Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3723
Gene name
LocationContig_239:16877..18540
Strand-
Gene length (bp)1663
Transcript length (bp)1503
Coding sequence length (bp)1503
Protein length (aa) 501

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00646 F-box F-box domain 3.2E-05 7 43

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup714
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2421
Ophiocordyceps australis 1348a (Ghana) OphauG2|882
Ophiocordyceps australis map64 (Brazil) OphauB2|3723 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|03033
Ophiocordyceps camponoti-rufipedis Ophun1|7238
Ophiocordyceps kimflemingae Ophio5|823
Ophiocordyceps subramaniannii Hirsu2|158

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3723
MAQYNILDELSPEIINLILEQLRALDIAFVLTLRLVCRRFNDFATPASYRLIHLNERILSPTAEQLYPHALEHIS
QHTNHVSVRSDLDLPSVGRILRLVKRLLSIRWHYVAQQDRTPRIWLPSAMLNQEQVKSNRTEIFIENLPLGGAQH
DLDQSCFSATLTKHLVSLKLCNSEPPLTTRPNTLKLLVVKSRRLKTLHYRDLGIGTSFCFNSDERLPPVAHLVLC
SYNWHHSADEVRRHWDFSGIQSLQMVNVPVCNFFKSVELDHLCRLHTLKVGEQSGHLHQTWGGATGFLYQAIKHH
IDALQTLELTCKTALFGLDALERHARTLQVLRFQDHVGFQDDSRTCPTLDYKSVRALASALVHVHTLELDMDTTE
PTEFLEAVCLFPRLHTLTLHVQTRVRPVDEAVVHPDADDEAVAEMLRLLLRRRKGGVAWRRVTINVGGWRRAMVR
RVGYEWKKQNERGVFAERCFVMETDGESGYAVRDEACQKGSLGRPLADEA*
Coding >OphauB2|3723
ATGGCCCAGTACAATATTCTAGATGAATTGTCTCCAGAGATTATCAATCTCATCTTGGAACAGCTACGAGCCCTT
GATATAGCCTTTGTCTTGACGCTGCGTTTAGTCTGTAGACGGTTCAACGACTTTGCTACACCGGCGAGCTACCGA
CTGATTCACCTCAATGAGCGCATCCTGAGTCCGACGGCAGAGCAATTATATCCTCATGCCCTGGAGCATATTTCA
CAGCACACCAATCACGTGTCTGTGCGCAGCGACCTGGATTTGCCGAGTGTAGGGCGGATTCTGCGCTTGGTCAAG
AGGCTCTTGTCCATACGCTGGCATTATGTTGCCCAGCAGGATCGCACCCCCCGGATTTGGCTGCCATCTGCCATG
CTGAACCAAGAGCAGGTCAAGAGCAACAGAACGGAAATATTCATCGAGAACCTACCATTGGGAGGAGCTCAACAT
GATCTCGATCAGTCATGCTTCAGCGCGACTTTGACCAAGCACTTGGTGTCTCTCAAGCTGTGCAATTCGGAGCCG
CCGCTAACAACGAGGCCTAATACGCTCAAGCTTCTCGTGGTGAAATCGCGACGTTTGAAGACTCTGCATTACCGA
GACCTGGGCATAGGCACAAGCTTTTGCTTCAATAGCGACGAACGGCTACCGCCAGTGGCGCATTTGGTGCTCTGC
TCGTACAACTGGCATCACTCGGCCGACGAAGTCAGGCGGCATTGGGACTTTTCAGGCATACAATCCTTACAGATG
GTGAATGTTCCCGTGTGCAACTTTTTCAAGTCGGTTGAACTGGACCATCTCTGCCGGCTGCATACACTCAAGGTT
GGCGAGCAAAGTGGACACTTGCACCAGACATGGGGCGGGGCGACAGGCTTCCTGTACCAAGCTATCAAGCACCAC
ATTGATGCACTGCAGACTCTAGAGCTGACGTGCAAGACGGCATTGTTTGGGCTCGACGCGCTAGAGCGACACGCC
AGGACGCTGCAGGTGCTTCGTTTTCAAGACCACGTGGGCTTCCAAGACGATAGCAGGACGTGCCCGACGCTAGAC
TACAAGTCGGTCCGCGCACTGGCGTCTGCTCTAGTCCACGTGCACACGCTTGAGCTGGACATGGACACGACAGAG
CCGACGGAATTCCTCGAGGCCGTGTGTCTGTTTCCGCGGCTGCACACGCTGACGTTGCATGTGCAGACGCGGGTG
CGGCCAGTGGACGAGGCGGTGGTGCACCCGGATGCTGATGATGAGGCGGTGGCGGAGATGCTGAGGCTTTTGCTG
AGGCGGCGCAAGGGAGGCGTGGCATGGCGGCGCGTCACCATCAATGTCGGGGGGTGGCGGCGGGCCATGGTGAGA
AGGGTGGGATATGAGTGGAAGAAGCAGAATGAGCGGGGAGTGTTTGCAGAGCGATGTTTTGTCATGGAGACGGAT
GGCGAGAGTGGGTATGCTGTGAGGGATGAGGCGTGCCAGAAAGGAAGCCTGGGGCGGCCGCTGGCGGACGAGGCA
TAG
Transcript >OphauB2|3723
ATGGCCCAGTACAATATTCTAGATGAATTGTCTCCAGAGATTATCAATCTCATCTTGGAACAGCTACGAGCCCTT
GATATAGCCTTTGTCTTGACGCTGCGTTTAGTCTGTAGACGGTTCAACGACTTTGCTACACCGGCGAGCTACCGA
CTGATTCACCTCAATGAGCGCATCCTGAGTCCGACGGCAGAGCAATTATATCCTCATGCCCTGGAGCATATTTCA
CAGCACACCAATCACGTGTCTGTGCGCAGCGACCTGGATTTGCCGAGTGTAGGGCGGATTCTGCGCTTGGTCAAG
AGGCTCTTGTCCATACGCTGGCATTATGTTGCCCAGCAGGATCGCACCCCCCGGATTTGGCTGCCATCTGCCATG
CTGAACCAAGAGCAGGTCAAGAGCAACAGAACGGAAATATTCATCGAGAACCTACCATTGGGAGGAGCTCAACAT
GATCTCGATCAGTCATGCTTCAGCGCGACTTTGACCAAGCACTTGGTGTCTCTCAAGCTGTGCAATTCGGAGCCG
CCGCTAACAACGAGGCCTAATACGCTCAAGCTTCTCGTGGTGAAATCGCGACGTTTGAAGACTCTGCATTACCGA
GACCTGGGCATAGGCACAAGCTTTTGCTTCAATAGCGACGAACGGCTACCGCCAGTGGCGCATTTGGTGCTCTGC
TCGTACAACTGGCATCACTCGGCCGACGAAGTCAGGCGGCATTGGGACTTTTCAGGCATACAATCCTTACAGATG
GTGAATGTTCCCGTGTGCAACTTTTTCAAGTCGGTTGAACTGGACCATCTCTGCCGGCTGCATACACTCAAGGTT
GGCGAGCAAAGTGGACACTTGCACCAGACATGGGGCGGGGCGACAGGCTTCCTGTACCAAGCTATCAAGCACCAC
ATTGATGCACTGCAGACTCTAGAGCTGACGTGCAAGACGGCATTGTTTGGGCTCGACGCGCTAGAGCGACACGCC
AGGACGCTGCAGGTGCTTCGTTTTCAAGACCACGTGGGCTTCCAAGACGATAGCAGGACGTGCCCGACGCTAGAC
TACAAGTCGGTCCGCGCACTGGCGTCTGCTCTAGTCCACGTGCACACGCTTGAGCTGGACATGGACACGACAGAG
CCGACGGAATTCCTCGAGGCCGTGTGTCTGTTTCCGCGGCTGCACACGCTGACGTTGCATGTGCAGACGCGGGTG
CGGCCAGTGGACGAGGCGGTGGTGCACCCGGATGCTGATGATGAGGCGGTGGCGGAGATGCTGAGGCTTTTGCTG
AGGCGGCGCAAGGGAGGCGTGGCATGGCGGCGCGTCACCATCAATGTCGGGGGGTGGCGGCGGGCCATGGTGAGA
AGGGTGGGATATGAGTGGAAGAAGCAGAATGAGCGGGGAGTGTTTGCAGAGCGATGTTTTGTCATGGAGACGGAT
GGCGAGAGTGGGTATGCTGTGAGGGATGAGGCGTGCCAGAAAGGAAGCCTGGGGCGGCCGCTGGCGGACGAGGCA
TAG
Gene >OphauB2|3723
ATGGCCCAGTACAATATTCTAGATGAATTGTCTCCAGAGATTATCAATCTCATCTTGGAACAGGTGAGTCACTGG
CTCCTCGTGTAACCCCTTTTCCAACTATTTTTCCGGATCCAGATATTGACAGAACCAGCTACGAGCCCTTGATAT
AGCCTTTGTCTTGACGCTGCGTTTAGTCTGTAGACGGTTCAACGACTTTGCTACACCGGCGAGCTACCGACTGAT
TCACCTCAATGAGCGCATCCTGAGTCCGACGGCAGAGCAATTATATCCTCATGCCCTGGAGCATATTTCACAGCA
CACCAATCACGTGTCTGTGCGCAGCGACCTGGATTTGCCGAGTGTAGGGCGGATTCTGCGCTTGGTCAAGAGGCT
CTTGTCCATACGGTGCGCTGCCTGTTCTTTAAAGGGAGGGGGGGGATCTTGTGCTACATCTGGATAGGGCTGACT
GGAGAATTGCTTGGTTGGGGGCCACAGCTGGCATTATGTTGCCCAGCAGGATCGCACCCCCCGGATTTGGCTGCC
ATCTGCCATGCTGAACCAAGAGCAGGTCAAGAGCAACAGAACGGAAATATTCATCGAGAACCTACCATTGGGAGG
AGCTCAACATGATCTCGATCAGTCATGCTTCAGCGCGACTTTGACCAAGCACTTGGTGTCTCTCAAGCTGTGCAA
TTCGGAGCCGCCGCTAACAACGAGGCCTAATACGCTCAAGCTTCTCGTGGTGAAATCGCGACGTTTGAAGACTCT
GCATTACCGAGACCTGGGCATAGGCACAAGCTTTTGCTTCAATAGCGACGAACGGCTACCGCCAGTGGCGCATTT
GGTGCTCTGCTCGTACAACTGGCATCACTCGGCCGACGAAGTCAGGCGGCATTGGGACTTTTCAGGCATACAATC
CTTACAGATGGTGAATGTTCCCGTGTGCAACTTTTTCAAGTCGGTTGAACTGGACCATCTCTGCCGGCTGCATAC
ACTCAAGGTTGGCGAGCAAAGTGGACACTTGCACCAGACATGGGGCGGGGCGACAGGCTTCCTGTACCAAGCTAT
CAAGCACCACATTGATGCACTGCAGACTCTAGAGCTGACGTGCAAGACGGCATTGTTTGGGCTCGACGCGCTAGA
GCGACACGCCAGGACGCTGCAGGTGCTTCGTTTTCAAGACCACGTGGGCTTCCAAGACGATAGCAGGACGTGCCC
GACGCTAGACTACAAGTCGGTCCGCGCACTGGCGTCTGCTCTAGTCCACGTGCACACGCTTGAGCTGGACATGGA
CACGACAGAGCCGACGGAATTCCTCGAGGCCGTGTGTCTGTTTCCGCGGCTGCACACGCTGACGTTGCATGTGCA
GACGCGGGTGCGGCCAGTGGACGAGGCGGTGGTGCACCCGGATGCTGATGATGAGGCGGTGGCGGAGATGCTGAG
GCTTTTGCTGAGGCGGCGCAAGGGAGGCGTGGCATGGCGGCGCGTCACCATCAATGTCGGGGGGTGGCGGCGGGC
CATGGTGAGAAGGGTGGGATATGAGTGGAAGAAGCAGAATGAGCGGGGAGTGTTTGCAGAGCGATGTTTTGTCAT
GGAGACGGATGGCGAGAGTGGGTATGCTGTGAGGGATGAGGCGTGCCAGAAAGGAAGCCTGGGGCGGCCGCTGGC
GGACGAGGCATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail