Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3714
Gene name
LocationContig_238:4093..5969
Strand-
Gene length (bp)1876
Transcript length (bp)1671
Coding sequence length (bp)1671
Protein length (aa) 557

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00118 Cpn60_TCP1 TCP-1/cpn60 chaperonin family 3.5E-153 36 525

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87153|TCPH_SCHPO Probable T-complex protein 1 subunit eta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cct7 PE=1 SV=1 1 555 0.0E+00
sp|P42943|TCPH_YEAST T-complex protein 1 subunit eta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCT7 PE=1 SV=1 1 554 0.0E+00
sp|P80313|TCPH_MOUSE T-complex protein 1 subunit eta OS=Mus musculus GN=Cct7 PE=1 SV=1 8 555 0.0E+00
sp|Q5ZJK8|TCPH_CHICK T-complex protein 1 subunit eta OS=Gallus gallus GN=CCT7 PE=1 SV=1 8 534 0.0E+00
sp|Q99832|TCPH_HUMAN T-complex protein 1 subunit eta OS=Homo sapiens GN=CCT7 PE=1 SV=2 8 528 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87153|TCPH_SCHPO Probable T-complex protein 1 subunit eta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cct7 PE=1 SV=1 1 555 0.0E+00
sp|P42943|TCPH_YEAST T-complex protein 1 subunit eta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCT7 PE=1 SV=1 1 554 0.0E+00
sp|P80313|TCPH_MOUSE T-complex protein 1 subunit eta OS=Mus musculus GN=Cct7 PE=1 SV=1 8 555 0.0E+00
sp|Q5ZJK8|TCPH_CHICK T-complex protein 1 subunit eta OS=Gallus gallus GN=CCT7 PE=1 SV=1 8 534 0.0E+00
sp|Q99832|TCPH_HUMAN T-complex protein 1 subunit eta OS=Homo sapiens GN=CCT7 PE=1 SV=2 8 528 0.0E+00
sp|Q5R5C8|TCPH_PONAB T-complex protein 1 subunit eta OS=Pongo abelii GN=CCT7 PE=2 SV=1 8 528 0.0E+00
sp|Q2NKZ1|TCPH_BOVIN T-complex protein 1 subunit eta OS=Bos taurus GN=CCT7 PE=1 SV=1 8 535 0.0E+00
sp|Q9SF16|TCPH_ARATH T-complex protein 1 subunit eta OS=Arabidopsis thaliana GN=CCT7 PE=1 SV=1 8 532 0.0E+00
sp|Q54ER7|TCPH_DICDI T-complex protein 1 subunit eta OS=Dictyostelium discoideum GN=cct7 PE=3 SV=1 8 550 0.0E+00
sp|P54409|TCPH_TETPY T-complex protein 1 subunit eta OS=Tetrahymena pyriformis PE=3 SV=1 8 544 0.0E+00
sp|O77323|TCPH_PLAF7 T-complex protein 1 subunit eta OS=Plasmodium falciparum (isolate 3D7) GN=MAL3P3.6 PE=3 SV=1 10 529 0.0E+00
sp|P54410|TCPH_TETTH T-complex protein 1 subunit eta (Fragment) OS=Tetrahymena thermophila PE=3 SV=1 64 413 3.0E-148
sp|Q8SR53|TCPH_ENCCU T-complex protein 1 subunit eta OS=Encephalitozoon cuniculi (strain GB-M1) GN=CCT7 PE=1 SV=1 18 528 1.0E-135
sp|O28045|THSA_ARCFU Thermosome subunit alpha OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=thsA PE=3 SV=1 7 523 1.0E-110
sp|O26885|THSB_METTH Thermosome subunit beta OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=thsB PE=3 SV=1 5 523 6.0E-109
sp|Q9YA66|THSB_AERPE Thermosome subunit beta OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=thsB PE=3 SV=2 10 523 7.0E-108
sp|P48424|THSA_THEAC Thermosome subunit alpha OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=thsA PE=1 SV=1 5 531 8.0E-108
sp|Q9V2Q7|THS_PYRAB Thermosome subunit OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=ths PE=3 SV=1 10 523 2.0E-107
sp|O57762|THS_PYRHO Thermosome subunit OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=ths PE=3 SV=1 10 523 3.0E-107
sp|P50016|THS_METKA Thermosome subunit OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=ths PE=3 SV=1 3 530 8.0E-107
sp|O26320|THSA_METTH Thermosome subunit alpha OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=thsA PE=3 SV=2 5 523 3.0E-105
sp|O24730|THSB_THEK1 Thermosome subunit beta OS=Thermococcus sp. (strain JCM 11816 / KS-1) GN=thsB PE=3 SV=2 10 523 7.0E-104
sp|O93624|THS_METTL Thermosome subunit OS=Methanothermococcus thermolithotrophicus GN=ths PE=1 SV=1 10 526 8.0E-104
sp|Q52500|THSB_THEKO Thermosome subunit beta OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=thsB PE=3 SV=1 10 523 3.0E-103
sp|Q58405|THS_METJA Thermosome subunit OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=ths PE=3 SV=1 1 526 6.0E-103
sp|O28821|THSB_ARCFU Thermosome subunit beta OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=thsB PE=3 SV=1 6 523 1.0E-102
sp|O30561|THS1_HALVD Thermosome subunit 1 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=cct1 PE=1 SV=1 6 523 2.0E-102
sp|Q53546|THS_DESSY Thermosome subunit OS=Desulfurococcus sp. (strain SY) GN=ths PE=3 SV=1 10 523 2.0E-100
sp|Q9HN70|THSA_HALSA Thermosome subunit alpha OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=thsA PE=3 SV=2 5 523 2.0E-100
sp|P61111|THSA_THEKO Thermosome subunit alpha OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=thsA PE=1 SV=1 10 532 4.0E-100
sp|P61112|THSA_THEK1 Thermosome subunit alpha OS=Thermococcus sp. (strain JCM 11816 / KS-1) GN=thsA PE=1 SV=1 10 532 4.0E-100
sp|Q9V2T4|THSB_SULAC Thermosome subunit beta OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=thsB PE=3 SV=2 10 523 3.0E-99
sp|Q9YDK6|THSA_AERPE Thermosome subunit alpha OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=thsA PE=3 SV=2 10 523 1.0E-98
sp|O24732|THSB_THEK8 Thermosome subunit beta OS=Thermococcus sp. (strain KS-8) GN=thsB PE=3 SV=1 10 523 3.0E-98
sp|P18279|TCPA_CRIGR T-complex protein 1 subunit alpha OS=Cricetulus griseus GN=TCP1 PE=2 SV=1 18 546 8.0E-96
sp|Q32L40|TCPA_BOVIN T-complex protein 1 subunit alpha OS=Bos taurus GN=TCP1 PE=1 SV=1 18 535 1.0E-95
sp|P17987|TCPA_HUMAN T-complex protein 1 subunit alpha OS=Homo sapiens GN=TCP1 PE=1 SV=1 18 546 3.0E-95
sp|O24731|THSA_THEK8 Thermosome subunit alpha OS=Thermococcus sp. (strain KS-8) GN=thsA PE=3 SV=1 10 539 2.0E-94
sp|Q9V2T3|THSB_DESMO Thermosome subunit beta (Fragment) OS=Desulfurococcus mobilis GN=thsB PE=3 SV=1 20 517 2.0E-94
sp|Q9XT06|TCPA_MONDO T-complex protein 1 subunit alpha OS=Monodelphis domestica GN=TCP1 PE=2 SV=1 29 535 6.0E-94
sp|P28769|TCPA_ARATH T-complex protein 1 subunit alpha OS=Arabidopsis thaliana GN=CCT1 PE=1 SV=1 1 524 7.0E-94
sp|O24735|THSB_SULTO Thermosome subunit beta OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=thsB PE=1 SV=1 10 523 1.0E-93
sp|P28480|TCPA_RAT T-complex protein 1 subunit alpha OS=Rattus norvegicus GN=Tcp1 PE=1 SV=1 18 535 1.0E-93
sp|Q4R5G2|TCPA_MACFA T-complex protein 1 subunit alpha OS=Macaca fascicularis GN=TCP1 PE=2 SV=1 18 546 5.0E-93
sp|O24734|THSA_SULTO Thermosome subunit alpha OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=thsA PE=1 SV=1 10 523 5.0E-93
sp|Q9V2T5|THSA_SULAC Thermosome subunit alpha OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=thsA PE=3 SV=2 10 523 1.0E-92
sp|P11983|TCPA_MOUSE T-complex protein 1 subunit alpha OS=Mus musculus GN=Tcp1 PE=1 SV=3 18 546 2.0E-92
sp|Q9V2T8|THSB_SULSO Thermosome subunit beta OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=thsB PE=3 SV=2 10 523 5.0E-92
sp|P28488|THSB_SULSH Thermosome subunit beta OS=Sulfolobus shibatae GN=thsB PE=1 SV=1 10 523 1.0E-91
sp|Q94757|TCPA_SCHMA T-complex protein 1 subunit alpha OS=Schistosoma mansoni GN=TCP-1A PE=2 SV=1 29 535 3.0E-91
sp|P12613|TCPA_DROME T-complex protein 1 subunit alpha OS=Drosophila melanogaster GN=T-cp1 PE=2 SV=2 29 524 4.0E-91
sp|Q9W790|TCPA_PALPA T-complex protein 1 subunit alpha OS=Paleosuchus palpebrosus GN=TCP1 PE=2 SV=1 29 535 3.0E-90
sp|P46219|THSA_SULSH Thermosome subunit alpha OS=Sulfolobus shibatae GN=thsA PE=1 SV=1 10 523 6.0E-90
sp|P12612|TCPA_YEAST T-complex protein 1 subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TCP1 PE=1 SV=2 29 538 1.0E-89
sp|Q9V2S9|THSA_SULSO Thermosome subunit alpha OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=thsA PE=3 SV=2 10 523 1.0E-89
sp|P50143|TCPG_XENLA T-complex protein 1 subunit gamma OS=Xenopus laevis GN=cct3 PE=2 SV=2 10 523 1.0E-88
sp|P41988|TCPA_CAEEL T-complex protein 1 subunit alpha OS=Caenorhabditis elegans GN=cct-1 PE=3 SV=2 20 524 6.0E-87
sp|P48425|THSB_THEAC Thermosome subunit beta OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=thsB PE=1 SV=1 10 523 7.0E-87
sp|Q55BM4|TCPA_DICDI T-complex protein 1 subunit alpha OS=Dictyostelium discoideum GN=tcp1 PE=2 SV=1 29 523 1.0E-86
sp|P54408|TCPG_TETPY T-complex protein 1 subunit gamma OS=Tetrahymena pyriformis PE=3 SV=1 1 523 1.0E-86
sp|Q9LKI7|TCPG_THAWE T-complex protein 1 subunit gamma OS=Thalassiosira weissflogii PE=2 SV=1 1 523 1.0E-85
sp|O94501|TCPA_SCHPO T-complex protein 1 subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cct1 PE=3 SV=1 29 534 5.0E-84
sp|Q3T0K2|TCPG_BOVIN T-complex protein 1 subunit gamma OS=Bos taurus GN=CCT3 PE=1 SV=1 5 523 7.0E-84
sp|O15891|TCPA_TETPY T-complex protein 1 subunit alpha OS=Tetrahymena pyriformis PE=3 SV=1 8 540 7.0E-84
sp|P39077|TCPG_YEAST T-complex protein 1 subunit gamma OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCT3 PE=1 SV=2 6 523 2.0E-83
sp|O00782|TCPG_OXYGR T-complex protein 1 subunit gamma OS=Oxytricha granulifera PE=3 SV=1 10 523 9.0E-82
sp|Q54TH8|TCPG_DICDI T-complex protein 1 subunit gamma OS=Dictyostelium discoideum GN=cct3 PE=1 SV=1 32 521 2.0E-81
sp|P80318|TCPG_MOUSE T-complex protein 1 subunit gamma OS=Mus musculus GN=Cct3 PE=1 SV=1 5 523 2.0E-81
sp|Q940P8|TCPB_ARATH T-complex protein 1 subunit beta OS=Arabidopsis thaliana GN=CCT2 PE=1 SV=1 8 523 3.0E-81
sp|Q5NVF9|TCPG_PONAB T-complex protein 1 subunit gamma OS=Pongo abelii GN=CCT3 PE=2 SV=1 5 523 2.0E-80
sp|Q6P502|TCPG_RAT T-complex protein 1 subunit gamma OS=Rattus norvegicus GN=Cct3 PE=1 SV=1 5 523 2.0E-80
sp|P47207|TCPB_CAEEL T-complex protein 1 subunit beta OS=Caenorhabditis elegans GN=cct-2 PE=1 SV=2 12 532 5.0E-80
sp|P49368|TCPG_HUMAN T-complex protein 1 subunit gamma OS=Homo sapiens GN=CCT3 PE=1 SV=4 5 523 8.0E-80
sp|Q84WV1|TCPG_ARATH T-complex protein 1 subunit gamma OS=Arabidopsis thaliana GN=CCT3 PE=1 SV=1 29 538 2.0E-79
sp|O74341|TCPG_SCHPO T-complex protein 1 subunit gamma OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cct3 PE=1 SV=1 6 523 2.0E-79
sp|P39076|TCPB_YEAST T-complex protein 1 subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCT2 PE=1 SV=1 33 536 5.0E-79
sp|Q4R963|TCPG_MACFA T-complex protein 1 subunit gamma OS=Macaca fascicularis GN=CCT3 PE=2 SV=1 5 523 6.0E-79
sp|Q54ES9|TCPB_DICDI T-complex protein 1 subunit beta OS=Dictyostelium discoideum GN=cct2 PE=1 SV=1 3 524 9.0E-78
sp|Q4R6F8|TCPB_MACFA T-complex protein 1 subunit beta OS=Macaca fascicularis GN=CCT2 PE=2 SV=3 12 538 5.0E-77
sp|P78371|TCPB_HUMAN T-complex protein 1 subunit beta OS=Homo sapiens GN=CCT2 PE=1 SV=4 12 538 5.0E-77
sp|Q3ZBH0|TCPB_BOVIN T-complex protein 1 subunit beta OS=Bos taurus GN=CCT2 PE=1 SV=3 12 538 1.0E-76
sp|Q5XIM9|TCPB_RAT T-complex protein 1 subunit beta OS=Rattus norvegicus GN=Cct2 PE=1 SV=3 12 538 6.0E-76
sp|P80314|TCPB_MOUSE T-complex protein 1 subunit beta OS=Mus musculus GN=Cct2 PE=1 SV=4 12 538 9.0E-76
sp|P48605|TCPG_DROME T-complex protein 1 subunit gamma OS=Drosophila melanogaster GN=Cctgamma PE=2 SV=2 3 540 4.0E-75
sp|P47209|TCPE_CAEEL T-complex protein 1 subunit epsilon OS=Caenorhabditis elegans GN=cct-5 PE=2 SV=1 29 521 3.0E-74
sp|Q8SSC9|TCPA_ENCCU T-complex protein 1 subunit alpha OS=Encephalitozoon cuniculi (strain GB-M1) GN=TCP1 PE=1 SV=1 16 523 8.0E-74
sp|Q10147|TCPB_SCHPO Probable T-complex protein 1 subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cct2 PE=3 SV=1 33 524 1.0E-72
sp|P80316|TCPE_MOUSE T-complex protein 1 subunit epsilon OS=Mus musculus GN=Cct5 PE=1 SV=1 29 528 5.0E-72
sp|P40413|TCPE_YEAST T-complex protein 1 subunit epsilon OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCT5 PE=1 SV=3 8 523 6.0E-72
sp|O30560|THS2_HALVD Thermosome subunit 2 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=cct2 PE=1 SV=1 29 523 6.0E-72
sp|O04450|TCPE_ARATH T-complex protein 1 subunit epsilon OS=Arabidopsis thaliana GN=CCT5 PE=1 SV=1 29 527 2.0E-71
sp|Q4R6V2|TCPE_MACFA T-complex protein 1 subunit epsilon OS=Macaca fascicularis GN=CCT5 PE=2 SV=1 29 528 3.0E-71
sp|P48643|TCPE_HUMAN T-complex protein 1 subunit epsilon OS=Homo sapiens GN=CCT5 PE=1 SV=1 29 528 3.0E-71
sp|Q2T9X2|TCPD_BOVIN T-complex protein 1 subunit delta OS=Bos taurus GN=CCT4 PE=1 SV=3 29 523 4.0E-71
sp|Q68FQ0|TCPE_RAT T-complex protein 1 subunit epsilon OS=Rattus norvegicus GN=Cct5 PE=1 SV=1 29 528 5.0E-71
sp|Q9UTM4|TCPE_SCHPO T-complex protein 1 subunit epsilon OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cct5 PE=3 SV=1 29 523 9.0E-71
sp|Q5RF02|TCPE_PONAB T-complex protein 1 subunit epsilon OS=Pongo abelii GN=CCT5 PE=2 SV=1 29 528 2.0E-70
sp|P54411|TCPE2_AVESA T-complex protein 1 subunit epsilon OS=Avena sativa PE=2 SV=1 11 527 3.0E-70
sp|P50991|TCPD_HUMAN T-complex protein 1 subunit delta OS=Homo sapiens GN=CCT4 PE=1 SV=4 29 523 3.0E-70
sp|P80315|TCPD_MOUSE T-complex protein 1 subunit delta OS=Mus musculus GN=Cct4 PE=1 SV=3 29 523 5.0E-70
sp|Q5R637|TCPD_PONAB T-complex protein 1 subunit delta OS=Pongo abelii GN=CCT4 PE=2 SV=3 29 523 1.0E-69
sp|Q9LV21|TCPD_ARATH T-complex protein 1 subunit delta OS=Arabidopsis thaliana GN=CCT4 PE=1 SV=1 29 523 1.0E-69
sp|Q7TPB1|TCPD_RAT T-complex protein 1 subunit delta OS=Rattus norvegicus GN=Cct4 PE=1 SV=3 29 523 3.0E-69
sp|P40412|TCPE1_AVESA T-complex protein 1 subunit epsilon OS=Avena sativa PE=2 SV=1 40 527 7.0E-69
sp|Q54TD3|TCPE_DICDI T-complex protein 1 subunit epsilon OS=Dictyostelium discoideum GN=cct5 PE=3 SV=1 29 524 6.0E-68
sp|Q9V2T7|THSG_SULSO Thermosome subunit gamma OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=thsC PE=3 SV=1 12 523 8.0E-68
sp|Q9HHA2|THS3_HALVD Thermosome subunit 3 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=cct3 PE=1 SV=2 6 523 9.0E-68
sp|P50999|TCPD_SCHPO T-complex protein 1 subunit delta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cct4 PE=2 SV=2 29 521 1.0E-67
sp|P53451|TCPD_TAKRU T-complex protein 1 subunit delta OS=Takifugu rubripes GN=cct4 PE=2 SV=1 29 523 2.0E-67
sp|Q9NB32|TCPD_OCHTR T-complex protein 1 subunit delta OS=Ochlerotatus triseriatus PE=2 SV=1 29 523 1.0E-66
sp|Q9HH21|THSG_SULSH Thermosome subunit gamma OS=Sulfolobus shibatae GN=thsC PE=3 SV=1 12 523 4.0E-65
sp|Q9HNI0|THSB_HALSA Thermosome subunit beta OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=thsB PE=3 SV=2 29 523 2.0E-64
sp|Q54CL2|TCPD_DICDI T-complex protein 1 subunit delta OS=Dictyostelium discoideum GN=cct4 PE=3 SV=1 29 521 3.0E-64
sp|Q6C100|TCPD_YARLI T-complex protein 1 subunit delta OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CCT4 PE=3 SV=1 29 521 2.0E-61
sp|Q6BXF6|TCPD_DEBHA T-complex protein 1 subunit delta OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CCT4 PE=3 SV=1 29 521 9.0E-61
sp|A8X6I9|TCPQ_CAEBR T-complex protein 1 subunit theta OS=Caenorhabditis briggsae GN=cct-8 PE=3 SV=1 13 536 3.0E-60
sp|Q6FQT2|TCPD_CANGA T-complex protein 1 subunit delta OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CCT4 PE=3 SV=1 29 521 2.0E-59
sp|Q552J0|TCPQ_DICDI T-complex protein 1 subunit theta OS=Dictyostelium discoideum GN=cct8 PE=3 SV=1 12 541 7.0E-58
sp|P47079|TCPQ_YEAST T-complex protein 1 subunit theta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCT8 PE=1 SV=1 6 540 9.0E-58
sp|Q9N358|TCPQ_CAEEL T-complex protein 1 subunit theta OS=Caenorhabditis elegans GN=cct-8 PE=1 SV=3 13 534 5.0E-57
sp|P78921|TCPQ_SCHPO Probable T-complex protein 1 subunit theta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cct8 PE=2 SV=3 12 523 9.0E-57
sp|O77622|TCPZ_RABIT T-complex protein 1 subunit zeta OS=Oryctolagus cuniculus GN=CCT6 PE=1 SV=3 13 524 1.0E-56
sp|P39078|TCPD_YEAST T-complex protein 1 subunit delta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCT4 PE=1 SV=2 29 521 1.0E-56
sp|Q6EE31|TCPQ_CHICK T-complex protein 1 subunit theta OS=Gallus gallus GN=CCT8 PE=1 SV=3 12 534 3.0E-56
sp|Q61390|TCPW_MOUSE T-complex protein 1 subunit zeta-2 OS=Mus musculus GN=Cct6b PE=1 SV=4 16 524 7.0E-56
sp|Q3MHL7|TCPZ_BOVIN T-complex protein 1 subunit zeta OS=Bos taurus GN=CCT6A PE=1 SV=3 13 524 7.0E-56
sp|Q6CL82|TCPD_KLULA T-complex protein 1 subunit delta OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CCT4 PE=3 SV=1 29 521 1.0E-55
sp|Q5RCD2|TCPZ_PONAB T-complex protein 1 subunit zeta OS=Pongo abelii GN=CCT6 PE=2 SV=3 13 524 1.0E-55
sp|P40227|TCPZ_HUMAN T-complex protein 1 subunit zeta OS=Homo sapiens GN=CCT6A PE=1 SV=3 13 524 2.0E-55
sp|P80317|TCPZ_MOUSE T-complex protein 1 subunit zeta OS=Mus musculus GN=Cct6a PE=1 SV=3 13 524 4.0E-55
sp|P42932|TCPQ_MOUSE T-complex protein 1 subunit theta OS=Mus musculus GN=Cct8 PE=1 SV=3 12 534 1.0E-54
sp|P47828|TCPQ_CANAX T-complex protein 1 subunit theta OS=Candida albicans GN=CCT8 PE=3 SV=2 6 540 4.0E-54
sp|Q94K05|TCPQ_ARATH T-complex protein 1 subunit theta OS=Arabidopsis thaliana GN=CCT8 PE=1 SV=1 12 532 8.0E-54
sp|P47208|TCPD_CAEEL T-complex protein 1 subunit delta OS=Caenorhabditis elegans GN=cct-4 PE=2 SV=1 29 523 1.0E-53
sp|Q3ZCI9|TCPQ_BOVIN T-complex protein 1 subunit theta OS=Bos taurus GN=CCT8 PE=1 SV=3 12 534 2.0E-53
sp|Q75A36|TCPD_ASHGO T-complex protein 1 subunit delta OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CCT4 PE=3 SV=1 29 521 3.0E-53
sp|Q5ZJ54|TCPZ_CHICK T-complex protein 1 subunit zeta OS=Gallus gallus GN=CCT6 PE=1 SV=3 13 524 3.0E-53
sp|P39079|TCPZ_YEAST T-complex protein 1 subunit zeta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCT6 PE=1 SV=1 28 534 6.0E-53
sp|Q8SQP2|TCPB_ENCCU T-complex protein 1 subunit beta OS=Encephalitozoon cuniculi (strain GB-M1) GN=CCT2 PE=1 SV=1 36 524 1.0E-52
sp|Q8SR76|TCPG_ENCCU T-complex protein 1 subunit gamma OS=Encephalitozoon cuniculi (strain GB-M1) GN=CCT3 PE=1 SV=1 36 526 4.0E-52
sp|Q92526|TCPW_HUMAN T-complex protein 1 subunit zeta-2 OS=Homo sapiens GN=CCT6B PE=1 SV=5 29 524 8.0E-52
sp|O94515|TCPZ_SCHPO T-complex protein 1 subunit zeta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cct6 PE=3 SV=1 28 536 1.0E-51
sp|Q5RAP1|TCPQ_PONAB T-complex protein 1 subunit theta OS=Pongo abelii GN=CCT8 PE=2 SV=3 12 534 5.0E-51
sp|P50990|TCPQ_HUMAN T-complex protein 1 subunit theta OS=Homo sapiens GN=CCT8 PE=1 SV=4 12 534 5.0E-51
sp|Q4R5J0|TCPQ_MACFA T-complex protein 1 subunit theta OS=Macaca fascicularis GN=CCT8 PE=2 SV=1 12 534 7.0E-51
sp|Q3T084|TCPW_BOVIN T-complex protein 1 subunit zeta-2 OS=Bos taurus GN=CCT6B PE=2 SV=3 22 524 2.0E-50
sp|Q8SRP9|TCPE_ENCCU T-complex protein 1 subunit epsilon OS=Encephalitozoon cuniculi (strain GB-M1) GN=CCT5 PE=1 SV=1 17 525 5.0E-50
sp|P46550|TCPZ_CAEEL T-complex protein 1 subunit zeta OS=Caenorhabditis elegans GN=cct-6 PE=1 SV=1 28 524 1.0E-48
sp|Q9M888|TCPZA_ARATH T-complex protein 1 subunit zeta 1 OS=Arabidopsis thaliana GN=CCT6A PE=1 SV=1 9 524 2.0E-47
sp|Q8L7N0|TCPZB_ARATH T-complex protein 1 subunit zeta 2 OS=Arabidopsis thaliana GN=CCT6B PE=1 SV=1 9 524 2.0E-46
sp|Q76NU3|TCPZ_DICDI T-complex protein 1 subunit zeta OS=Dictyostelium discoideum GN=cct6 PE=1 SV=1 11 524 8.0E-46
sp|Q8SSH3|TCPD_ENCCU T-complex protein 1 subunit delta OS=Encephalitozoon cuniculi (strain GB-M1) GN=CCT4 PE=1 SV=1 39 523 2.0E-37
sp|A6NM43|TCPQL_HUMAN Putative T-complex protein 1 subunit theta-like 1 OS=Homo sapiens GN=CCT8L1P PE=5 SV=1 25 532 3.0E-24
sp|Q96SF2|TCPQM_HUMAN T-complex protein 1 subunit theta-like 2 OS=Homo sapiens GN=CCT8L2 PE=2 SV=2 25 532 1.0E-23
sp|P50157|TCPA_AMBME T-complex protein 1 subunit alpha (Fragment) OS=Ambystoma mexicanum PE=2 SV=1 386 524 3.0E-23
sp|Q5SLM2|CH60_THET8 60 kDa chaperonin OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=groL PE=1 SV=3 35 540 5.0E-22
sp|P61490|CH60_THET2 60 kDa chaperonin OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=groL PE=1 SV=2 35 540 5.0E-22
sp|Q9RWQ9|CH60_DEIRA 60 kDa chaperonin OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=groL PE=1 SV=3 35 534 1.0E-19
sp|A7NIK8|CH601_ROSCS 60 kDa chaperonin 1 OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=groL1 PE=3 SV=1 36 534 5.0E-19
sp|B8I5W0|CH60_CLOCE 60 kDa chaperonin OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=groL PE=3 SV=1 38 534 3.0E-18
sp|Q2RL13|CH601_MOOTA 60 kDa chaperonin 1 OS=Moorella thermoacetica (strain ATCC 39073) GN=groL1 PE=3 SV=1 36 540 3.0E-18
sp|Q9AEP7|CH60_LACLM 60 kDa chaperonin OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=groL PE=3 SV=1 38 526 4.0E-18
sp|A5V0S2|CH602_ROSS1 60 kDa chaperonin 2 OS=Roseiflexus sp. (strain RS-1) GN=groL2 PE=3 SV=1 36 534 5.0E-18
sp|Q8KJ24|CH60_CLOBO 60 kDa chaperonin OS=Clostridium botulinum GN=groL PE=3 SV=1 38 534 7.0E-18
sp|Q8R5T7|CH60_CALS4 60 kDa chaperonin OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=groL PE=3 SV=1 35 535 9.0E-18
sp|P48212|CH60_CLOTH 60 kDa chaperonin OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=groL PE=1 SV=3 38 525 2.0E-17
sp|Q1IW59|CH60_DEIGD 60 kDa chaperonin OS=Deinococcus geothermalis (strain DSM 11300) GN=groL PE=3 SV=1 35 534 2.0E-17
sp|Q031S8|CH60_LACLS 60 kDa chaperonin OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=groL PE=3 SV=1 38 526 2.0E-17
sp|P37282|CH60_LACLA 60 kDa chaperonin OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=groL PE=3 SV=2 38 526 3.0E-17
sp|A9B6A4|CH60_HERA2 60 kDa chaperonin OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=groL PE=3 SV=1 36 520 3.0E-17
sp|B0TCA0|CH60_HELMI 60 kDa chaperonin OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=groL PE=3 SV=1 40 538 3.0E-17
sp|B7GFR6|CH60_ANOFW 60 kDa chaperonin OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=groL PE=3 SV=1 38 535 4.0E-17
sp|B5YDR9|CH60_DICT6 60 kDa chaperonin OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=groL PE=3 SV=1 36 539 4.0E-17
sp|B8E1A9|CH60_DICTD 60 kDa chaperonin OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=groL PE=3 SV=1 30 539 5.0E-17
sp|C5D4F4|CH60_GEOSW 60 kDa chaperonin OS=Geobacillus sp. (strain WCH70) GN=groL PE=3 SV=1 38 535 7.0E-17
sp|A5N5D7|CH60_CLOK5 60 kDa chaperonin OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=groL PE=3 SV=1 38 535 9.0E-17
sp|B9DYY5|CH60_CLOK1 60 kDa chaperonin OS=Clostridium kluyveri (strain NBRC 12016) GN=groL PE=3 SV=1 38 535 9.0E-17
sp|C4ZD46|CH60_EUBR3 60 kDa chaperonin OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=groL PE=3 SV=1 38 517 9.0E-17
sp|Q9AMJ8|CH601_ANASL 60 kDa chaperonin 1 OS=Anabaena sp. (strain L31) GN=groL1 PE=1 SV=1 25 535 9.0E-17
sp|C4Z3R4|CH60_EUBE2 60 kDa chaperonin OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=groL PE=3 SV=1 38 525 1.0E-16
sp|P69205|CH60_TROWT 60 kDa chaperonin OS=Tropheryma whipplei (strain Twist) GN=groL PE=3 SV=1 38 541 1.0E-16
sp|P69204|CH60_TROWH 60 kDa chaperonin OS=Tropheryma whipplei GN=groL PE=3 SV=1 38 541 1.0E-16
sp|C1CZP1|CH60_DEIDV 60 kDa chaperonin OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=groL PE=3 SV=1 35 534 1.0E-16
sp|Q88YM5|CH60_LACPL 60 kDa chaperonin OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=groL PE=3 SV=1 38 517 1.0E-16
sp|Q8VT58|CH60_STRGN 60 kDa chaperonin OS=Streptococcus gordonii GN=groL PE=3 SV=1 38 538 2.0E-16
sp|Q1GJ36|CH60_RUEST 60 kDa chaperonin OS=Ruegeria sp. (strain TM1040) GN=groL PE=3 SV=1 38 534 2.0E-16
sp|A4IJV3|CH60_GEOTN 60 kDa chaperonin OS=Geobacillus thermodenitrificans (strain NG80-2) GN=groL PE=3 SV=1 38 534 2.0E-16
sp|Q8CX00|CH60_STRA5 60 kDa chaperonin OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=groL PE=3 SV=1 38 538 2.0E-16
sp|Q3JYQ0|CH60_STRA1 60 kDa chaperonin OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=groL PE=3 SV=1 38 538 2.0E-16
sp|Q83NN0|CH60_TROW8 60 kDa chaperonin OS=Tropheryma whipplei (strain TW08/27) GN=groL PE=3 SV=1 38 541 2.0E-16
sp|B9DW28|CH60_STRU0 60 kDa chaperonin OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=groL PE=3 SV=1 38 539 2.0E-16
sp|Q03VC3|CH60_LEUMM 60 kDa chaperonin OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=groL PE=3 SV=1 38 540 2.0E-16
sp|Q8CX22|CH60_STRA3 60 kDa chaperonin OS=Streptococcus agalactiae serotype III (strain NEM316) GN=groL PE=3 SV=1 38 538 3.0E-16
sp|Q0BQ24|CH60_GRABC 60 kDa chaperonin OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=groL PE=3 SV=1 38 540 3.0E-16
sp|Q9AGE6|CH60_LISMO 60 kDa chaperonin OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=groL PE=3 SV=1 38 538 3.0E-16
sp|Q71XU6|CH60_LISMF 60 kDa chaperonin OS=Listeria monocytogenes serotype 4b (strain F2365) GN=groL PE=3 SV=1 38 538 3.0E-16
sp|C1KX21|CH60_LISMC 60 kDa chaperonin OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=groL PE=3 SV=1 38 538 3.0E-16
sp|Q929V0|CH60_LISIN 60 kDa chaperonin OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=groL PE=3 SV=1 38 535 3.0E-16
sp|A8AZE1|CH60_STRGC 60 kDa chaperonin OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=groL PE=3 SV=1 38 538 3.0E-16
sp|Q9KI57|CH60_GARVA 60 kDa chaperonin OS=Gardnerella vaginalis GN=groL PE=3 SV=2 38 543 3.0E-16
sp|A0AKH5|CH60_LISW6 60 kDa chaperonin OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=groL PE=3 SV=1 38 538 4.0E-16
sp|B9MLY9|CH60_CALBD 60 kDa chaperonin OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=groL PE=3 SV=1 38 534 4.0E-16
sp|B0K3P6|CH60_THEPX 60 kDa chaperonin OS=Thermoanaerobacter sp. (strain X514) GN=groL PE=3 SV=1 35 541 5.0E-16
sp|B0KBR3|CH60_THEP3 60 kDa chaperonin OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=groL PE=3 SV=1 35 541 5.0E-16
sp|A4XJ09|CH60_CALS8 60 kDa chaperonin OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=groL PE=3 SV=1 38 534 6.0E-16
sp|C4K477|CH60_HAMD5 60 kDa chaperonin OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=groL PE=3 SV=1 38 517 6.0E-16
sp|B8DH59|CH60_LISMH 60 kDa chaperonin OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=groL PE=3 SV=1 38 538 7.0E-16
sp|Q6W163|CH601_RHISN 60 kDa chaperonin 1 OS=Rhizobium sp. (strain NGR234) GN=groL1 PE=3 SV=1 38 539 9.0E-16
sp|Q60024|CH60_THEBR 60 kDa chaperonin OS=Thermoanaerobacter brockii GN=groL PE=1 SV=2 35 517 1.0E-15
sp|Q7NT31|CH601_CHRVO 60 kDa chaperonin 1 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=groL1 PE=3 SV=1 30 537 1.0E-15
sp|Q07201|CH60_GEOSE 60 kDa chaperonin OS=Geobacillus stearothermophilus GN=groL PE=2 SV=1 38 535 1.0E-15
sp|Q048Y3|CH60_LACDB 60 kDa chaperonin OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=groL PE=3 SV=1 30 540 1.0E-15
sp|Q1G937|CH60_LACDA 60 kDa chaperonin OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=groL PE=3 SV=1 30 540 1.0E-15
sp|B1I661|CH60_DESAP 60 kDa chaperonin OS=Desulforudis audaxviator (strain MP104C) GN=groL PE=3 SV=1 35 517 1.0E-15
sp|A9KSJ1|CH60_CLOPH 60 kDa chaperonin OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=groL PE=3 SV=1 38 517 1.0E-15
sp|Q8VV84|CH60_GEOTM 60 kDa chaperonin OS=Geobacillus thermoglucosidasius GN=groL PE=3 SV=1 38 517 1.0E-15
sp|Q660M1|CH60_BORBP 60 kDa chaperonin OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=groL PE=3 SV=1 36 517 1.0E-15
sp|C3KUC8|CH60_CLOB6 60 kDa chaperonin OS=Clostridium botulinum (strain 657 / Type Ba4) GN=groL PE=3 SV=1 38 535 1.0E-15
sp|A7GIN3|CH60_CLOBL 60 kDa chaperonin OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=groL PE=3 SV=1 38 535 1.0E-15
sp|B1IFD4|CH60_CLOBK 60 kDa chaperonin OS=Clostridium botulinum (strain Okra / Type B1) GN=groL PE=3 SV=1 38 535 1.0E-15
sp|C1FLV5|CH60_CLOBJ 60 kDa chaperonin OS=Clostridium botulinum (strain Kyoto / Type A2) GN=groL PE=3 SV=1 38 535 1.0E-15
sp|A5I723|CH60_CLOBH 60 kDa chaperonin OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=groL PE=3 SV=1 38 535 1.0E-15
sp|A7FYP3|CH60_CLOB1 60 kDa chaperonin OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=groL PE=3 SV=1 38 535 1.0E-15
sp|Q0SMK4|CH60_BORAP 60 kDa chaperonin OS=Borrelia afzelii (strain PKo) GN=groL PE=3 SV=1 36 517 2.0E-15
sp|Q67KB8|CH60_SYMTH 60 kDa chaperonin OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=groL PE=3 SV=1 35 534 2.0E-15
sp|Q24QE3|CH60_DESHY 60 kDa chaperonin OS=Desulfitobacterium hafniense (strain Y51) GN=groL PE=3 SV=2 35 517 2.0E-15
sp|B1L1K0|CH60_CLOBM 60 kDa chaperonin OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=groL PE=3 SV=1 38 535 2.0E-15
sp|A9WJN7|CH601_CHLAA 60 kDa chaperonin 1 OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=groL1 PE=3 SV=1 36 535 2.0E-15
sp|B7J2K5|CH60_BORBZ 60 kDa chaperonin OS=Borrelia burgdorferi (strain ZS7) GN=groL PE=3 SV=1 36 517 2.0E-15
sp|P0C923|CH60_BORBU 60 kDa chaperonin OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=groL PE=3 SV=1 36 517 2.0E-15
sp|Q5L3E6|CH60_GEOKA 60 kDa chaperonin OS=Geobacillus kaustophilus (strain HTA426) GN=groL PE=3 SV=1 38 517 2.0E-15
sp|B5RPZ1|CH60_BORRA 60 kDa chaperonin OS=Borrelia recurrentis (strain A1) GN=groL PE=3 SV=1 36 540 2.0E-15
sp|B5RMJ5|CH60_BORDL 60 kDa chaperonin OS=Borrelia duttonii (strain Ly) GN=groL PE=3 SV=1 36 540 2.0E-15
sp|A1R074|CH60_BORT9 60 kDa chaperonin OS=Borrelia turicatae (strain 91E135) GN=groL PE=3 SV=1 36 540 2.0E-15
sp|A5WD52|CH60_PSYWF 60 kDa chaperonin OS=Psychrobacter sp. (strain PRwf-1) GN=groL PE=3 SV=1 38 533 2.0E-15
sp|B8FNT7|CH60_DESHD 60 kDa chaperonin OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=groL PE=3 SV=1 35 517 2.0E-15
sp|A7I0W5|CH60_CAMHC 60 kDa chaperonin OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=groL PE=3 SV=1 36 538 2.0E-15
sp|Q1H4F2|CH60_METFK 60 kDa chaperonin OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=groL PE=3 SV=1 30 534 3.0E-15
sp|P51349|CH60_PORPU 60 kDa chaperonin, chloroplastic OS=Porphyra purpurea GN=groL PE=3 SV=1 40 517 3.0E-15
sp|A0LR17|CH601_ACIC1 60 kDa chaperonin 1 OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=groL1 PE=3 SV=1 38 535 3.0E-15
sp|Q1AXU6|CH60_RUBXD 60 kDa chaperonin OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=groL PE=3 SV=1 38 534 3.0E-15
sp|Q2SDG0|CH60_HAHCH 60 kDa chaperonin OS=Hahella chejuensis (strain KCTC 2396) GN=groL PE=3 SV=1 38 517 4.0E-15
sp|Q9KI71|CH60_PARDN 60 kDa chaperonin OS=Parascardovia denticolens GN=groL PE=3 SV=2 38 517 4.0E-15
sp|Q8YQZ8|CH601_NOSS1 60 kDa chaperonin 1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=groL1 PE=3 SV=1 25 534 4.0E-15
sp|B2S1X8|CH60_TREPS 60 kDa chaperonin OS=Treponema pallidum subsp. pallidum (strain SS14) GN=groL PE=3 SV=1 36 534 4.0E-15
sp|P23033|CH60_TREPA 60 kDa chaperonin OS=Treponema pallidum (strain Nichols) GN=groL PE=1 SV=4 36 534 4.0E-15
sp|Q2LPJ8|CH601_SYNAS 60 kDa chaperonin 1 OS=Syntrophus aciditrophicus (strain SB) GN=groL1 PE=3 SV=1 38 539 4.0E-15
sp|B2G5X7|CH60_LACRJ 60 kDa chaperonin OS=Lactobacillus reuteri (strain JCM 1112) GN=groL PE=3 SV=1 38 538 5.0E-15
sp|A5VIE9|CH60_LACRD 60 kDa chaperonin OS=Lactobacillus reuteri (strain DSM 20016) GN=groL PE=3 SV=1 38 538 5.0E-15
sp|Q5N3T6|CH602_SYNP6 60 kDa chaperonin 2 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=groL2 PE=3 SV=1 35 535 5.0E-15
sp|A1R3H9|CH601_ARTAT 60 kDa chaperonin 1 OS=Arthrobacter aurescens (strain TC1) GN=groL1 PE=3 SV=1 38 534 5.0E-15
sp|A7GKG0|CH60_BACCN 60 kDa chaperonin OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=groL PE=3 SV=1 38 534 6.0E-15
sp|Q93GT6|CH60_TETHA 60 kDa chaperonin OS=Tetragenococcus halophilus GN=groL PE=3 SV=2 30 535 7.0E-15
sp|A0Q2T1|CH60_CLONN 60 kDa chaperonin OS=Clostridium novyi (strain NT) GN=groL PE=3 SV=1 38 516 7.0E-15
sp|B2GAI0|CH60_LACF3 60 kDa chaperonin OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=groL PE=3 SV=1 38 534 7.0E-15
sp|Q9AME7|CH60_STRAG 60 kDa chaperonin OS=Streptococcus agalactiae GN=groL PE=3 SV=1 38 538 8.0E-15
sp|Q1WSW0|CH60_LACS1 60 kDa chaperonin OS=Lactobacillus salivarius (strain UCC118) GN=groL PE=3 SV=1 38 540 8.0E-15
sp|P26209|CH60_BACP3 60 kDa chaperonin OS=Bacillus sp. (strain PS3) GN=groL PE=3 SV=1 38 517 1.0E-14
sp|O66190|CH60_ENTAS 60 kDa chaperonin (Fragment) OS=Enterobacter asburiae GN=groL PE=3 SV=1 38 517 1.0E-14
sp|Q9XCA9|CH60_RHOMR 60 kDa chaperonin OS=Rhodothermus marinus GN=groL PE=3 SV=1 25 537 1.0E-14
sp|Q29068|TCPG_PIG T-complex protein 1 subunit gamma (Fragment) OS=Sus scrofa GN=CCT3 PE=2 SV=1 31 109 1.0E-14
sp|A8LJP9|CH60_DINSH 60 kDa chaperonin OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=groL PE=3 SV=1 38 517 1.0E-14
sp|Q2LU42|CH603_SYNAS 60 kDa chaperonin 3 OS=Syntrophus aciditrophicus (strain SB) GN=groL3 PE=3 SV=1 38 523 1.0E-14
sp|O66200|CH60_ENTAG 60 kDa chaperonin (Fragment) OS=Enterobacter agglomerans GN=groL PE=3 SV=1 38 517 2.0E-14
sp|B7H4Q7|CH60_BACC4 60 kDa chaperonin OS=Bacillus cereus (strain B4264) GN=groL PE=3 SV=1 38 534 2.0E-14
sp|Q1XDD8|CH60_PYRYE 60 kDa chaperonin, chloroplastic OS=Pyropia yezoensis GN=groL PE=3 SV=2 43 517 2.0E-14
sp|B1HT15|CH60_LYSSC 60 kDa chaperonin OS=Lysinibacillus sphaericus (strain C3-41) GN=groL PE=3 SV=1 38 517 2.0E-14
sp|C5BDK5|CH60_EDWI9 60 kDa chaperonin OS=Edwardsiella ictaluri (strain 93-146) GN=groL PE=3 SV=1 38 517 2.0E-14
sp|Q814B0|CH60_BACCR 60 kDa chaperonin OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=groL PE=3 SV=1 38 534 2.0E-14
sp|A7H2F8|CH60_CAMJD 60 kDa chaperonin OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=groL PE=3 SV=1 36 534 2.0E-14
sp|A8FMS6|CH60_CAMJ8 60 kDa chaperonin OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=groL PE=3 SV=1 36 534 2.0E-14
sp|Q93EU6|CH60_ENTFA 60 kDa chaperonin OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=groL PE=3 SV=2 38 537 2.0E-14
sp|Q5HTP2|CH60_CAMJR 60 kDa chaperonin OS=Campylobacter jejuni (strain RM1221) GN=groL PE=3 SV=1 36 534 2.0E-14
sp|A7MMC0|CH60_CROS8 60 kDa chaperonin OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=groL PE=3 SV=1 38 517 2.0E-14
sp|Q3M704|CH601_ANAVT 60 kDa chaperonin 1 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=groL1 PE=3 SV=1 25 517 2.0E-14
sp|Q6HPC7|CH60_BACHK 60 kDa chaperonin OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=groL PE=3 SV=1 38 534 2.0E-14
sp|Q63GV7|CH60_BACCZ 60 kDa chaperonin OS=Bacillus cereus (strain ZK / E33L) GN=groL PE=3 SV=1 38 534 2.0E-14
sp|B9J1H2|CH60_BACCQ 60 kDa chaperonin OS=Bacillus cereus (strain Q1) GN=groL PE=3 SV=1 38 534 2.0E-14
sp|B7HS05|CH60_BACC7 60 kDa chaperonin OS=Bacillus cereus (strain AH187) GN=groL PE=3 SV=1 38 534 2.0E-14
sp|C1EUB1|CH60_BACC3 60 kDa chaperonin OS=Bacillus cereus (strain 03BB102) GN=groL PE=3 SV=1 38 534 2.0E-14
sp|Q73ER9|CH60_BACC1 60 kDa chaperonin OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=groL PE=3 SV=2 38 534 2.0E-14
sp|B7JM60|CH60_BACC0 60 kDa chaperonin OS=Bacillus cereus (strain AH820) GN=groL PE=3 SV=1 38 534 2.0E-14
sp|A0R8W4|CH60_BACAH 60 kDa chaperonin OS=Bacillus thuringiensis (strain Al Hakam) GN=groL PE=3 SV=1 38 534 2.0E-14
sp|C4L1L2|CH60_EXISA 60 kDa chaperonin OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=groL PE=3 SV=1 35 534 2.0E-14
sp|B2A5V3|CH60_NATTJ 60 kDa chaperonin OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=groL PE=3 SV=1 38 517 2.0E-14
sp|B1GYR7|CH60_UNCTG 60 kDa chaperonin OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=groL PE=3 SV=1 38 517 2.0E-14
sp|O66210|CH60_KLEOX 60 kDa chaperonin (Fragment) OS=Klebsiella oxytoca GN=groL PE=3 SV=1 38 517 2.0E-14
sp|B9KCR7|CH60_CAMLR 60 kDa chaperonin OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=groL PE=3 SV=1 36 534 3.0E-14
sp|B8D0Z4|CH60_HALOH 60 kDa chaperonin OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=groL PE=3 SV=1 38 517 3.0E-14
sp|Q9EY76|CH60_SCAIO 60 kDa chaperonin OS=Scardovia inopinata GN=groL PE=3 SV=2 38 517 3.0E-14
sp|Q8Y1P8|CH60_RALSO 60 kDa chaperonin OS=Ralstonia solanacearum (strain GMI1000) GN=groL PE=3 SV=1 38 520 3.0E-14
sp|Q0RB64|CH604_FRAAA 60 kDa chaperonin 4 OS=Frankia alni (strain ACN14a) GN=groL4 PE=3 SV=1 38 535 3.0E-14
sp|Q81VE1|CH60_BACAN 60 kDa chaperonin OS=Bacillus anthracis GN=groL PE=3 SV=1 38 534 3.0E-14
sp|C3L507|CH60_BACAC 60 kDa chaperonin OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=groL PE=3 SV=1 38 534 3.0E-14
sp|C3PAV1|CH60_BACAA 60 kDa chaperonin OS=Bacillus anthracis (strain A0248) GN=groL PE=3 SV=1 38 534 3.0E-14
sp|Q0RQ25|CH602_FRAAA 60 kDa chaperonin 2 OS=Frankia alni (strain ACN14a) GN=groL2 PE=3 SV=1 38 528 3.0E-14
sp|Q2J4P8|CH604_FRASC 60 kDa chaperonin 4 OS=Frankia sp. (strain CcI3) GN=groL4 PE=3 SV=1 38 535 3.0E-14
sp|B6JPA7|CH60_HELP2 60 kDa chaperonin OS=Helicobacter pylori (strain P12) GN=groL PE=3 SV=1 36 534 3.0E-14
sp|Q1CVE5|CH60_HELPH 60 kDa chaperonin OS=Helicobacter pylori (strain HPAG1) GN=groL PE=3 SV=1 36 534 3.0E-14
sp|Q4MPR6|CH60_BACCE 60 kDa chaperonin OS=Bacillus cereus GN=groL PE=1 SV=3 38 534 3.0E-14
sp|O78419|CH60_GUITH 60 kDa chaperonin, chloroplastic OS=Guillardia theta GN=groL PE=3 SV=1 40 517 3.0E-14
sp|Q2NBL8|CH601_ERYLH 60 kDa chaperonin 1 OS=Erythrobacter litoralis (strain HTCC2594) GN=groL1 PE=3 SV=1 38 538 3.0E-14
sp|P42383|CH60_HELPY 60 kDa chaperonin OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=groL PE=3 SV=2 36 534 4.0E-14
sp|A0T0H6|CH60_PHATC 60 kDa chaperonin, chloroplastic OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=groL PE=3 SV=1 43 517 4.0E-14
sp|Q17VC6|CH60_HELAH 60 kDa chaperonin OS=Helicobacter acinonychis (strain Sheeba) GN=groL PE=3 SV=1 36 534 4.0E-14
sp|A6VB57|CH60_PSEA7 60 kDa chaperonin OS=Pseudomonas aeruginosa (strain PA7) GN=groL PE=3 SV=1 38 517 4.0E-14
sp|Q8KJ20|CH60_STRAP 60 kDa chaperonin OS=Streptococcus anginosus GN=groL PE=3 SV=1 38 538 4.0E-14
sp|C4LCA2|CH60_TOLAT 60 kDa chaperonin OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=groL PE=3 SV=1 38 517 4.0E-14
sp|P35471|CH605_RHIME 60 kDa chaperonin 5 OS=Rhizobium meliloti (strain 1021) GN=groL5 PE=2 SV=2 38 540 4.0E-14
sp|O66214|CH60_RAOOR 60 kDa chaperonin (Fragment) OS=Raoultella ornithinolytica GN=groL PE=3 SV=1 38 517 4.0E-14
sp|A7GZ43|CH60_CAMC5 60 kDa chaperonin OS=Campylobacter curvus (strain 525.92) GN=groL PE=3 SV=1 36 531 4.0E-14
sp|P48216|CH60_PSEPU 60 kDa chaperonin OS=Pseudomonas putida GN=groL PE=1 SV=3 38 531 4.0E-14
sp|A6TH53|CH60_KLEP7 60 kDa chaperonin OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=groL PE=3 SV=1 38 517 4.0E-14
sp|O50305|CH60_BACHD 60 kDa chaperonin OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=groL PE=2 SV=2 38 532 4.0E-14
sp|Q2JYW6|CH604_RHIEC 60 kDa chaperonin 4 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=groL4 PE=3 SV=1 38 541 5.0E-14
sp|B0U418|CH60_XYLFM 60 kDa chaperonin OS=Xylella fastidiosa (strain M12) GN=groL PE=3 SV=1 38 541 5.0E-14
sp|P35470|CH602_RHIME 60 kDa chaperonin 2 OS=Rhizobium meliloti (strain 1021) GN=groL2 PE=2 SV=2 38 540 5.0E-14
sp|Q05972|CH601_SYNY3 60 kDa chaperonin 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=groL1 PE=1 SV=4 43 540 5.0E-14
sp|B5Z6D1|CH60_HELPG 60 kDa chaperonin OS=Helicobacter pylori (strain G27) GN=groL PE=3 SV=1 36 534 5.0E-14
sp|Q73NH7|CH60_TREDE 60 kDa chaperonin OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=groL PE=3 SV=1 36 534 5.0E-14
sp|B2UW12|CH60_HELPS 60 kDa chaperonin OS=Helicobacter pylori (strain Shi470) GN=groL PE=3 SV=1 36 534 5.0E-14
sp|B5Y368|CH60_KLEP3 60 kDa chaperonin OS=Klebsiella pneumoniae (strain 342) GN=groL PE=3 SV=1 38 517 5.0E-14
sp|Q9ZN50|CH60_HELPJ 60 kDa chaperonin OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=groL PE=3 SV=1 36 534 5.0E-14
sp|Q0KDR7|CH60_CUPNH 60 kDa chaperonin OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=groL PE=3 SV=1 38 520 5.0E-14
sp|Q3M1B1|CH603_ANAVT 60 kDa chaperonin 3 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=groL3 PE=3 SV=1 35 543 5.0E-14
sp|Q93GT8|CH60_COLMA 60 kDa chaperonin OS=Colwellia maris GN=groL PE=3 SV=2 38 525 6.0E-14
sp|B5EN19|CH60_ACIF5 60 kDa chaperonin OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=groL PE=3 SV=1 38 517 6.0E-14
sp|B7J561|CH60_ACIF2 60 kDa chaperonin OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=groL PE=3 SV=1 38 517 6.0E-14
sp|Q045Q8|CH60_LACGA 60 kDa chaperonin OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=groL PE=3 SV=1 38 540 6.0E-14
sp|A1W0K4|CH60_CAMJJ 60 kDa chaperonin OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=groL PE=3 SV=1 36 534 6.0E-14
sp|O69289|CH60_CAMJE 60 kDa chaperonin OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=groL PE=3 SV=2 36 534 6.0E-14
sp|P30718|CH60_PSEAE 60 kDa chaperonin OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=groL PE=1 SV=3 38 517 6.0E-14
sp|Q02H55|CH60_PSEAB 60 kDa chaperonin OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=groL PE=3 SV=1 38 517 6.0E-14
sp|B7UZG3|CH60_PSEA8 60 kDa chaperonin OS=Pseudomonas aeruginosa (strain LESB58) GN=groL PE=3 SV=1 38 517 6.0E-14
sp|B2VL84|CH60_ERWT9 60 kDa chaperonin OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=groL PE=3 SV=1 38 517 7.0E-14
sp|Q03H05|CH60_PEDPA 60 kDa chaperonin OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=groL PE=3 SV=1 38 517 7.0E-14
sp|B9DMM2|CH60_STACT 60 kDa chaperonin OS=Staphylococcus carnosus (strain TM300) GN=groL PE=3 SV=1 38 517 7.0E-14
sp|P49464|CH60_ODOSI 60 kDa chaperonin, chloroplastic OS=Odontella sinensis GN=groL PE=3 SV=1 43 522 7.0E-14
sp|B7IUT0|CH60_BACC2 60 kDa chaperonin OS=Bacillus cereus (strain G9842) GN=groL PE=3 SV=1 38 534 7.0E-14
sp|Q38YR7|CH60_LACSS 60 kDa chaperonin OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=groL PE=3 SV=1 38 541 7.0E-14
sp|A9VQG8|CH60_BACWK 60 kDa chaperonin OS=Bacillus weihenstephanensis (strain KBAB4) GN=groL PE=3 SV=1 38 534 7.0E-14
sp|O66198|CH60_ENTAK 60 kDa chaperonin OS=Enterobacter aerogenes (strain ATCC 13048 / DSM 30053 / JCM 1235 / KCTC 2190 / NBRC 13534 / NCIMB 10102 / NCTC 10006) GN=groL PE=3 SV=2 38 517 8.0E-14
sp|C1CTD6|CH60_STRZT 60 kDa chaperonin OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=groL PE=3 SV=1 38 538 8.0E-14
sp|C1CGD7|CH60_STRZJ 60 kDa chaperonin OS=Streptococcus pneumoniae (strain JJA) GN=groL PE=3 SV=1 38 538 8.0E-14
sp|P0A336|CH60_STRR6 60 kDa chaperonin OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=groL PE=3 SV=1 38 538 8.0E-14
sp|P0A335|CH60_STRPN 60 kDa chaperonin OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=groL PE=1 SV=1 38 538 8.0E-14
sp|B8ZNK9|CH60_STRPJ 60 kDa chaperonin OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=groL PE=3 SV=1 38 538 8.0E-14
sp|C1C9H6|CH60_STRP7 60 kDa chaperonin OS=Streptococcus pneumoniae (strain 70585) GN=groL PE=3 SV=1 38 538 8.0E-14
sp|B5E223|CH60_STRP4 60 kDa chaperonin OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=groL PE=3 SV=1 38 538 8.0E-14
sp|Q04IQ3|CH60_STRP2 60 kDa chaperonin OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=groL PE=3 SV=1 38 538 8.0E-14
sp|Q9KLC6|CH602_VIBCH 60 kDa chaperonin 2 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=groL2 PE=3 SV=1 38 529 9.0E-14
sp|A5F0I2|CH601_VIBC3 60 kDa chaperonin 1 OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=groL1 PE=3 SV=1 38 529 9.0E-14
sp|O66204|CH60_SERFI 60 kDa chaperonin (Fragment) OS=Serratia ficaria GN=groL PE=3 SV=1 38 517 9.0E-14
sp|Q487Q9|CH60_COLP3 60 kDa chaperonin OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=groL PE=3 SV=1 38 534 1.0E-13
sp|Q03SQ9|CH60_LACBA 60 kDa chaperonin OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=groL PE=3 SV=1 38 517 1.0E-13
sp|Q162U5|CH602_ROSDO 60 kDa chaperonin 2 OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=groL2 PE=3 SV=1 38 517 1.0E-13
sp|Q3IW60|CH602_RHOS4 60 kDa chaperonin 2 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=groL2 PE=3 SV=1 16 516 1.0E-13
sp|B2ILZ5|CH60_STRPS 60 kDa chaperonin OS=Streptococcus pneumoniae (strain CGSP14) GN=groL PE=3 SV=1 38 538 1.0E-13
sp|B1I8B2|CH60_STRPI 60 kDa chaperonin OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=groL PE=3 SV=1 38 538 1.0E-13
sp|O66206|CH60_SERMA 60 kDa chaperonin (Fragment) OS=Serratia marcescens GN=groL PE=3 SV=1 38 517 1.0E-13
sp|Q13IM9|CH605_BURXL 60 kDa chaperonin 5 OS=Burkholderia xenovorans (strain LB400) GN=groL5 PE=3 SV=1 38 534 1.0E-13
sp|Q46XW6|CH60_CUPPJ 60 kDa chaperonin OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=groL PE=3 SV=1 38 520 1.0E-13
sp|O66202|CH60_SERRU 60 kDa chaperonin (Fragment) OS=Serratia rubidaea GN=groL PE=3 SV=1 30 517 1.0E-13
sp|Q5WJN4|CH60_BACSK 60 kDa chaperonin OS=Bacillus clausii (strain KSM-K16) GN=groL PE=3 SV=1 38 529 1.0E-13
sp|A4J8H4|CH60_DESRM 60 kDa chaperonin OS=Desulfotomaculum reducens (strain MI-1) GN=groL PE=3 SV=1 35 517 1.0E-13
sp|O32847|CH60_LACZE 60 kDa chaperonin OS=Lactobacillus zeae GN=groL PE=3 SV=1 38 517 1.0E-13
sp|B3W9W7|CH60_LACCB 60 kDa chaperonin OS=Lactobacillus casei (strain BL23) GN=groL PE=3 SV=1 38 517 1.0E-13
sp|Q035Y9|CH60_LACC3 60 kDa chaperonin OS=Lactobacillus casei (strain ATCC 334) GN=groL PE=3 SV=1 38 517 1.0E-13
sp|Q28LY7|CH60_JANSC 60 kDa chaperonin OS=Jannaschia sp. (strain CCS1) GN=groL PE=3 SV=1 38 534 1.0E-13
sp|Q3K7L6|CH60_PSEPF 60 kDa chaperonin OS=Pseudomonas fluorescens (strain Pf0-1) GN=groL PE=3 SV=1 38 517 1.0E-13
sp|P0A338|CH602_THEVL 60 kDa chaperonin 2 OS=Thermosynechococcus vulcanus GN=groL2 PE=3 SV=1 35 534 1.0E-13
sp|P0A337|CH602_THEEB 60 kDa chaperonin 2 OS=Thermosynechococcus elongatus (strain BP-1) GN=groL2 PE=3 SV=1 35 534 1.0E-13
sp|Q87BC0|CH60_XYLFT 60 kDa chaperonin OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=groL PE=3 SV=1 38 541 1.0E-13
sp|B2I7D4|CH60_XYLF2 60 kDa chaperonin OS=Xylella fastidiosa (strain M23) GN=groL PE=3 SV=1 38 541 1.0E-13
sp|C6DKC7|CH60_PECCP 60 kDa chaperonin OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=groL PE=3 SV=1 38 517 1.0E-13
sp|C1CML7|CH60_STRZP 60 kDa chaperonin OS=Streptococcus pneumoniae (strain P1031) GN=groL PE=3 SV=1 38 538 1.0E-13
sp|Q4ZP20|CH60_PSEU2 60 kDa chaperonin OS=Pseudomonas syringae pv. syringae (strain B728a) GN=groL PE=3 SV=1 22 531 1.0E-13
sp|Q7U348|CH60_BLOFL 60 kDa chaperonin OS=Blochmannia floridanus GN=groL PE=3 SV=1 38 517 1.0E-13
sp|B3R2Y3|CH60_CUPTR 60 kDa chaperonin OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=groL PE=3 SV=1 38 520 2.0E-13
sp|Q46GW7|CH602_PROMT 60 kDa chaperonin 2 OS=Prochlorococcus marinus (strain NATL2A) GN=groL2 PE=3 SV=1 38 535 2.0E-13
sp|Q9PFP2|CH60_XYLFA 60 kDa chaperonin OS=Xylella fastidiosa (strain 9a5c) GN=groL PE=3 SV=1 38 541 2.0E-13
sp|A1B877|CH60_PARDP 60 kDa chaperonin OS=Paracoccus denitrificans (strain Pd 1222) GN=groL1 PE=3 SV=1 38 534 2.0E-13
sp|Q9Z462|CH60_PARDE 60 kDa chaperonin OS=Paracoccus denitrificans GN=groL PE=1 SV=2 38 534 2.0E-13
sp|O66026|CH60_KLEPN 60 kDa chaperonin OS=Klebsiella pneumoniae GN=groL PE=3 SV=1 38 517 2.0E-13
sp|Q8G879|CH60_BIFLO 60 kDa chaperonin OS=Bifidobacterium longum (strain NCC 2705) GN=groL PE=3 SV=1 38 534 2.0E-13
sp|B3DPK4|CH60_BIFLD 60 kDa chaperonin OS=Bifidobacterium longum (strain DJO10A) GN=groL PE=3 SV=1 38 534 2.0E-13
sp|O66222|CH60_ERWAP 60 kDa chaperonin (Fragment) OS=Erwinia aphidicola GN=groL PE=3 SV=1 38 517 2.0E-13
sp|C3K1A0|CH60_PSEFS 60 kDa chaperonin OS=Pseudomonas fluorescens (strain SBW25) GN=groL PE=3 SV=1 38 533 2.0E-13
sp|Q8DMD4|CH60_THEEB 60 kDa chaperonin OS=Thermosynechococcus elongatus (strain BP-1) GN=groL PE=3 SV=1 25 534 2.0E-13
sp|Q493W7|CH60_BLOPB 60 kDa chaperonin OS=Blochmannia pennsylvanicus (strain BPEN) GN=groL PE=3 SV=1 38 517 2.0E-13
sp|Q0VRW6|CH60_ALCBS 60 kDa chaperonin OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=groL PE=3 SV=1 38 534 2.0E-13
sp|A1TKQ5|CH60_ACIAC 60 kDa chaperonin OS=Acidovorax citrulli (strain AAC00-1) GN=groL PE=3 SV=1 38 539 2.0E-13
sp|Q1C0Y0|CH60_YERPA 60 kDa chaperonin OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=groL PE=3 SV=1 38 517 2.0E-13
sp|Q93M78|CH60_BIFAS 60 kDa chaperonin OS=Bifidobacterium animalis subsp. lactis (strain DSM 10140 / JCM 10602 / LMG 18314) GN=groL PE=3 SV=2 38 526 2.0E-13
sp|B8DTZ2|CH60_BIFA0 60 kDa chaperonin OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=groL PE=3 SV=1 38 526 2.0E-13
sp|B1JMR1|CH60_YERPY 60 kDa chaperonin OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=groL PE=3 SV=1 38 517 2.0E-13
sp|Q66FD5|CH60_YERPS 60 kDa chaperonin OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=groL PE=3 SV=1 38 517 2.0E-13
sp|A4TRR0|CH60_YERPP 60 kDa chaperonin OS=Yersinia pestis (strain Pestoides F) GN=groL PE=3 SV=1 38 517 2.0E-13
sp|Q1CED4|CH60_YERPN 60 kDa chaperonin OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=groL PE=3 SV=1 38 517 2.0E-13
sp|A9QYQ1|CH60_YERPG 60 kDa chaperonin OS=Yersinia pestis bv. Antiqua (strain Angola) GN=groL PE=3 SV=1 38 517 2.0E-13
sp|Q8ZIY3|CH60_YERPE 60 kDa chaperonin OS=Yersinia pestis GN=groL PE=3 SV=1 38 517 2.0E-13
sp|B2K1Y4|CH60_YERPB 60 kDa chaperonin OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=groL PE=3 SV=1 38 517 2.0E-13
sp|A7FN01|CH60_YERP3 60 kDa chaperonin OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=groL PE=3 SV=1 38 517 2.0E-13
sp|P20110|CH601_RHOSH 60 kDa chaperonin 1 OS=Rhodobacter sphaeroides GN=groL1 PE=1 SV=4 38 534 2.0E-13
sp|Q3J419|CH601_RHOS4 60 kDa chaperonin 1 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=groL1 PE=3 SV=1 38 534 2.0E-13
sp|A7HNA3|CH60_FERNB 60 kDa chaperonin OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=groL PE=3 SV=1 35 538 2.0E-13
sp|B3DZP5|CH60_METI4 60 kDa chaperonin OS=Methylacidiphilum infernorum (isolate V4) GN=groL PE=3 SV=1 36 534 2.0E-13
sp|P61438|CH60_LEPIC 60 kDa chaperonin OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=groL PE=2 SV=1 38 534 2.0E-13
sp|Q48EI5|CH60_PSE14 60 kDa chaperonin OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=groL PE=3 SV=1 22 531 2.0E-13
sp|Q21MD3|CH60_SACD2 60 kDa chaperonin OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=groL PE=3 SV=1 38 539 2.0E-13
sp|A7ZCV2|CH60_CAMC1 60 kDa chaperonin OS=Campylobacter concisus (strain 13826) GN=groL PE=3 SV=1 36 534 3.0E-13
sp|Q7MBC7|CH601_GLOVI 60 kDa chaperonin 1 OS=Gloeobacter violaceus (strain PCC 7421) GN=groL1 PE=3 SV=1 35 517 3.0E-13
sp|Q9KJ23|CH60_LACJO 60 kDa chaperonin OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=groL PE=3 SV=2 38 540 3.0E-13
sp|B1J3K5|CH60_PSEPW 60 kDa chaperonin OS=Pseudomonas putida (strain W619) GN=groL PE=3 SV=1 38 531 3.0E-13
sp|B6IU98|CH60_RHOCS 60 kDa chaperonin OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=groL PE=3 SV=1 38 523 3.0E-13
sp|Q16C40|CH601_ROSDO 60 kDa chaperonin 1 OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=groL1 PE=3 SV=1 38 539 3.0E-13
sp|Q12FH7|CH60_POLSJ 60 kDa chaperonin OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=groL PE=3 SV=1 38 517 3.0E-13
sp|Q8CWW6|CH60_STRMU 60 kDa chaperonin OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=groL PE=3 SV=1 38 517 3.0E-13
sp|Q1QDC9|CH60_PSYCK 60 kDa chaperonin OS=Psychrobacter cryohalolentis (strain K5) GN=groL PE=3 SV=1 38 517 4.0E-13
sp|Q8KJ18|CH60_STRCV 60 kDa chaperonin OS=Streptococcus constellatus GN=groL PE=3 SV=1 38 538 4.0E-13
sp|A0JT07|CH601_ARTS2 60 kDa chaperonin 1 OS=Arthrobacter sp. (strain FB24) GN=groL1 PE=3 SV=1 38 517 4.0E-13
sp|A7Z207|CH60_BACMF 60 kDa chaperonin OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=groL PE=3 SV=1 35 529 4.0E-13
sp|A8ERY3|CH60_ARCB4 60 kDa chaperonin OS=Arcobacter butzleri (strain RM4018) GN=groL PE=3 SV=1 38 534 4.0E-13
sp|Q31IT1|CH60_THICR 60 kDa chaperonin OS=Thiomicrospira crunogena (strain XCL-2) GN=groL PE=3 SV=1 38 517 4.0E-13
sp|P28598|CH60_BACSU 60 kDa chaperonin OS=Bacillus subtilis (strain 168) GN=groL PE=1 SV=3 35 517 4.0E-13
sp|P77829|CH601_BRADU 60 kDa chaperonin 1 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=groL1 PE=2 SV=3 38 538 4.0E-13
sp|O66220|CH60_PECCC 60 kDa chaperonin (Fragment) OS=Pectobacterium carotovorum subsp. carotovorum GN=groL PE=3 SV=1 38 517 4.0E-13
sp|P95647|CH602_RHOSH 60 kDa chaperonin 2 OS=Rhodobacter sphaeroides GN=groL2 PE=3 SV=1 16 516 4.0E-13
sp|Q2NW94|CH60_SODGM 60 kDa chaperonin OS=Sodalis glossinidius (strain morsitans) GN=groL PE=1 SV=1 38 517 5.0E-13
sp|A6U7N0|CH602_SINMW 60 kDa chaperonin 2 OS=Sinorhizobium medicae (strain WSM419) GN=groL2 PE=3 SV=1 38 539 5.0E-13
sp|P42385|CH60_NEIMB 60 kDa chaperonin OS=Neisseria meningitidis serogroup B (strain MC58) GN=groL PE=1 SV=2 30 534 5.0E-13
sp|P61439|CH60_LEPIN 60 kDa chaperonin OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=groL PE=3 SV=1 38 534 5.0E-13
sp|Q4FU94|CH60_PSYA2 60 kDa chaperonin OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=groL PE=3 SV=1 38 517 5.0E-13
sp|A4XYM0|CH60_PSEMY 60 kDa chaperonin OS=Pseudomonas mendocina (strain ymp) GN=groL PE=3 SV=1 38 534 5.0E-13
sp|P0C193|CH60_SODGL 60 kDa chaperonin OS=Sodalis glossinidius GN=groL PE=3 SV=1 38 517 5.0E-13
sp|O66218|CH60_PANAN 60 kDa chaperonin (Fragment) OS=Pantoea ananas GN=groL PE=3 SV=1 38 517 5.0E-13
sp|A4VP82|CH60_PSEU5 60 kDa chaperonin OS=Pseudomonas stutzeri (strain A1501) GN=groL PE=3 SV=1 38 534 5.0E-13
sp|B0KFQ2|CH60_PSEPG 60 kDa chaperonin OS=Pseudomonas putida (strain GB-1) GN=groL PE=3 SV=1 38 531 5.0E-13
sp|B1YEP6|CH60_EXIS2 60 kDa chaperonin OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=groL PE=3 SV=1 35 534 5.0E-13
sp|A8YTH8|CH60_LACH4 60 kDa chaperonin OS=Lactobacillus helveticus (strain DPC 4571) GN=groL PE=3 SV=1 38 534 5.0E-13
sp|Q7MAZ7|CH60_PHOLL 60 kDa chaperonin OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=groL PE=3 SV=1 38 517 6.0E-13
sp|B4EXE2|CH60_PROMH 60 kDa chaperonin OS=Proteus mirabilis (strain HI4320) GN=groL PE=3 SV=1 38 517 6.0E-13
sp|Q3ADX3|CH60_CARHZ 60 kDa chaperonin OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=groL PE=3 SV=1 35 534 6.0E-13
sp|Q1MJF2|CH60_RHIL3 60 kDa chaperonin OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=groL PE=3 SV=1 36 517 6.0E-13
sp|O50323|CH601_THEVL 60 kDa chaperonin 1 OS=Thermosynechococcus vulcanus GN=groL1 PE=3 SV=2 25 534 6.0E-13
sp|B8D6T6|CH60_BUCAT 60 kDa chaperonin OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=groL PE=3 SV=1 38 517 6.0E-13
sp|C0MES3|CH60_STRS7 60 kDa chaperonin OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=groL PE=3 SV=1 38 540 6.0E-13
sp|Q0SET3|CH601_RHOJR 60 kDa chaperonin 1 OS=Rhodococcus jostii (strain RHA1) GN=groL1 PE=3 SV=1 35 540 6.0E-13
sp|Q4K764|CH60_PSEF5 60 kDa chaperonin OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=groL PE=3 SV=1 38 533 7.0E-13
sp|O67943|CH60_AQUAE 60 kDa chaperonin OS=Aquifex aeolicus (strain VF5) GN=groL PE=3 SV=1 38 538 7.0E-13
sp|Q9REU4|CH60_BIFAA 60 kDa chaperonin OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=groL PE=3 SV=3 38 517 7.0E-13
sp|B2TIX0|CH60_CLOBB 60 kDa chaperonin OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=groL PE=3 SV=1 38 535 7.0E-13
sp|A1WZJ2|CH60_HALHL 60 kDa chaperonin OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=groL PE=3 SV=1 38 517 8.0E-13
sp|Q1I5E2|CH60_PSEE4 60 kDa chaperonin OS=Pseudomonas entomophila (strain L48) GN=groL PE=3 SV=1 38 533 8.0E-13
sp|Q0RBS5|CH603_FRAAA 60 kDa chaperonin 3 OS=Frankia alni (strain ACN14a) GN=groL3 PE=3 SV=2 38 525 8.0E-13
sp|Q391Y9|CH601_BURL3 60 kDa chaperonin 1 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=groL1 PE=3 SV=1 38 523 8.0E-13
sp|O68324|CH60_LACHE 60 kDa chaperonin OS=Lactobacillus helveticus GN=groL PE=3 SV=1 38 540 8.0E-13
sp|A6U901|CH603_SINMW 60 kDa chaperonin 3 OS=Sinorhizobium medicae (strain WSM419) GN=groL3 PE=3 SV=1 38 540 8.0E-13
sp|P30717|CH60_CLOAB 60 kDa chaperonin OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=groL PE=3 SV=1 38 516 8.0E-13
sp|P25750|CH60_BUCAI 60 kDa chaperonin OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=groL PE=3 SV=1 38 517 8.0E-13
sp|B8D8I2|CH60_BUCA5 60 kDa chaperonin OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=groL PE=3 SV=1 38 517 8.0E-13
sp|Q1GRD4|CH602_SPHAL 60 kDa chaperonin 2 OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=groL2 PE=3 SV=1 38 531 9.0E-13
sp|A8Z640|CH60_SULMW 60 kDa chaperonin OS=Sulcia muelleri (strain GWSS) GN=groL PE=3 SV=1 35 534 9.0E-13
sp|A3PID0|CH60_RHOS1 60 kDa chaperonin OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=groL PE=3 SV=1 38 534 9.0E-13
sp|B4SKL8|CH60_STRM5 60 kDa chaperonin OS=Stenotrophomonas maltophilia (strain R551-3) GN=groL PE=3 SV=1 38 517 9.0E-13
sp|A0AXY5|CH602_BURCH 60 kDa chaperonin 2 OS=Burkholderia cenocepacia (strain HI2424) GN=groL2 PE=3 SV=1 38 523 9.0E-13
sp|A6Q2B4|CH60_NITSB 60 kDa chaperonin OS=Nitratiruptor sp. (strain SB155-2) GN=groL PE=3 SV=1 38 534 9.0E-13
sp|P31294|CH60_HAEDU 60 kDa chaperonin OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=groL PE=3 SV=2 38 517 9.0E-13
sp|B5F2L0|CH60_SALA4 60 kDa chaperonin OS=Salmonella agona (strain SL483) GN=groL PE=3 SV=1 38 517 9.0E-13
sp|P0A1D3|CH60_SALTY 60 kDa chaperonin OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=groL PE=3 SV=2 38 517 9.0E-13
sp|P0A1D4|CH60_SALTI 60 kDa chaperonin OS=Salmonella typhi GN=groL PE=3 SV=2 38 517 9.0E-13
sp|B4TSC6|CH60_SALSV 60 kDa chaperonin OS=Salmonella schwarzengrund (strain CVM19633) GN=groL PE=3 SV=1 38 517 9.0E-13
sp|B5BKF4|CH60_SALPK 60 kDa chaperonin OS=Salmonella paratyphi A (strain AKU_12601) GN=groL PE=3 SV=1 38 517 9.0E-13
sp|C0Q6A2|CH60_SALPC 60 kDa chaperonin OS=Salmonella paratyphi C (strain RKS4594) GN=groL PE=3 SV=1 38 517 9.0E-13
sp|A9N3Z7|CH60_SALPB 60 kDa chaperonin OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=groL PE=3 SV=1 38 517 9.0E-13
sp|Q5PL62|CH60_SALPA 60 kDa chaperonin OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=groL PE=3 SV=1 38 517 9.0E-13
sp|B4TF80|CH60_SALHS 60 kDa chaperonin OS=Salmonella heidelberg (strain SL476) GN=groL PE=3 SV=1 38 517 9.0E-13
sp|B5R005|CH60_SALEP 60 kDa chaperonin OS=Salmonella enteritidis PT4 (strain P125109) GN=groL PE=3 SV=1 38 517 9.0E-13
sp|B5FRK2|CH60_SALDC 60 kDa chaperonin OS=Salmonella dublin (strain CT_02021853) GN=groL PE=3 SV=1 38 517 9.0E-13
sp|Q57GP7|CH60_SALCH 60 kDa chaperonin OS=Salmonella choleraesuis (strain SC-B67) GN=groL PE=3 SV=1 38 517 9.0E-13
sp|Q4JTF2|CH602_CORJK 60 kDa chaperonin 2 OS=Corynebacterium jeikeium (strain K411) GN=groL2 PE=3 SV=1 35 517 9.0E-13
sp|A3NHB6|CH602_BURP6 60 kDa chaperonin 2 OS=Burkholderia pseudomallei (strain 668) GN=groL2 PE=3 SV=1 38 539 9.0E-13
sp|B2UZ02|CH60_CLOBA 60 kDa chaperonin OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=groL PE=3 SV=1 38 535 9.0E-13
sp|A1WL05|CH60_VEREI 60 kDa chaperonin OS=Verminephrobacter eiseniae (strain EF01-2) GN=groL PE=3 SV=1 38 534 1.0E-12
sp|B0CEZ1|CH602_ACAM1 60 kDa chaperonin 2 OS=Acaryochloris marina (strain MBIC 11017) GN=groL2 PE=3 SV=1 25 534 1.0E-12
sp|Q8KTS0|CH60_TREPR 60 kDa chaperonin OS=Tremblaya princeps GN=groL PE=3 SV=1 38 536 1.0E-12
sp|A1SYD3|CH603_PSYIN 60 kDa chaperonin 3 OS=Psychromonas ingrahamii (strain 37) GN=groL3 PE=3 SV=1 38 517 1.0E-12
sp|O59722|FAB1_SCHPO 1-phosphatidylinositol 3-phosphate 5-kinase fab1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fab1 PE=3 SV=2 197 397 1.0E-12
sp|Q6D9J0|CH60_PECAS 60 kDa chaperonin OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=groL PE=3 SV=1 38 517 1.0E-12
sp|Q64QU2|CH60_BACFR 60 kDa chaperonin OS=Bacteroides fragilis (strain YCH46) GN=groL PE=3 SV=1 25 532 1.0E-12
sp|Q5LAF6|CH60_BACFN 60 kDa chaperonin OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=groL PE=3 SV=1 25 532 1.0E-12
sp|A3CKI1|CH60_STRSV 60 kDa chaperonin OS=Streptococcus sanguinis (strain SK36) GN=groL PE=3 SV=1 38 538 1.0E-12
sp|Q8KJ16|CH60_STRSA 60 kDa chaperonin OS=Streptococcus sanguinis GN=groL PE=3 SV=1 38 538 1.0E-12
sp|A3P2X2|CH602_BURP0 60 kDa chaperonin 2 OS=Burkholderia pseudomallei (strain 1106a) GN=groL2 PE=3 SV=1 38 539 1.0E-12
sp|O66194|CH60_PLUGE 60 kDa chaperonin (Fragment) OS=Pluralibacter gergoviae GN=groL PE=3 SV=1 38 517 1.0E-12
sp|A1VJZ8|CH602_POLNA 60 kDa chaperonin 2 OS=Polaromonas naphthalenivorans (strain CJ2) GN=groL2 PE=3 SV=1 38 534 1.0E-12
sp|Q3YUJ7|CH60_SHISS 60 kDa chaperonin OS=Shigella sonnei (strain Ss046) GN=groL PE=3 SV=1 38 517 1.0E-12
sp|P0A6F8|CH60_SHIFL 60 kDa chaperonin OS=Shigella flexneri GN=groL PE=3 SV=2 38 517 1.0E-12
sp|Q0SXD6|CH60_SHIF8 60 kDa chaperonin OS=Shigella flexneri serotype 5b (strain 8401) GN=groL PE=3 SV=1 38 517 1.0E-12
sp|Q328C4|CH60_SHIDS 60 kDa chaperonin OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=groL PE=3 SV=1 38 517 1.0E-12
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0097159 organic cyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0030554 adenyl nucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0032553 ribonucleotide binding No
GO:0043168 anion binding No
GO:0036094 small molecule binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0097367 carbohydrate derivative binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3714
MSFGGQTPTIIVLKEGTDTSQGKGQIILNINACVAVQNTIKPTLGPYGGDLLMVDENGRQTITNDGATVMKLLDI
VHPAARILVDIARSQDAEVGDGTTSVVVLAGEILKEVKEHVEQGVSSQVMIKGLRKACQMAVNKIKEIAISTDEG
NRRETLSKLAATAMTSKLIKRNTDFFTKMVVDAVLSLDQNDLNEKLIGVKKIPGGSLTDSLFVNGVAFKKTFSYA
GFEQQPKSFVKPKIVCLNVELELKAEKDNAEVRVEQVSEYQAIVDAEWKIIYNKLEAISKTGAKVVLSKLPIGDL
ATQYFADRDIFCAGRVTSEDLERVVQATGATIQSTCSDILAQHLGTCGRFEERQIGGERFNFFEECPEAKSCTLV
LRGGAEQFIAEVERSLHDAIMIVKRAIKNQLIVGGGGAVEMELSAYLHGFADKKIPHKQQTIIKSFARALEVIPR
QLCDNAGFDSTEILNKLRVEHRMGRTWSGVDFNQEGVADMMDRFVWEPALIKINAIQAATEASCLILGVDETIRN
EESAKPQAPGQLPPGAAQRALRGRGRGMPRR*
Coding >OphauB2|3714
ATGTCATTTGGAGGCCAAACACCCACCATTATCGTCCTTAAAGAAGGAACCGACACTTCGCAGGGCAAGGGACAA
ATAATTTTAAATATCAATGCCTGCGTGGCGGTGCAAAACACCATCAAGCCCACTCTGGGCCCGTATGGCGGCGAC
CTGCTCATGGTGGACGAGAACGGACGGCAGACAATCACCAATGATGGCGCCACTGTGATGAAGCTCCTCGATATC
GTTCACCCGGCGGCGCGTATTCTTGTTGACATTGCTCGATCGCAAGACGCCGAGGTGGGCGACGGCACCACCTCG
GTCGTCGTTCTCGCTGGAGAGATTCTCAAAGAGGTCAAGGAACACGTTGAGCAAGGTGTCAGCTCGCAGGTCATG
ATTAAAGGTCTCCGAAAAGCCTGTCAGATGGCTGTAAACAAGATCAAGGAAATAGCCATCAGTACAGACGAGGGC
AATCGTCGCGAGACGCTCTCCAAGCTTGCAGCCACCGCTATGACGAGCAAGCTTATCAAGCGCAACACGGATTTC
TTCACAAAAATGGTGGTTGATGCTGTGTTATCCCTGGACCAGAACGATCTCAATGAAAAGCTTATTGGCGTCAAG
AAGATTCCAGGGGGTTCTTTGACTGACTCACTTTTTGTCAATGGGGTTGCCTTCAAAAAGACTTTTTCATATGCT
GGCTTCGAGCAACAACCAAAGTCGTTTGTGAAGCCCAAGATTGTATGTCTCAACGTTGAGCTCGAGCTCAAAGCC
GAAAAAGACAACGCCGAGGTCCGTGTTGAGCAGGTCTCCGAGTATCAGGCTATTGTCGATGCCGAGTGGAAGATT
ATCTACAATAAGCTGGAGGCTATATCCAAGACGGGCGCCAAGGTGGTGCTGAGCAAGCTTCCCATTGGAGATTTG
GCGACACAGTACTTTGCCGACCGCGACATCTTTTGCGCCGGACGTGTCACGTCTGAGGACTTGGAGCGCGTTGTC
CAAGCCACAGGGGCTACCATTCAGTCAACCTGCTCGGATATTCTAGCTCAACATCTTGGGACTTGTGGTCGCTTT
GAGGAGCGGCAAATTGGTGGCGAACGTTTCAACTTTTTCGAGGAGTGCCCCGAAGCCAAGTCGTGCACTCTGGTG
CTACGCGGAGGTGCTGAACAGTTTATTGCAGAGGTGGAGCGGTCGCTGCATGATGCCATTATGATTGTAAAGCGC
GCCATTAAAAACCAGCTAATTGTTGGTGGTGGCGGTGCTGTTGAGATGGAACTTTCGGCCTATCTACATGGCTTT
GCGGATAAGAAGATACCCCACAAACAACAGACCATTATCAAGTCTTTTGCCAGGGCGCTCGAGGTGATACCTCGG
CAGCTTTGCGACAATGCTGGATTTGACTCTACTGAGATTCTCAATAAACTGCGTGTGGAACACCGCATGGGCAGG
ACTTGGTCGGGCGTCGACTTCAACCAGGAAGGGGTGGCTGATATGATGGACCGCTTCGTCTGGGAACCGGCGCTC
ATCAAGATTAATGCTATCCAAGCTGCAACCGAGGCCAGCTGTCTCATTCTCGGGGTCGACGAGACAATCCGCAAC
GAGGAGAGCGCGAAGCCCCAGGCACCAGGTCAGCTGCCTCCAGGTGCAGCTCAGCGAGCGCTTAGGGGCAGGGGT
CGAGGTATGCCACGTAGGTAG
Transcript >OphauB2|3714
ATGTCATTTGGAGGCCAAACACCCACCATTATCGTCCTTAAAGAAGGAACCGACACTTCGCAGGGCAAGGGACAA
ATAATTTTAAATATCAATGCCTGCGTGGCGGTGCAAAACACCATCAAGCCCACTCTGGGCCCGTATGGCGGCGAC
CTGCTCATGGTGGACGAGAACGGACGGCAGACAATCACCAATGATGGCGCCACTGTGATGAAGCTCCTCGATATC
GTTCACCCGGCGGCGCGTATTCTTGTTGACATTGCTCGATCGCAAGACGCCGAGGTGGGCGACGGCACCACCTCG
GTCGTCGTTCTCGCTGGAGAGATTCTCAAAGAGGTCAAGGAACACGTTGAGCAAGGTGTCAGCTCGCAGGTCATG
ATTAAAGGTCTCCGAAAAGCCTGTCAGATGGCTGTAAACAAGATCAAGGAAATAGCCATCAGTACAGACGAGGGC
AATCGTCGCGAGACGCTCTCCAAGCTTGCAGCCACCGCTATGACGAGCAAGCTTATCAAGCGCAACACGGATTTC
TTCACAAAAATGGTGGTTGATGCTGTGTTATCCCTGGACCAGAACGATCTCAATGAAAAGCTTATTGGCGTCAAG
AAGATTCCAGGGGGTTCTTTGACTGACTCACTTTTTGTCAATGGGGTTGCCTTCAAAAAGACTTTTTCATATGCT
GGCTTCGAGCAACAACCAAAGTCGTTTGTGAAGCCCAAGATTGTATGTCTCAACGTTGAGCTCGAGCTCAAAGCC
GAAAAAGACAACGCCGAGGTCCGTGTTGAGCAGGTCTCCGAGTATCAGGCTATTGTCGATGCCGAGTGGAAGATT
ATCTACAATAAGCTGGAGGCTATATCCAAGACGGGCGCCAAGGTGGTGCTGAGCAAGCTTCCCATTGGAGATTTG
GCGACACAGTACTTTGCCGACCGCGACATCTTTTGCGCCGGACGTGTCACGTCTGAGGACTTGGAGCGCGTTGTC
CAAGCCACAGGGGCTACCATTCAGTCAACCTGCTCGGATATTCTAGCTCAACATCTTGGGACTTGTGGTCGCTTT
GAGGAGCGGCAAATTGGTGGCGAACGTTTCAACTTTTTCGAGGAGTGCCCCGAAGCCAAGTCGTGCACTCTGGTG
CTACGCGGAGGTGCTGAACAGTTTATTGCAGAGGTGGAGCGGTCGCTGCATGATGCCATTATGATTGTAAAGCGC
GCCATTAAAAACCAGCTAATTGTTGGTGGTGGCGGTGCTGTTGAGATGGAACTTTCGGCCTATCTACATGGCTTT
GCGGATAAGAAGATACCCCACAAACAACAGACCATTATCAAGTCTTTTGCCAGGGCGCTCGAGGTGATACCTCGG
CAGCTTTGCGACAATGCTGGATTTGACTCTACTGAGATTCTCAATAAACTGCGTGTGGAACACCGCATGGGCAGG
ACTTGGTCGGGCGTCGACTTCAACCAGGAAGGGGTGGCTGATATGATGGACCGCTTCGTCTGGGAACCGGCGCTC
ATCAAGATTAATGCTATCCAAGCTGCAACCGAGGCCAGCTGTCTCATTCTCGGGGTCGACGAGACAATCCGCAAC
GAGGAGAGCGCGAAGCCCCAGGCACCAGGTCAGCTGCCTCCAGGTGCAGCTCAGCGAGCGCTTAGGGGCAGGGGT
CGAGGTATGCCACGTAGGTAG
Gene >OphauB2|3714
ATGTCATTTGGAGGCCAAACACCCACCATTATCGTCCTTAAAGAAGGTAAGCAGGCCGCGACTCTTGCTACCAAG
ACTAGCTCCTCGCCCTCGCATCATCCGGCTGACAGCTCAATTTGTCCAGGAACCGACACTTCGCAGGGCAAGGGA
CAAATAATTTTAAATATCAATGCCTGCGTGGCGGTGCAAAACACCATCAAGCCCACTCTGGGCCCGTATGGCGGC
GACCTGCTCATGGTGGACGAGAACGGACGGCAGACAATCACCAATGATGGCGCCACTGTGATGAAGGTGCGACAG
CTCTCTGTTTACATTTTGGTCACTGTTACGCGCCTCTCTCTAATGCCCTACAGCTCCTCGATATCGTTCACCCGG
CGGCGCGTATTCTTGTTGACATTGCTCGATCGCAAGACGCCGAGGTGGGCGACGGCACCACCTCGGTCGTCGTTC
TCGCTGGAGAGATTCTCAAAGAGGTCAAGGAACACGTTGAGCAAGGTGTCAGCTCGCAGGTCATGATTAAAGGTC
TCCGAAAAGCCTGTCAGATGGCTGTAAACAAGATCAAGGAAATAGCCATCAGTACAGACGAGGGCAATCGTCGCG
AGACGCTCTCCAAGCTTGCAGCCACCGCTATGACGAGCAAGCTTATCAAGCGCAACACGGATTTCTTCACAAAAA
GTACGTGTACACGGGGTGGCGCACGGTCCAGGGCCTTGGGAGAACTGACATGCGAACATCTACAGTGGTGGTTGA
TGCTGTGTTATCCCTGGACCAGAACGATCTCAATGAAAAGCTTATTGGCGTCAAGAAGATTCCAGGGGGTTCTTT
GACTGACTCACTTTTTGTCAATGGGGTTGCCTTCAAAAAGACTTTTTCATATGCTGGCTTCGAGCAACAACCAAA
GTCGTTTGTGAAGCCCAAGATTGTATGTCTCAACGTTGAGCTCGAGCTCAAAGCCGAAAAAGACAACGCCGAGGT
CCGTGTTGAGCAGGTCTCCGAGTATCAGGCTATTGTCGATGCCGAGTGGAAGATTATCTACAATAAGCTGGAGGC
TATATCCAAGACGGGCGCCAAGGTGGTGCTGAGCAAGCTTCCCATTGGAGATTTGGCGACACAGTACTTTGCCGA
CCGCGACATCTTTTGCGCCGGACGTGTCACGTCTGAGGACTTGGAGCGCGTTGTCCAAGCCACAGGGGCTACCAT
TCAGTCAACCTGCTCGGATATTCTAGCTCAACATCTTGGGACTTGTGGTCGCTTTGAGGAGCGGCAAATTGGTGG
CGAACGTTTCAACTTTTTCGAGGAGTGCCCCGAAGCCAAGTCGTGCACTCTGGTGCTACGCGGAGGTGCTGAACA
GTTTATTGCAGAGGTGGAGCGGTCGCTGCATGATGCCATTATGATTGTAAAGCGCGCCATTAAAAACCAGCTAAT
TGTTGGTGGTGGCGGTGCTGTTGAGATGGAACTTTCGGCCTATCTACATGGCTTTGCGGATAAGAAGATACCCCA
CAAACAACAGACCATTATCAAGTCTTTTGCCAGGGCGCTCGAGGTGATACCTCGGCAGCTTTGCGACAATGCTGG
ATTTGACTCTACTGAGATTCTCAATAAACTGCGTGTGGAACACCGCATGGGCAGGACTTGGTCGGGCGTCGACTT
CAACCAGGAAGGGGTGGCTGATATGATGGACCGCTTCGTCTGGGAACCGGCGCTCATCAAGATTAATGCTATCCA
AGCTGCAACCGAGGCCAGCTGTCTCATTCTCGGGGTCGACGAGACAATCCGCAACGAGGAGAGCGCGAAGCCCCA
GGCACCAGGTCAGCTGCCTCCAGGTGCAGCTCAGCGAGCGCTTAGGGGCAGGGGTCGAGGTATGCCACGTAGGTA
G

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail