGGCGTGG
GACAAGGGCGACAGCAGCCAAAAAGGGCCGGAAGAGGATGAAGAGGACGCGGATTCGAAGCCAAGGCAAAGTAGG
CCTGGCGCACGCAAACGCATGAGAGCAAGCAAGACGACAGACGAGGCCATCTGCAGCGTCATTGAGAGTCTGCTG
GAAGAGCAAAATGGCGTCATGATGGGCGGATGGCGGCTCTCCAAGGCCGTGAGGGCGGCATGGGGCCCGAGGTTT
GGCGACATTGCGCCGCCCAGCGATAGGGAGTGCCGGGAAGCAGTCAAGAGCATGATCAAGGCCAAGAGGGTAACG
GAGCAGTGGCACGGGTTTCGCGAAGGCGGCGGCAAAGGCGCCATCTTCTCCAAATGCCAGCTGCTGCTGGGACCG
CGGGTGGGCGCCTTTTCTCCGGCGGTGCTGGCGCTGGTGGAAAAGGTGAAGGGCTCGCGGCCCGAGCTGATTGAG
GGCGAGGCGGGCGACGAGGAGAGCGTGTCGCGGCGGCGCATGTGGCGGCGAGGGCGGCGCTTCCTGGGCGACGAG
GTGGTGGATCTGGAGGCGCCCGTGTATGCGGCCAAGTTGGCGAGCAAGAGGGCGGGCTCGGGCAGTGGTGGAGGA
GGTGGAGGAGGCGGAGGAGGCGGAGGAGGTGGTGGTAGGGCAAAGCGCGTCAAGCTGTCGACGGCGCGCAGAGGA
CAAGACGCGTTGGCGCTGGACGACGTGTTGATTGCGGAGCCGGAGCGGGAAGCAAGGGCCATTGTGTTTGTCGAG
GCGAATACGTGGCTGGGCGAGGCCTCGGGGGACGGGCAGCTGGGAGAGGCAGCTAGAGAGACACAGGCTGCATGG
AGCATGGAGCAGCAAGCCCTGGACGAGGCGCTGCGAGCAGGCTCGGCTCCTTGTCCCGACGGCTACCTCTTTGAC
AGGGCCAACACCATCCTGGGCCACGCAGGCAGCTGGCCGGCCATCAACGAGGGCCACTTTGAGCGCGTCGACGGC
AGCTGGACCATGCGGGGCTGGATGCCGGGCCCAGACTGGTTCCGCGGAGCCTCGTTTGTCGAGCAGGTGGACAAG
CGCTTCGTGGTGCGCATGCAGGGCCGCAGCCAGCTGGGCGCGGCGCCTGTCTCCCGCCATGAGCGCTTCCTGTGC
AGACTGCGCGCCTGTCGCGACGTGGAGCTGGCCTGGACGAGCTTGTTTGCCAGCATGGGCCCCATGACTCTTCAA
ATCAACTACTCGTCGGGCCCGCTTCAGCAGGCCGACGCGCCTGCGGCAGAGACGGTCTGGCGGCCCGAGGAGCAG
CTGACGCCGGCAACGCTCGTGGGCCAGAGCCACGGCTACGAATCGTCGGCTTCGTCGCTGGCCGAGGACGACGCG
TGGCCCGAGCCCACCAGACTCAAGACGCTGCCGCCGTCGCCGTCTGCTCCGCGCGGCACTGCCAGACCAAGGCTC
AAGCGCGTTGCCCTCGTCTCACGCGCGCTGACTGCTCTGCCCAGCCCACTCGGAGATGCTCGACAGCGCCAGCGA
CCCCTGGGCGCCGACCAAGGCCAGGAGCTCATGGCTGCCTTTATTGCCGTGCGGGCGCTGCTGGGCGGCACGGCA
AAGGCGGTTGACTGGGGCCTGCTCATGACGCTCTACCCACATGTCGAGCTCGTCAGCCTGCGCCGCTTCTGGACG
GATGCCTTGCGCCGCCAGGGCGCCTACATTGCCAACTACACGCGCCTCTTCCACCAGAGGCTGATTGGCGCCTTT
GAGGCGGACGAGCTGCCCGTCATTGACTTTGACGCCATTGGCGATTACGACTGGCGCCGCCTCATCGCCTGGACC
CTGGACCTGGCCCGCCAAGAGGGGCCGTGGGTGCCGGCATCGCGAGAGGCGCTCGACAGGCAGTATGCGCTGCAG
GCCGCCAGCAGCGCCAGGGCCGACTGGCGCGAGACCTTTTTTGGCGCCACCACGTCCTTTTTTGCCCGCTACGAG
GCCATTACGTCGGAGCCGGGCGCCGTGCCGCTGACGCCAGCCAGACACGCCCCAGCCCAGCCGCTGCTCGACGCC
GTCGACGTGGCCAAGTCGTGGGTCAAGGCGCTCTGTGGCACCAGCGCGTCGCGCTACTCGGCCCAGCAGGTGCGC
GCACGCCTGCGCACTCTTTGCCCCGGCGACCGCCAGGCCTCGTCGGCCCTCTTCAAGACGGCCGTGGCCCAGCTG
CAGCAGCAGCGTGTCGTGGCCCGCAAGAGCCGCATGCCGCCTGGCCACCGCCCCTTTGGCCTGAGCGAGTGGTAT
GTCGCCCTGCTGACGCGCCTGGCTCAGGCATCCAAGTACCACGACGCCGCCGCCTTTAAAGCCCGCCTCGACGCC
GCCTTTGCCGCCCGCGCGCCCCTGCCCGTGCCCTACACCCTGAGCGACGGCGCCACCATGGCCCTGACCAACCTC
AGCGCCCACGGCCGCATCTGCCTCGGAGCCGTCGACGTGCCTCATGTGCCCCTGGGCTTCGAGCCAGGCAACTAC
GAGAGCCGCAAGTTTCCAAAGTCGTACTACCACTTTGCCCTCGACGCCACTCCCACCCCCACATACCAGCCCACG
CCCGACATTGCCCTCGTTGCCGCCGTCCAGCACGAGCCGCCGCCCTGTGAGGGCCCCGAGGCCGCCCTGCCGCAA
TGGGTCGATATTTTTGGTCAGCCAGACGCCGCCTGGGGCCGAGTCGTTGGCGCCGTCTGCTTCCTCGTTGCCACG
CGCGGGCCCATGCCCTGCTCCGCCATCCTCGCCGCCATGGATCCCATTCTCCACGCCTTTGAGCTGCACCTTGTC
GTCGACTGGGGGCGGCGTACCGGCCTCTTGGTCGATGCTGCTGACGGTGCTGCCATTGGCGTCGCTGAGTGGTGG
TGGCTGGCTGTGCCTTTGATACCGCGGCAGACATGA
Gene >OphauB2|3739
ATGGCGCTGGATTTTGAGGAGCTGATTGTGCACTTGCTGATGCTGATTGCATGTCGCGGCGAGAATGGTGAGTTT
ACCTGGCCGGTGGAAGGAGCAAGCAATCATAGCCTTGGAATATCGTGACGAATGTCAATAGCCAGTCTCATATGC
AACGTCTCTCACTCATCATTGCCCTTTTTAATCAGCAGCAAATATGCCGTTGGCTTTATGAGCTGACAGAGGTGC
AACAGGATGTACAATTGATGAGATTATAAGAGATATTATAGAGGCAGTGAATCCCCATTGTTCATCACCCCTGGC
TCCGAATCTAGCTCCAGACACCAGAAAGTCTTTGCCGGATACAGCATGTTCTACAGTGTGGCGCTGGCTGGCGGA
TCGAGAAGATGTATTGGTGGGCCGTGGGAGAGAATTCAACCATCTCTCACTTGATGAGCTCCTCAGCCTGCCCCA
AGCTAGCACCACTGCTTTGGCAGCAAGCAGCACCTCTGCCACCAGCAGCGATGAAGCCGTCAGGGTCTTCACAAC
ACAAGCCACCATGTGGGAGGCTATCACGGGCCACGGCGTCGACTACAAACGCGTACCCAAGTCTGAATGGCAGCT
CCTTCTTGGCATTGCAGGCAGCAGGGGCCAGGGGATCCTTCAGGGCGACTTGGGCCGCCTCACCTGCCAGGACAA
GCGCTCGGTTCCCAAGCGCACTGATGTGTTAGCCAACAAGGGCTACATCATCAAGAGGACGACACTAGTCAAGGG
CACCAAGACGAGCAAGATGTGGCTCAAGGCTTTGGCGCCGCCTGTGCCCAAAGATAGCGACAGTGTGCCTACACC
TAGGCCTGAGTTTGATCTCTCGCGGCAGGTGCTGGTGGAAAATCTGGATCCTGTGCCTTGGCACCATCGGTGGAC
GGGCAGCGACATTGACTTTGAGGCTCTTGCCACGACGCTCATGGCTATTGTTAAGGAATGGGGTACATTGCGTCT
ACGGGATGTCAAGCTGAAGTTGGGTGTCCTGGGTCAGCGCTGGCAGATGAAGGTGCTGGCACAGACGTGTCGATT
TCTCAATGCTCGTGGTGCTATTCAGTACGTGGCGGCTAAGCTTGACAATGCCATCTTCAAGGACTGTATTTCCTT
TCGGCGAAACATGACGGCCGAGGACTGGCAACTCTTTTTATCCACGGGAAAACGAGGACGTGCTCTGCTAGTGCC
GTTTGGAGCCGAGGAGGAAGAAGAAGAATGCAGGCAACAAGACAGGATCGAGTCTCAGCTGGCGTCAAAAAAACT
TGCCAGTCAGCTGACTCCGTGGACAGTGGAAAAGCCGTTGCCGCAGACGATTGTTGGCATGGTGCAGTGCAGCGG
GCCAAAGGGCCTTTCCAACTCTATTCTCCGAACGCTGACACTGGGCCAGTCTTTTGGCCGCTATCTCTCATCTAC
TACATCAGCCATGACAATGGGTAGCGAACAGCCACGGCAGCTGGCTCATCTGAAGCTGAGAAGCGAACATGTGAG
AAACGGTAGAGATTCACGACTCTTGTTTTTTGTGGGAGAGCCAGACAAGGGGGATGCTCCTGCTTCCACATGTCC
CCAAGAGGAAGCAACAACAGCTCGTGCCATTGAGGACTTGTATGGTTTTTTGCCTGCAGCTCAGGCAGGGGCAGA
GACTGCAGAGTATCAGTCCCTGACAAATATTTGCATCGATGGAGCATCTGTGATTGGTATAGGTAAAAACCGGGG
AAGGCGGAGAAGAAATGAGTCAGGAGAAGGCGGCACAGTGTCTGAGAAGCAAGAGGATGGTTTGTTAATTTCGGA
TGAAGCTCTGGCTGAGACTCAAATGGTACAAACAAGAGATAATGACGAGGAACAGAAGAAGTCTCGCCAGCAGGT
AGAAGGGCAAGAGAAGGAGGAAAAGGAAGAGCAAGATGGAGACGAGGGAGAAGAAGCAGAAGAGGAAGCAGAGGA
GGATCAGCAGCTGTCGCCTCGGATTACTCGCGGAAAGGCCAAGCAACAGCAGACCCGGTCATCTAGCTCCAGCAG
ATTAACACATTTCAAGGTTGGCCCAAGTCAACCAAATGGTTTACTAGGCCAAGACGTCGTCTCCAACTCGGATAG
CGCTGCAAATGTCTCTCCAAAGCAGACGAGATCAGGTCGGATAAAGGCGCAGAAACGGTCCGATACCCATGTTGA
TGGACAAGAGGATACGGGGCGAAATATAGACGTGGCAGACCATGTGGATAGGGGCGAAGCTGCAAGTCAAGGCTC
GTCAGACAAAGGCCGACTCCAGGAGCAAGACGAGGAGCAAGAAAAGGAGCAAGAAGATGAAGATGCATATGAGGA
GACAGGAGAAGAGGTCAGTCAGGATGAGGAGCCAGTAGCATGGCCGGCATTGCGTGACCGGGGCAGTCGAGGCAG
AGGAGGAAAGCGAGGAAAAAGAGGAAAACGGGGCAGAGGGTCGAGTCGTGGGCGGCTGCGTGGCGGCACGAGTAG
GACAGTGCGACGACCAGCAGATGCCGAAGCGTCAGATCCGCTGCCGTGGAAATGCTCCAAGTGCGGCAAGGGATG
GAAGAATGACGTTGGCCTCAAGTATCATGTGGAAAAGTCACAGACTGCATGCAACCAATCATACACGGCGCCGCC
GCGACGCGAGAAGCCAAGCAAGCCAGCAGCGGATGCTCCTTCAAGAAGGCTGCGGCGACGACGTGTGCATCTGGG
CCAGGAAAATGAGAGCGATGGCTCGGGGAGCAGGCTGAGGCGTGGCGGCCGTGGGGTAGAGAAACAGGCCAAGGC
AGAGAAGAAGGTGAAGCAGCAGGAAGCAGTCATGGACCGGCTGGGTGAGATGTGGAAGAGACTACCGCCATTGAT
TGCCAAGATGGACCCCAAGGCGGCAGCCATTGTTGAGGCTCCAGGGCTGGTGGCATGGCGAAAGGGCGCTGCTGC
TCGGCTCCTGCTGCAAGAGACGGGGGACCAAGGGCTCGTTTCGGTCTTTGGGCCTCGAGAGGCGGCGGAGAGGGC
GCCAAGGGCGTGGGACAAGGGCGACAGCAGCCAAAAAGGGCCGGAAGAGGATGAAGAGGACGCGGATTCGAAGCC
AAGGCAAAGTAGGCCTGGCGCACGCAAACGCATGAGAGCAAGCAAGACGACAGACGAGGCCATCTGCAGCGTCAT
TGAGAGTCTGCTGGAAGAGCAAAATGGCGTCATGATGGGCGGATGGCGGCTCTCCAAGGCCGTGAGGGCGGCATG
GGGCCCGAGGTTTGGCGACATTGCGCCGCCCAGCGATAGGGAGTGCCGGGAAGCAGTCAAGAGCATGATCAAGGC
CAAGAGGGTAACGGAGCAGTGGCACGGGTTTCGCGAAGGCGGCGGCAAAGGCGCCATCTTCTCCAAATGCCAGCT
GCTGCTGGGACCGCGGGTGGGCGCCTTTTCTCCGGCGGTGCTGGCGCTGGTGGAAAAGGTGAAGGGCTCGCGGCC
CGAGCTGATTGAGGGCGAGGCGGGCGACGAGGAGAGCGTGTCGCGGCGGCGCATGTGGCGGCGAGGGCGGCGCTT
CCTGGGCGACGAGGTGGTGGATCTGGAGGCGCCCGTGTATGCGGCCAAGTTGGCGAGCAAGAGGGCGGGCTCGGG
CAGTGGTGGAGGAGGTGGAGGAGGCGGAGGAGGCGGAGGAGGTGGTGGTAGGGCAAAGCGCGTCAAGCTGTCGAC
GGCGCGCAGAGGACAAGACGCGTTGGCGCTGGACGACGTGTTGATTGCGGAGCCGGAGCGGGAAGCAAGGGCCAT
TGTGTTTGTCGAGGCGAATACGTGGCTGGGCGAGGCCTCGGGGGACGGGCAGCTGGGAGAGGCAGCTAGAGAGAC
ACAGGCTGCATGGAGCATGGAGCAGCAAGCCCTGGACGAGGCGCTGCGAGCAGGCTCGGCTCCTTGTCCCGACGG
CTACCTCTTTGACAGGGCCAACACCATCCTGGGCCACGCAGGCAGCTGGCCGGCCATCAACGAGGGCCACTTTGA
GCGCGTCGACGGCAGCTGGACCATGCGGGGCTGGATGCCGGGCCCAGACTGGTTCCGCGGAGCCTCGTTTGTCGA
GCAGGTGGACAAGCGCTTCGTGGTGCGCATGCAGGGCCGCAGCCAGCTGGGCGCGGCGCCTGTCTCCCGCCATGA
GCGCTTCCTGTGCAGACTGCGCGCCTGTCGCGACGTGGAGCTGGCCTGGACGAGCTTGTTTGCCAGCATGGGCCC
CATGACTCTTCAAATCAACTACTCGTCGGGCCCGCTTCAGCAGGCCGACGCGCCTGCGGCAGAGACGGTCTGGCG
GCCCGAGGAGCAGCTGACGCCGGCAACGCTCGTGGGCCAGAGCCACGGCTACGAATCGTCGGCTTCGTCGCTGGC
CGAGGACGACGCGTGGCCCGAGCCCACCAGACTCAAGACGCTGCCGCCGTCGCCGTCTGCTCCGCGCGGCACTGC
CAGACCAAGGCTCAAGCGCGTTGCCCTCGTCTCACGCGCGCTGACTGCTCTGCCCAGCCCACTCGGAGATGCTCG
ACAGCGCCAGCGACCCCTGGGCGCCGACCAAGGCCAGGAGCTCATGGCTGCCTTTATTGCCGTGCGGGCGCTGCT
GGGCGGCACGGCAAAGGCGGTTGACTGGGGCCTGCTCATGACGCTCTACCCACATGTCGAGCTCGTCAGCCTGCG
CCGCTTCTGGACGGATGCCTTGCGCCGCCAGGGCGCCTACATTGCCAACTACACGCGCCTCTTCCACCAGAGGCT
GATTGGCGCCTTTGAGGCGGACGAGCTGCCCGTCATTGACTTTGACGCCATTGGCGATTACGACTGGCGCCGCCT
CATCGCCTGGACCCTGGACCTGGCCCGCCAAGAGGGGCCGTGGGTGCCGGCATCGCGAGAGGCGCTCGACAGGCA
GTATGCGCTGCAGGCCGCCAGCAGCGCCAGGGCCGACTGGCGCGAGACCTTTTTTGGCGCCACCACGTCCTTTTT
TGCCCGCTACGAGGCCATTACGTCGGAGCCGGGCGCCGTGCCGCTGACGCCAGCCAGACACGCCCCAGCCCAGCC
GCTGCTCGACGCCGTCGACGTGGCCAAGTCGTGGGTCAAGGCGCTCTGTGGCACCAGCGCGTCGCGCTACTCGGC
CCAGCAGGTGCGCGCACGCCTGCGCACTCTTTGCCCCGGCGACCGCCAGGCCTCGTCGGCCCTCTTCAAGACGGC
CGTGGCCCAGCTGCAGCAGCAGCGTGTCGTGGCCCGCAAGAGCCGCATGCCGCCTGGCCACCGCCCCTTTGGCCT
GAGCGAGTGGTATGTCGCCCTGCTGACGCGCCTGGCTCAGGCATCCAAGTACCACGACGCCGCCGCCTTTAAAGC
CCGCCTCGACGCCGCCTTTGCCGCCCGCGCGCCCCTGCCCGTGCCCTACACCCTGAGCGACGGCGCCACCATGGC
CCTGACCAACCTCAGCGCCCACGGCCGCATCTGCCTCGGAGCCGTCGACGTGCCTCATGTGCCCCTGGGCTTCGA
GCCAGGCAACTACGAGAGCCGCAAGTTTCCAAAGTCGTACTACCACTTTGCCCTCGACGCCACTCCCACCCCCAC
ATACCAGCCCACGCCCGACATTGCCCTCGTTGCCGCCGTCCAGCACGAGCCGCCGCCCTGTGAGGGCCCCGAGGC
CGCCCTGCCGCAATGGGTCGATATTTTTGGTCAGCCAGACGCCGCCTGGGGCCGAGTCGTTGGCGCCGTCTGCTT
CCTCGTTGCCACGCGCGGGCCCATGCCCTGCTCCGCCATCCTCGCCGCCATGGATCCCATTCTCCACGCCTTTGA
GCTGCACCTTGTCGTCGACTGGGGGCGGCGTACCGGCCTCTTGGTCGATGCTGCTGACGGTGCTGCCATTGGCGT
CGCTGAGTGGTGGTGGCTGGCTGTGCCTTTGATACCGCGGCAGACATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail