Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|372
Gene name
LocationContig_103:62707..64397
Strand+
Gene length (bp)1690
Transcript length (bp)1599
Coding sequence length (bp)1599
Protein length (aa) 533

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00067 p450 Cytochrome P450 3.5E-15 342 502

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9T0K2|C71AK_ARATH Cytochrome P450 71A20 OS=Arabidopsis thaliana GN=CYP71A20 PE=2 SV=2 286 498 5.0E-10
sp|O49342|C71AD_ARATH Indoleacetaldoxime dehydratase OS=Arabidopsis thaliana GN=CYP71A13 PE=1 SV=1 323 498 7.0E-10
sp|Q9STL0|C71AN_ARATH Cytochrome P450 71A23 OS=Arabidopsis thaliana GN=CYP71A23 PE=2 SV=1 339 498 3.0E-09
sp|O48958|C71E1_SORBI 4-hydroxyphenylacetaldehyde oxime monooxygenase OS=Sorghum bicolor GN=CYP71E1 PE=2 SV=1 314 518 5.0E-09
sp|Q92113|CP17A_SQUAC Steroid 17-alpha-hydroxylase/17,20 lyase OS=Squalus acanthias GN=CYP17A1 PE=2 SV=1 97 530 1.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9T0K2|C71AK_ARATH Cytochrome P450 71A20 OS=Arabidopsis thaliana GN=CYP71A20 PE=2 SV=2 286 498 5.0E-10
sp|O49342|C71AD_ARATH Indoleacetaldoxime dehydratase OS=Arabidopsis thaliana GN=CYP71A13 PE=1 SV=1 323 498 7.0E-10
sp|Q9STL0|C71AN_ARATH Cytochrome P450 71A23 OS=Arabidopsis thaliana GN=CYP71A23 PE=2 SV=1 339 498 3.0E-09
sp|O48958|C71E1_SORBI 4-hydroxyphenylacetaldehyde oxime monooxygenase OS=Sorghum bicolor GN=CYP71E1 PE=2 SV=1 314 518 5.0E-09
sp|Q92113|CP17A_SQUAC Steroid 17-alpha-hydroxylase/17,20 lyase OS=Squalus acanthias GN=CYP17A1 PE=2 SV=1 97 530 1.0E-08
sp|Q9STK9|C71AO_ARATH Cytochrome P450 71A24 OS=Arabidopsis thaliana GN=CYP71A24 PE=2 SV=3 339 498 2.0E-08
sp|Q9STK8|C71AP_ARATH Cytochrome P450 71A25 OS=Arabidopsis thaliana GN=CYP71A25 PE=2 SV=1 344 498 3.0E-08
sp|Q64505|CP7A1_MOUSE Cholesterol 7-alpha-monooxygenase OS=Mus musculus GN=Cyp7a1 PE=2 SV=2 108 500 4.0E-08
sp|Q50EK4|C75A1_PINTA Cytochrome P450 750A1 OS=Pinus taeda GN=CYP750A1 PE=2 SV=1 334 498 9.0E-08
sp|P93531|C71D7_SOLCH Cytochrome P450 71D7 OS=Solanum chacoense GN=CYP71D7 PE=3 SV=1 284 513 1.0E-07
sp|Q9VG17|CP304_DROME Probable cytochrome P450 304a1 OS=Drosophila melanogaster GN=Cyp304a1 PE=2 SV=2 278 499 2.0E-07
sp|Q9STK7|C71AQ_ARATH Cytochrome P450 71A26 OS=Arabidopsis thaliana GN=CYP71A26 PE=3 SV=1 339 498 3.0E-07
sp|Q9FH66|C71AG_ARATH Cytochrome P450 71A16 OS=Arabidopsis thaliana GN=CYP71A16 PE=2 SV=1 322 519 4.0E-07
sp|Q9T0K0|C71AJ_ARATH Cytochrome P450 71A19 OS=Arabidopsis thaliana GN=CYP71A19 PE=2 SV=1 341 498 6.0E-07
sp|Q9SAB6|C71AI_ARATH Cytochrome P450 71A18 OS=Arabidopsis thaliana GN=CYP71A18 PE=2 SV=2 339 498 6.0E-07
sp|D1MI46|C76BA_SWEMU Geraniol 8-hydroxylase OS=Swertia mussotii GN=CYP76B10 PE=1 SV=1 340 510 6.0E-07
sp|P05176|CP1A1_RABIT Cytochrome P450 1A1 OS=Oryctolagus cuniculus GN=CYP1A1 PE=2 SV=1 344 521 7.0E-07
sp|O49340|C71AC_ARATH Cytochrome P450 71A12 OS=Arabidopsis thaliana GN=CYP71A12 PE=2 SV=1 276 514 8.0E-07
sp|P37122|C76A2_SOLME Cytochrome P450 76A2 OS=Solanum melongena GN=CYP76A2 PE=2 SV=1 344 510 9.0E-07
sp|P58046|C71AF_ARATH Cytochrome P450 71A15 OS=Arabidopsis thaliana GN=CYP71A15 PE=3 SV=1 339 498 2.0E-06
sp|Q94FM7|C71DK_TOBAC 5-epiaristolochene 1,3-dihydroxylase OS=Nicotiana tabacum GN=CYP71D20 PE=1 SV=2 344 515 2.0E-06
sp|Q69XM6|C7344_ORYSJ Cytochrome P450 734A4 OS=Oryza sativa subsp. japonica GN=CYP734A4 PE=2 SV=1 344 499 3.0E-06
sp|Q9ZNR0|C78A6_ARATH Cytochrome P450 78A6 OS=Arabidopsis thaliana GN=CYP78A6 PE=2 SV=1 344 498 5.0E-06
sp|Q6Z6D6|C7342_ORYSJ Cytochrome P450 734A2 OS=Oryza sativa subsp. japonica GN=CYP734A2 PE=2 SV=1 391 499 7.0E-06
sp|Q0DBF4|C7018_ORYSJ Ent-sandaracopimaradiene 3-hydroxylase OS=Oryza sativa subsp. japonica GN=CYP701A8 PE=1 SV=1 306 498 8.0E-06
sp|P48420|C78A1_MAIZE Cytochrome P450 78A1 OS=Zea mays GN=CYP78A1 PE=2 SV=1 125 497 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0004497 monooxygenase activity Yes
GO:0020037 heme binding Yes
GO:0005506 iron ion binding Yes
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Yes
GO:0003824 catalytic activity No
GO:0046872 metal ion binding No
GO:0046906 tetrapyrrole binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0016491 oxidoreductase activity No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0046914 transition metal ion binding No
GO:0043169 cation binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|372
MATSFAIASSAFNSTNINLSKTVLSVPLLDPAVLTIHKYIALFVLCGFYIITFLPRSPASVSKTFSWLHAWPGAA
SLGAAATQADKDSRAAGQELPLPHVSSWVPILGHVMALRQRGGRYIHELIQQTPAELFTINVLCKRILVAGPSVD
RALGRHVQETSLAQVVSLMGQRSLGLGEAGVRAIAEHDPRPVHRSLFSTADGVAGLSEAAADYVRSKVQRQPQRQ
EVKLGRFVFDLVVGAAAHALWGKENPWTSDAEFMEQFIIVSDKFETLGQPMAWLTAAKAYRAREFLVSRLKRFHA
THQNTRKHSVAHRINAVAMADAQWESNDDYYRVELLEALGLLATASTLSVWLVREIIARPALLAAVEREVRAATE
DNIRASCPTLVAAWYETLRLHMTLVPRVASQAFTLDLSTRSVRVDKNDVILMPMLAFNLDEATWGADARDFNPGR
FLDANGAVVAAKTRRVRGFGVAGNLCPGRAFGFEVAIGSVATVLREFDIEKKAYAQPRAMAGTNVGFERVEDEVC
GELRRTT*
Coding >OphauB2|372
ATGGCTACCTCTTTTGCCATTGCCTCGTCGGCATTCAACTCTACCAACATCAACCTGTCCAAGACGGTGCTTTCG
GTGCCCTTGTTGGACCCGGCCGTCTTGACCATTCACAAGTACATTGCCCTGTTTGTCCTGTGCGGCTTTTACATC
ATTACCTTTTTGCCGCGCTCTCCCGCCTCGGTGAGCAAGACCTTTTCTTGGCTGCACGCCTGGCCAGGCGCAGCA
AGTCTGGGAGCAGCAGCCACACAAGCAGACAAGGACTCAAGAGCAGCGGGCCAAGAGCTTCCTCTCCCACACGTA
TCCTCGTGGGTGCCGATTCTGGGTCACGTAATGGCTCTTCGGCAGCGCGGCGGGCGCTACATCCATGAGCTAATC
CAGCAAACGCCGGCGGAGCTCTTTACAATTAACGTTTTGTGCAAGCGGATATTGGTGGCGGGGCCGAGCGTGGAC
CGCGCGCTGGGCCGCCATGTGCAGGAAACAAGTCTGGCGCAGGTGGTATCGTTGATGGGGCAGCGGTCGCTGGGT
CTGGGAGAGGCAGGCGTGCGGGCCATTGCGGAGCACGACCCGCGGCCGGTGCATCGGAGCCTCTTCTCCACGGCT
GATGGCGTGGCGGGGCTGAGCGAGGCGGCCGCCGACTATGTGCGCTCAAAGGTGCAGCGGCAGCCGCAGCGACAA
GAGGTGAAGCTGGGCAGATTTGTCTTTGACTTGGTTGTCGGGGCGGCTGCGCATGCGCTCTGGGGAAAGGAAAAT
CCGTGGACAAGTGATGCCGAGTTTATGGAGCAGTTCATCATTGTGAGCGATAAATTCGAAACACTGGGCCAGCCA
ATGGCTTGGCTCACGGCGGCAAAGGCATACCGTGCGCGCGAGTTTCTCGTCTCGCGCCTCAAGCGCTTTCACGCC
ACCCACCAAAACACGCGCAAGCACAGCGTGGCGCACCGCATCAATGCCGTGGCCATGGCAGACGCGCAGTGGGAA
AGCAACGACGACTACTACCGCGTGGAGCTGCTCGAGGCACTGGGACTGCTAGCCACGGCGAGCACGCTGTCTGTG
TGGCTGGTGCGCGAGATTATAGCCCGGCCGGCGCTTCTGGCCGCCGTGGAGCGGGAAGTGCGAGCGGCGACAGAG
GACAATATTCGCGCTTCGTGCCCGACGCTGGTGGCGGCATGGTATGAGACGCTGCGGCTTCACATGACGCTTGTG
CCGCGCGTGGCGTCACAAGCCTTTACCCTCGACCTGTCGACGCGGTCGGTGCGGGTGGACAAGAACGATGTGATT
CTCATGCCCATGCTGGCCTTCAACTTGGACGAGGCGACATGGGGAGCAGATGCGCGCGACTTCAACCCAGGGCGG
TTCCTCGATGCAAACGGGGCTGTTGTGGCGGCCAAGACGAGGCGCGTGAGGGGCTTTGGCGTGGCGGGCAATTTG
TGTCCCGGCCGGGCGTTTGGCTTCGAAGTCGCCATTGGGAGTGTGGCGACGGTGCTGCGCGAGTTTGATATTGAG
AAGAAGGCGTATGCGCAGCCCAGGGCCATGGCGGGGACCAATGTTGGCTTTGAGCGGGTCGAGGATGAGGTCTGT
GGCGAGCTGAGGCGGACGACGTGA
Transcript >OphauB2|372
ATGGCTACCTCTTTTGCCATTGCCTCGTCGGCATTCAACTCTACCAACATCAACCTGTCCAAGACGGTGCTTTCG
GTGCCCTTGTTGGACCCGGCCGTCTTGACCATTCACAAGTACATTGCCCTGTTTGTCCTGTGCGGCTTTTACATC
ATTACCTTTTTGCCGCGCTCTCCCGCCTCGGTGAGCAAGACCTTTTCTTGGCTGCACGCCTGGCCAGGCGCAGCA
AGTCTGGGAGCAGCAGCCACACAAGCAGACAAGGACTCAAGAGCAGCGGGCCAAGAGCTTCCTCTCCCACACGTA
TCCTCGTGGGTGCCGATTCTGGGTCACGTAATGGCTCTTCGGCAGCGCGGCGGGCGCTACATCCATGAGCTAATC
CAGCAAACGCCGGCGGAGCTCTTTACAATTAACGTTTTGTGCAAGCGGATATTGGTGGCGGGGCCGAGCGTGGAC
CGCGCGCTGGGCCGCCATGTGCAGGAAACAAGTCTGGCGCAGGTGGTATCGTTGATGGGGCAGCGGTCGCTGGGT
CTGGGAGAGGCAGGCGTGCGGGCCATTGCGGAGCACGACCCGCGGCCGGTGCATCGGAGCCTCTTCTCCACGGCT
GATGGCGTGGCGGGGCTGAGCGAGGCGGCCGCCGACTATGTGCGCTCAAAGGTGCAGCGGCAGCCGCAGCGACAA
GAGGTGAAGCTGGGCAGATTTGTCTTTGACTTGGTTGTCGGGGCGGCTGCGCATGCGCTCTGGGGAAAGGAAAAT
CCGTGGACAAGTGATGCCGAGTTTATGGAGCAGTTCATCATTGTGAGCGATAAATTCGAAACACTGGGCCAGCCA
ATGGCTTGGCTCACGGCGGCAAAGGCATACCGTGCGCGCGAGTTTCTCGTCTCGCGCCTCAAGCGCTTTCACGCC
ACCCACCAAAACACGCGCAAGCACAGCGTGGCGCACCGCATCAATGCCGTGGCCATGGCAGACGCGCAGTGGGAA
AGCAACGACGACTACTACCGCGTGGAGCTGCTCGAGGCACTGGGACTGCTAGCCACGGCGAGCACGCTGTCTGTG
TGGCTGGTGCGCGAGATTATAGCCCGGCCGGCGCTTCTGGCCGCCGTGGAGCGGGAAGTGCGAGCGGCGACAGAG
GACAATATTCGCGCTTCGTGCCCGACGCTGGTGGCGGCATGGTATGAGACGCTGCGGCTTCACATGACGCTTGTG
CCGCGCGTGGCGTCACAAGCCTTTACCCTCGACCTGTCGACGCGGTCGGTGCGGGTGGACAAGAACGATGTGATT
CTCATGCCCATGCTGGCCTTCAACTTGGACGAGGCGACATGGGGAGCAGATGCGCGCGACTTCAACCCAGGGCGG
TTCCTCGATGCAAACGGGGCTGTTGTGGCGGCCAAGACGAGGCGCGTGAGGGGCTTTGGCGTGGCGGGCAATTTG
TGTCCCGGCCGGGCGTTTGGCTTCGAAGTCGCCATTGGGAGTGTGGCGACGGTGCTGCGCGAGTTTGATATTGAG
AAGAAGGCGTATGCGCAGCCCAGGGCCATGGCGGGGACCAATGTTGGCTTTGAGCGGGTCGAGGATGAGGTCTGT
GGCGAGCTGAGGCGGACGACGTGA
Gene >OphauB2|372
ATGGCTACCTCTTTTGCCATTGCCTCGTCGGCATTCAACTCTACCAACATCAACCTGTCCAAGACGGTGCTTTCG
GTGCCCTTGTTGGACCCGGCCGTCTTGACCATTCACAAGTACATTGCCCTGTTTGTCCTGTGCGGCTTTTACATC
ATTACCTTTTTGCCGCGCTCTCCCGCCTCGGTGAGCAAGACCTTTTCTTGGCTGCACGCCTGGCCAGGCGCAGCA
AGTCTGGGAGCAGCAGCCACACAAGCAGACAAGGACTCAAGAGCAGCGGGCCAAGAGCTTCCTCTCCCACACGTA
TCCTCGTGGGTGCCGATTCTGGGTCACGTAATGGCTCTTCGGCAGCGCGGCGGGCGCTACATCCATGAGCTAATC
CAGCAAACGCCGGCGGAGCTCTTTACAATTAACGTTTTGTGCAAGCGGATATTGGTGGCGGGGCCGAGCGTGGAC
CGCGCGCTGGGCCGCCATGTGCAGGAAACAAGTCTGGCGCAGGTGGTATCGTTGATGGGGCAGCGGTCGCTGGGT
CTGGGAGAGGCAGGCGTGCGGGCCATTGCGGAGCACGACCCGCGGCCGGTGCATCGGAGCCTCTTCTCCACGGCT
GATGGCGTGGCGGGGCTGAGCGAGGCGGCCGCCGACTATGTGCGCTCAAAGGTGCAGCGGCAGCCGCAGCGACAA
GAGGTGAAGCTGGGCAGATTTGTCTTTGACTTGGTTGTCGGGGCGGCTGCGCATGCGCTCTGGGGAAAGGAAAAT
CCGTGGACAAGTGATGCCGAGTTTATGGAGCAGTTCATGTGAGTCTTTTCCCCTTGTTTCTCTGCTTCCCAAGAA
GAAAAAAAAAACTCCTTGAATAGTCCAAGAGCAAAGACTGACATGACTACATAGCATTGTGAGCGATAAATTCGA
AACACTGGGCCAGCCAATGGCTTGGCTCACGGCGGCAAAGGCATACCGTGCGCGCGAGTTTCTCGTCTCGCGCCT
CAAGCGCTTTCACGCCACCCACCAAAACACGCGCAAGCACAGCGTGGCGCACCGCATCAATGCCGTGGCCATGGC
AGACGCGCAGTGGGAAAGCAACGACGACTACTACCGCGTGGAGCTGCTCGAGGCACTGGGACTGCTAGCCACGGC
GAGCACGCTGTCTGTGTGGCTGGTGCGCGAGATTATAGCCCGGCCGGCGCTTCTGGCCGCCGTGGAGCGGGAAGT
GCGAGCGGCGACAGAGGACAATATTCGCGCTTCGTGCCCGACGCTGGTGGCGGCATGGTATGAGACGCTGCGGCT
TCACATGACGCTTGTGCCGCGCGTGGCGTCACAAGCCTTTACCCTCGACCTGTCGACGCGGTCGGTGCGGGTGGA
CAAGAACGATGTGATTCTCATGCCCATGCTGGCCTTCAACTTGGACGAGGCGACATGGGGAGCAGATGCGCGCGA
CTTCAACCCAGGGCGGTTCCTCGATGCAAACGGGGCTGTTGTGGCGGCCAAGACGAGGCGCGTGAGGGGCTTTGG
CGTGGCGGGCAATTTGTGTCCCGGCCGGGCGTTTGGCTTCGAAGTCGCCATTGGGAGTGTGGCGACGGTGCTGCG
CGAGTTTGATATTGAGAAGAAGGCGTATGCGCAGCCCAGGGCCATGGCGGGGACCAATGTTGGCTTTGAGCGGGT
CGAGGATGAGGTCTGTGGCGAGCTGAGGCGGACGACGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail