Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3711
Gene name
LocationContig_237:15873..19362
Strand-
Gene length (bp)3489
Transcript length (bp)3489
Coding sequence length (bp)3489
Protein length (aa) 1163

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00176 SNF2-rel_dom SNF2-related domain 2.0E-71 420 732
PF00271 Helicase_C Helicase conserved C-terminal domain 1.0E-15 767 866
PF04851 ResIII Type III restriction enzyme, res subunit 8.0E-07 420 600

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UR24|RHP26_SCHPO DNA repair protein rhp26 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp26 PE=3 SV=1 338 1005 0.0E+00
sp|P40352|RAD26_YEAST DNA repair and recombination protein RAD26 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD26 PE=1 SV=1 346 1082 0.0E+00
sp|Q9ZV43|CHR8_ARATH Protein CHROMATIN REMODELING 8 OS=Arabidopsis thaliana GN=CHR8 PE=2 SV=1 403 1158 0.0E+00
sp|Q03468|ERCC6_HUMAN DNA excision repair protein ERCC-6 OS=Homo sapiens GN=ERCC6 PE=1 SV=1 346 938 0.0E+00
sp|Q8W103|CHR24_ARATH Protein CHROMATIN REMODELING 24 OS=Arabidopsis thaliana GN=CHR24 PE=2 SV=1 409 924 6.0E-95
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UR24|RHP26_SCHPO DNA repair protein rhp26 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp26 PE=3 SV=1 338 1005 0.0E+00
sp|P40352|RAD26_YEAST DNA repair and recombination protein RAD26 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD26 PE=1 SV=1 346 1082 0.0E+00
sp|Q9ZV43|CHR8_ARATH Protein CHROMATIN REMODELING 8 OS=Arabidopsis thaliana GN=CHR8 PE=2 SV=1 403 1158 0.0E+00
sp|Q03468|ERCC6_HUMAN DNA excision repair protein ERCC-6 OS=Homo sapiens GN=ERCC6 PE=1 SV=1 346 938 0.0E+00
sp|Q8W103|CHR24_ARATH Protein CHROMATIN REMODELING 24 OS=Arabidopsis thaliana GN=CHR24 PE=2 SV=1 409 924 6.0E-95
sp|A2BGR3|ERC6L_DANRE DNA excision repair protein ERCC-6-like OS=Danio rerio GN=ercc6l PE=1 SV=1 404 918 9.0E-92
sp|A6QQR4|ERC6L_BOVIN DNA excision repair protein ERCC-6-like OS=Bos taurus GN=ERCC6L PE=2 SV=1 400 920 5.0E-90
sp|Q8BHK9|ERC6L_MOUSE DNA excision repair protein ERCC-6-like OS=Mus musculus GN=Ercc6l PE=1 SV=1 402 920 5.0E-87
sp|Q2NKX8|ERC6L_HUMAN DNA excision repair protein ERCC-6-like OS=Homo sapiens GN=ERCC6L PE=1 SV=1 403 893 8.0E-87
sp|O43065|MOT1_SCHPO Probable helicase mot1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mot1 PE=1 SV=4 406 920 4.0E-86
sp|O14981|BTAF1_HUMAN TATA-binding protein-associated factor 172 OS=Homo sapiens GN=BTAF1 PE=1 SV=2 408 951 4.0E-85
sp|P32333|MOT1_YEAST TATA-binding protein-associated factor MOT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MOT1 PE=1 SV=1 407 919 2.0E-79
sp|Q9UTN6|SNF21_SCHPO Chromatin structure-remodeling complex subunit snf21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snf21 PE=1 SV=1 400 902 2.0E-79
sp|Q6PGB8|SMCA1_MOUSE Probable global transcription activator SNF2L1 OS=Mus musculus GN=Smarca1 PE=1 SV=1 420 889 4.0E-79
sp|O94421|SNF22_SCHPO SWI/SNF chromatin-remodeling complex subunit snf22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snf22 PE=1 SV=2 374 902 3.0E-78
sp|Q9Y620|RA54B_HUMAN DNA repair and recombination protein RAD54B OS=Homo sapiens GN=RAD54B PE=1 SV=1 420 934 7.0E-78
sp|Q5T890|ER6L2_HUMAN DNA excision repair protein ERCC-6-like 2 OS=Homo sapiens GN=ERCC6L2 PE=1 SV=2 394 894 1.0E-77
sp|Q6PFE3|RA54B_MOUSE DNA repair and recombination protein RAD54B OS=Mus musculus GN=Rad54b PE=2 SV=1 420 930 1.0E-77
sp|Q9DG67|RA54B_CHICK DNA repair and recombination protein RAD54B OS=Gallus gallus GN=RAD54B PE=2 SV=1 420 920 1.0E-77
sp|O60264|SMCA5_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Homo sapiens GN=SMARCA5 PE=1 SV=1 420 889 2.0E-77
sp|Q91ZW3|SMCA5_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Mus musculus GN=Smarca5 PE=1 SV=1 420 889 6.0E-77
sp|A3KMX0|ER6L2_BOVIN DNA excision repair protein ERCC-6-like 2 OS=Bos taurus GN=ERCC6L2 PE=2 SV=3 394 894 9.0E-77
sp|Q9XFH4|DDM1_ARATH ATP-dependent DNA helicase DDM1 OS=Arabidopsis thaliana GN=DDM1 PE=1 SV=1 407 970 1.0E-76
sp|B4MX21|RAD54_DROWI DNA repair and recombination protein RAD54-like OS=Drosophila willistoni GN=okr PE=3 SV=1 362 921 2.0E-76
sp|B4JCS7|RAD54_DROGR DNA repair and recombination protein RAD54-like OS=Drosophila grimshawi GN=okr PE=3 SV=1 362 921 2.0E-76
sp|P28370|SMCA1_HUMAN Probable global transcription activator SNF2L1 OS=Homo sapiens GN=SMARCA1 PE=1 SV=2 420 889 4.0E-76
sp|B4KHL5|RAD54_DROMO DNA repair and recombination protein RAD54-like OS=Drosophila mojavensis GN=okr PE=3 SV=1 420 921 6.0E-76
sp|Q5A310|ISW2_CANAL ISWI chromatin-remodeling complex ATPase ISW2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ISW2 PE=2 SV=1 420 909 7.0E-76
sp|Q22516|CHD3_CAEEL Chromodomain-helicase-DNA-binding protein 3 homolog OS=Caenorhabditis elegans GN=chd-3 PE=2 SV=2 411 915 1.0E-75
sp|Q9JIM3|ER6L2_MOUSE DNA excision repair protein ERCC-6-like 2 OS=Mus musculus GN=Ercc6l2 PE=1 SV=3 394 894 1.0E-75
sp|P51532|SMCA4_HUMAN Transcription activator BRG1 OS=Homo sapiens GN=SMARCA4 PE=1 SV=2 420 951 1.0E-75
sp|Q08773|ISW2_YEAST ISWI chromatin-remodeling complex ATPase ISW2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ISW2 PE=1 SV=1 420 889 2.0E-75
sp|P22082|SNF2_YEAST Transcription regulatory protein SNF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF2 PE=1 SV=1 416 902 4.0E-75
sp|Q29KH2|RAD54_DROPS DNA repair and recombination protein RAD54-like OS=Drosophila pseudoobscura pseudoobscura GN=okr PE=3 SV=2 420 921 6.0E-75
sp|P38144|ISW1_YEAST ISWI chromatin-remodeling complex ATPase ISW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ISW1 PE=1 SV=2 367 889 7.0E-75
sp|A7Z019|SMCA4_BOVIN Transcription activator BRG1 OS=Bos taurus GN=SMARCA4 PE=2 SV=1 420 902 8.0E-75
sp|Q3TKT4|SMCA4_MOUSE Transcription activator BRG1 OS=Mus musculus GN=Smarca4 PE=1 SV=1 420 902 9.0E-75
sp|Q8K1P7|SMCA4_RAT Transcription activator BRG1 OS=Rattus norvegicus GN=Smarca4 PE=1 SV=1 420 902 9.0E-75
sp|F4K128|CHR23_ARATH Probable ATP-dependent DNA helicase CHR23 OS=Arabidopsis thaliana GN=CHR23 PE=2 SV=1 417 902 1.0E-74
sp|P32597|STH1_YEAST Nuclear protein STH1/NPS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STH1 PE=1 SV=1 399 902 1.0E-74
sp|P32863|RAD54_YEAST DNA repair and recombination protein RAD54 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD54 PE=1 SV=1 437 947 2.0E-74
sp|P25439|BRM_DROME ATP-dependent helicase brm OS=Drosophila melanogaster GN=brm PE=1 SV=2 413 902 2.0E-74
sp|Q24368|ISWI_DROME Chromatin-remodeling complex ATPase chain Iswi OS=Drosophila melanogaster GN=Iswi PE=1 SV=1 420 889 2.0E-74
sp|Q6DIC0|SMCA2_MOUSE Probable global transcription activator SNF2L2 OS=Mus musculus GN=Smarca2 PE=1 SV=1 413 902 3.0E-74
sp|B4GS98|RAD54_DROPE DNA repair and recombination protein RAD54-like OS=Drosophila persimilis GN=okr PE=3 SV=1 420 921 4.0E-74
sp|P51531|SMCA2_HUMAN Probable global transcription activator SNF2L2 OS=Homo sapiens GN=SMARCA2 PE=1 SV=2 413 902 5.0E-74
sp|Q8RWY3|ISW2_ARATH ISWI chromatin-remodeling complex ATPase CHR11 OS=Arabidopsis thaliana GN=CHR11 PE=1 SV=4 407 889 5.0E-74
sp|B4M9A8|RAD54_DROVI DNA repair and recombination protein RAD54-like OS=Drosophila virilis GN=okr PE=3 SV=1 362 921 8.0E-74
sp|P41410|RAD54_SCHPO DNA repair protein rhp54 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp54 PE=1 SV=2 420 919 8.0E-74
sp|O12944|RAD54_CHICK DNA repair and recombination protein RAD54-like (Fragment) OS=Gallus gallus GN=RAD54L PE=2 SV=1 420 922 1.0E-73
sp|B5BT18|BTAF1_ARATH TATA-binding protein-associated factor BTAF1 OS=Arabidopsis thaliana GN=BTAF1 PE=1 SV=1 408 920 2.0E-73
sp|P41877|ISW1_CAEEL Chromatin-remodeling complex ATPase chain isw-1 OS=Caenorhabditis elegans GN=isw-1 PE=1 SV=2 397 902 4.0E-73
sp|F4JY24|CHR17_ARATH ISWI chromatin-remodeling complex ATPase CHR17 OS=Arabidopsis thaliana GN=CHR17 PE=1 SV=1 407 889 4.0E-73
sp|O76460|RAD54_DROME DNA repair and recombination protein RAD54-like OS=Drosophila melanogaster GN=okr PE=1 SV=1 420 921 5.0E-73
sp|F4J9M5|CHR12_ARATH Probable ATP-dependent DNA helicase CHR12 OS=Arabidopsis thaliana GN=CHR12 PE=2 SV=1 417 902 8.0E-73
sp|B3NAN8|RAD54_DROER DNA repair and recombination protein RAD54-like OS=Drosophila erecta GN=okr PE=3 SV=1 420 921 9.0E-73
sp|P32657|CHD1_YEAST Chromo domain-containing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHD1 PE=1 SV=1 420 889 2.0E-72
sp|B4NXB8|RAD54_DROYA DNA repair and recombination protein RAD54-like OS=Drosophila yakuba GN=okr PE=3 SV=2 420 921 2.0E-72
sp|Q7G8Y3|ISW2_ORYSJ Probable chromatin-remodeling complex ATPase chain OS=Oryza sativa subsp. japonica GN=Os01g0367900 PE=2 SV=2 407 889 2.0E-72
sp|P38086|RDH54_YEAST DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RDH54 PE=1 SV=4 437 920 4.0E-72
sp|C7GQI8|RDH54_YEAS2 DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain JAY291) GN=RDH54 PE=3 SV=1 437 920 4.0E-72
sp|B3LN76|RDH54_YEAS1 DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=RDH54 PE=3 SV=1 437 920 5.0E-72
sp|A6ZL17|RDH54_YEAS7 DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain YJM789) GN=RDH54 PE=3 SV=1 437 920 6.0E-72
sp|B3MMA5|RAD54_DROAN DNA repair and recombination protein RAD54-like OS=Drosophila ananassae GN=okr PE=3 SV=1 420 921 6.0E-72
sp|B5VE38|RDH54_YEAS6 DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=RDH54 PE=3 SV=1 437 920 6.0E-72
sp|F4KBP5|CHR4_ARATH Protein CHROMATIN REMODELING 4 OS=Arabidopsis thaliana GN=CHR4 PE=2 SV=1 416 899 8.0E-72
sp|Q5FWR0|SMRCD_XENTR SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Xenopus tropicalis GN=smarcad1 PE=2 SV=1 420 886 4.0E-71
sp|Q8TDI0|CHD5_HUMAN Chromodomain-helicase-DNA-binding protein 5 OS=Homo sapiens GN=CHD5 PE=1 SV=1 411 902 5.0E-71
sp|D3ZD32|CHD5_RAT Chromodomain-helicase-DNA-binding protein 5 OS=Rattus norvegicus GN=Chd5 PE=1 SV=1 411 902 6.0E-71
sp|G5EBZ4|LE418_CAEEL Protein let-418 OS=Caenorhabditis elegans GN=let-418 PE=1 SV=1 404 886 7.0E-71
sp|F4IHS2|SYD_ARATH Chromatin structure-remodeling complex protein SYD OS=Arabidopsis thaliana GN=SYD PE=1 SV=1 397 886 8.0E-71
sp|Q9US25|HRP1_SCHPO Chromodomain helicase hrp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hrp1 PE=1 SV=1 420 889 8.0E-71
sp|A2A8L1|CHD5_MOUSE Chromodomain-helicase-DNA-binding protein 5 OS=Mus musculus GN=Chd5 PE=1 SV=1 411 902 1.0E-70
sp|Q12873|CHD3_HUMAN Chromodomain-helicase-DNA-binding protein 3 OS=Homo sapiens GN=CHD3 PE=1 SV=3 416 902 2.0E-70
sp|Q7ZU90|CHD1L_DANRE Chromodomain-helicase-DNA-binding protein 1-like OS=Danio rerio GN=chd1l PE=2 SV=1 411 903 2.0E-70
sp|G5EDG2|SMRCD_CAEEL SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 homolog OS=Caenorhabditis elegans GN=M03C11.8 PE=3 SV=1 416 883 3.0E-70
sp|O16102|CHD3_DROME Chromodomain-helicase-DNA-binding protein 3 OS=Drosophila melanogaster GN=Chd3 PE=2 SV=3 406 978 3.0E-70
sp|Q9S775|PKL_ARATH CHD3-type chromatin-remodeling factor PICKLE OS=Arabidopsis thaliana GN=PKL PE=1 SV=1 409 886 1.0E-68
sp|A4PBL4|RAD54_ORYSJ DNA repair and recombination protein RAD54 OS=Oryza sativa subsp. japonica GN=RAD54 PE=1 SV=1 420 921 1.0E-68
sp|Q14839|CHD4_HUMAN Chromodomain-helicase-DNA-binding protein 4 OS=Homo sapiens GN=CHD4 PE=1 SV=2 411 902 3.0E-68
sp|Q6PDQ2|CHD4_MOUSE Chromodomain-helicase-DNA-binding protein 4 OS=Mus musculus GN=Chd4 PE=1 SV=1 411 902 4.0E-68
sp|E9PZM4|CHD2_MOUSE Chromodomain-helicase-DNA-binding protein 2 OS=Mus musculus GN=Chd2 PE=1 SV=1 417 902 4.0E-67
sp|P70270|RAD54_MOUSE DNA repair and recombination protein RAD54-like OS=Mus musculus GN=Rad54l PE=1 SV=2 363 928 1.0E-66
sp|E1B7X9|SMRCD_BOVIN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Bos taurus GN=SMARCAD1 PE=3 SV=2 416 886 2.0E-66
sp|Q92698|RAD54_HUMAN DNA repair and recombination protein RAD54-like OS=Homo sapiens GN=RAD54L PE=1 SV=2 420 942 2.0E-66
sp|O14647|CHD2_HUMAN Chromodomain-helicase-DNA-binding protein 2 OS=Homo sapiens GN=CHD2 PE=1 SV=2 417 902 2.0E-66
sp|F4JTF6|CHR7_ARATH CHD3-type chromatin-remodeling factor CHR7 OS=Arabidopsis thaliana GN=CHR7 PE=2 SV=1 383 886 4.0E-66
sp|O97159|CHDM_DROME Chromodomain-helicase-DNA-binding protein Mi-2 homolog OS=Drosophila melanogaster GN=Mi-2 PE=1 SV=2 393 902 4.0E-66
sp|Q9H4L7|SMRCD_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Homo sapiens GN=SMARCAD1 PE=1 SV=2 416 886 7.0E-66
sp|D3Z9Z9|SMRCD_RAT SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Rattus norvegicus GN=Smarcad1 PE=1 SV=1 416 886 9.0E-66
sp|Q86WJ1|CHD1L_HUMAN Chromodomain-helicase-DNA-binding protein 1-like OS=Homo sapiens GN=CHD1L PE=1 SV=2 413 902 1.0E-65
sp|Q7KU24|CHD1_DROME Chromodomain-helicase-DNA-binding protein 1 OS=Drosophila melanogaster GN=Chd1 PE=1 SV=1 416 902 1.0E-65
sp|Q3B7N1|CHD1L_BOVIN Chromodomain-helicase-DNA-binding protein 1-like OS=Bos taurus GN=CHD1L PE=2 SV=1 420 902 2.0E-65
sp|Q9ZUL5|CHR19_ARATH Protein CHROMATIN REMODELING 19 OS=Arabidopsis thaliana GN=ETL1 PE=1 SV=1 411 887 2.0E-65
sp|Q9CXF7|CHD1L_MOUSE Chromodomain-helicase-DNA-binding protein 1-like OS=Mus musculus GN=Chd1l PE=1 SV=1 417 902 4.0E-65
sp|P43610|IRC5_YEAST Uncharacterized ATP-dependent helicase IRC5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRC5 PE=1 SV=2 304 889 4.0E-65
sp|Q04692|SMRCD_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Mus musculus GN=Smarcad1 PE=1 SV=2 416 886 5.0E-65
sp|Q9P2D1|CHD7_HUMAN Chromodomain-helicase-DNA-binding protein 7 OS=Homo sapiens GN=CHD7 PE=1 SV=3 420 902 5.0E-65
sp|E7F1C4|SMRDB_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1B OS=Danio rerio GN=smarcad1b PE=3 SV=1 420 886 6.0E-65
sp|A2AJK6|CHD7_MOUSE Chromodomain-helicase-DNA-binding protein 7 OS=Mus musculus GN=Chd7 PE=1 SV=1 420 902 8.0E-65
sp|Q9VL72|SMRCD_DROME SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 homolog OS=Drosophila melanogaster GN=Etl1 PE=1 SV=1 420 886 1.0E-64
sp|O14139|HRP3_SCHPO Chromodomain helicase hrp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hrp3 PE=1 SV=1 417 889 1.0E-64
sp|B6ZLK2|CHD1_CHICK Chromodomain-helicase-DNA-binding protein 1 OS=Gallus gallus GN=CHD1 PE=1 SV=1 417 902 1.0E-64
sp|Q06A37|CHD7_CHICK Chromodomain-helicase-DNA-binding protein 7 OS=Gallus gallus GN=CHD7 PE=2 SV=1 420 902 2.0E-64
sp|F4IV99|CHR5_ARATH Protein CHROMATIN REMODELING 5 OS=Arabidopsis thaliana GN=CHR5 PE=3 SV=1 413 931 2.0E-64
sp|D3ZA12|CHD6_RAT Chromodomain-helicase-DNA-binding protein 6 OS=Rattus norvegicus GN=Chd6 PE=1 SV=2 420 909 2.0E-64
sp|P40201|CHD1_MOUSE Chromodomain-helicase-DNA-binding protein 1 OS=Mus musculus GN=Chd1 PE=1 SV=3 417 902 2.0E-64
sp|A3KFM7|CHD6_MOUSE Chromodomain-helicase-DNA-binding protein 6 OS=Mus musculus GN=Chd6 PE=1 SV=1 420 909 3.0E-64
sp|O14646|CHD1_HUMAN Chromodomain-helicase-DNA-binding protein 1 OS=Homo sapiens GN=CHD1 PE=1 SV=2 417 902 4.0E-64
sp|A9X4T1|CHD1_BOMMO Chromodomain-helicase-DNA-binding protein 1 OS=Bombyx mori GN=CHD1 PE=1 SV=1 417 902 1.0E-63
sp|F4IV45|CHR10_ARATH Probable helicase CHR10 OS=Arabidopsis thaliana GN=CHR10 PE=3 SV=1 420 944 1.0E-63
sp|Q8BYH8|CHD9_MOUSE Chromodomain-helicase-DNA-binding protein 9 OS=Mus musculus GN=Chd9 PE=1 SV=2 420 909 2.0E-63
sp|Q3L8U1|CHD9_HUMAN Chromodomain-helicase-DNA-binding protein 9 OS=Homo sapiens GN=CHD9 PE=1 SV=2 420 909 2.0E-63
sp|Q8TD26|CHD6_HUMAN Chromodomain-helicase-DNA-binding protein 6 OS=Homo sapiens GN=CHD6 PE=1 SV=4 420 903 4.0E-63
sp|Q0PCS3|CHR25_ARATH Protein CHROMATIN REMODELING 25 OS=Arabidopsis thaliana GN=CHR25 PE=1 SV=1 420 946 6.0E-63
sp|Q9HCK8|CHD8_HUMAN Chromodomain-helicase-DNA-binding protein 8 OS=Homo sapiens GN=CHD8 PE=1 SV=5 420 902 9.0E-63
sp|F4HW51|CHR20_ARATH Protein CHROMATIN REMODELING 20 OS=Arabidopsis thaliana GN=ATRX PE=2 SV=2 404 936 4.0E-62
sp|B5DE69|CHD8_XENTR Chromodomain-helicase-DNA-binding protein 8 OS=Xenopus tropicalis GN=chd8 PE=2 SV=2 420 910 6.0E-62
sp|B0R0I6|CHD8_DANRE Chromodomain-helicase-DNA-binding protein 8 OS=Danio rerio GN=chd8 PE=3 SV=2 420 902 8.0E-62
sp|Q09XV5|CHD8_MOUSE Chromodomain-helicase-DNA-binding protein 8 OS=Mus musculus GN=Chd8 PE=1 SV=1 420 902 9.0E-62
sp|Q9JIX5|CHD8_RAT Chromodomain-helicase-DNA-binding protein 8 OS=Rattus norvegicus GN=Chd8 PE=1 SV=2 420 902 1.0E-61
sp|P87114|FFT1_SCHPO ATP-dependent helicase fft1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fft1 PE=3 SV=1 416 886 3.0E-61
sp|Q09772|RDH54_SCHPO Meiotic recombination protein rdh54 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rdh54 PE=1 SV=3 417 927 1.0E-60
sp|B0R061|SMRDA_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1A OS=Danio rerio GN=smarcad1a PE=3 SV=1 417 884 8.0E-60
sp|O42861|FFT3_SCHPO ATP-dependent helicase fft3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fft3 PE=1 SV=1 410 886 2.0E-59
sp|Q9P793|MIT1_SCHPO Chromatin remodeling factor mit1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mit1 PE=1 SV=1 416 886 1.0E-57
sp|P94593|YWQA_BACSU Uncharacterized ATP-dependent helicase YwqA OS=Bacillus subtilis (strain 168) GN=ywqA PE=3 SV=2 413 922 4.0E-56
sp|P31380|FUN30_YEAST ATP-dependent helicase FUN30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FUN30 PE=1 SV=1 416 887 3.0E-55
sp|Q6EVK6|BRM_ARATH ATP-dependent helicase BRM OS=Arabidopsis thaliana GN=BRM PE=1 SV=1 416 890 4.0E-53
sp|P75093|Y020_MYCPN Uncharacterized ATP-dependent helicase MPN_020 OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_020 PE=3 SV=1 416 901 2.0E-51
sp|P47264|Y018_MYCGE Uncharacterized ATP-dependent helicase MG018 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG018 PE=3 SV=3 420 901 4.0E-51
sp|Q7X9V2|PIE1_ARATH Protein PHOTOPERIOD-INDEPENDENT EARLY FLOWERING 1 OS=Arabidopsis thaliana GN=PIE1 PE=1 SV=1 408 757 8.0E-49
sp|Q4IAK7|SWR1_GIBZE Helicase SWR1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SWR1 PE=3 SV=1 394 733 4.0E-48
sp|P41447|GTA_NPVAC Probable global transactivator OS=Autographa californica nuclear polyhedrosis virus GN=GTA PE=3 SV=1 389 903 4.0E-46
sp|Q7S133|SWR1_NEUCR Helicase swr-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=crf1-1 PE=3 SV=1 408 733 2.0E-45
sp|Q759G7|SWR1_ASHGO Helicase SWR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SWR1 PE=3 SV=2 409 747 5.0E-45
sp|Q4WAS9|SWR1_ASPFU Helicase swr1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=swr1 PE=3 SV=1 406 734 8.0E-45
sp|Q6FK48|SWR1_CANGA Helicase SWR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SWR1 PE=3 SV=1 375 734 1.0E-44
sp|Q6CJ38|SWR1_KLULA Helicase SWR1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SWR1 PE=3 SV=1 395 734 3.0E-44
sp|Q8RXS6|INO80_ARATH DNA helicase INO80 OS=Arabidopsis thaliana GN=INO80 PE=2 SV=2 415 781 6.0E-44
sp|O10302|GTA_NPVOP Probable global transactivator OS=Orgyia pseudotsugata multicapsid polyhedrosis virus GN=GTA PE=3 SV=1 415 920 1.0E-43
sp|Q5ARK3|SWR1_EMENI Helicase swr1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=swr1 PE=3 SV=2 406 766 2.0E-43
sp|Q05471|SWR1_YEAST Helicase SWR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWR1 PE=1 SV=1 409 734 2.0E-43
sp|Q6CA87|SWR1_YARLI Helicase SWR1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SWR1 PE=3 SV=1 410 734 3.0E-43
sp|Q59U81|SWR1_CANAL Helicase SWR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SWR1 PE=3 SV=1 409 763 6.0E-43
sp|Q6BKC2|SWR1_DEBHA Helicase SWR1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SWR1 PE=3 SV=2 409 734 7.0E-43
sp|F4I2H2|CHR9_ARATH Switch 2 OS=Arabidopsis thaliana GN=SWI2 PE=3 SV=1 407 712 2.0E-42
sp|Q4P328|SWR1_USTMA Helicase SWR1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SWR1 PE=3 SV=1 407 734 5.0E-42
sp|C0H4W3|HEPF1_PLAF7 Probable ATP-dependent helicase PF08_0048 OS=Plasmodium falciparum (isolate 3D7) GN=PF08_0048 PE=3 SV=1 405 733 1.0E-41
sp|Q6BGY8|INO80_DEBHA Putative DNA helicase INO80 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=INO80 PE=3 SV=2 404 760 1.0E-40
sp|Q9NEL2|SSL1_CAEEL Helicase ssl-1 OS=Caenorhabditis elegans GN=ssl-1 PE=2 SV=4 409 734 3.0E-40
sp|O13682|SWR1_SCHPO Helicase swr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swr1 PE=3 SV=1 407 732 4.0E-40
sp|Q6CNY4|INO80_KLULA Putative DNA helicase INO80 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=INO80 PE=3 SV=1 410 762 7.0E-40
sp|Q6FV37|INO80_CANGA Putative DNA helicase INO80 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=INO80 PE=3 SV=1 382 736 1.0E-39
sp|Q9ULG1|INO80_HUMAN DNA helicase INO80 OS=Homo sapiens GN=INO80 PE=1 SV=2 364 735 3.0E-39
sp|Q9NDJ2|DOM_DROME Helicase domino OS=Drosophila melanogaster GN=dom PE=1 SV=2 329 734 4.0E-39
sp|Q6ZPV2|INO80_MOUSE DNA helicase INO80 OS=Mus musculus GN=Ino80 PE=1 SV=2 364 735 1.0E-38
sp|Q2UTQ9|INO80_ASPOR Putative DNA helicase ino80 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ino80 PE=3 SV=1 410 747 1.0E-38
sp|Q872I5|INO80_NEUCR Putative DNA helicase ino80 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=crf2-1 PE=3 SV=3 404 747 2.0E-38
sp|A6ZU34|INO80_YEAS7 Putative DNA helicase INO80 OS=Saccharomyces cerevisiae (strain YJM789) GN=INO80 PE=3 SV=1 330 736 2.0E-38
sp|Q4PGL2|INO80_USTMA Putative DNA helicase INO80 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=INO80 PE=3 SV=1 407 794 3.0E-38
sp|Q5BAZ5|INO80_EMENI Putative DNA helicase ino80 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ino80 PE=3 SV=1 420 760 4.0E-38
sp|O14148|INO80_SCHPO Putative DNA helicase ino80 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ino80 PE=1 SV=4 336 739 4.0E-38
sp|P53115|INO80_YEAST Putative DNA helicase INO80 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=INO80 PE=1 SV=1 410 736 4.0E-38
sp|Q1DUF9|INO80_COCIM Putative DNA helicase INO80 OS=Coccidioides immitis (strain RS) GN=INO80 PE=3 SV=1 420 736 4.0E-38
sp|F4I2H2|CHR9_ARATH Switch 2 OS=Arabidopsis thaliana GN=SWI2 PE=3 SV=1 716 898 6.0E-38
sp|A1C9W6|INO80_ASPCL Putative DNA helicase ino80 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ino80 PE=3 SV=1 410 747 6.0E-38
sp|Q59KI4|INO80_CANAL Putative DNA helicase INO80 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=INO80 PE=3 SV=1 314 746 8.0E-38
sp|A2R9H9|INO80_ASPNC Putative DNA helicase ino80 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=ino80 PE=3 SV=1 410 736 8.0E-38
sp|A7EQA8|INO80_SCLS1 Putative DNA helicase INO80 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=INO80 PE=3 SV=1 404 736 1.0E-37
sp|A1CZE5|INO80_NEOFI Putative DNA helicase ino80 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ino80 PE=3 SV=1 420 747 2.0E-37
sp|Q0CA78|INO80_ASPTN Putative DNA helicase ino80 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ino80 PE=3 SV=1 411 736 2.0E-37
sp|P0CO18|SWR1_CRYNJ Helicase SWR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SWR1 PE=3 SV=1 411 734 2.0E-37
sp|P0CO19|SWR1_CRYNB Helicase SWR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SWR1 PE=3 SV=1 411 734 2.0E-37
sp|Q4WTV7|INO80_ASPFU Putative DNA helicase ino80 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ino80 PE=3 SV=1 420 747 2.0E-37
sp|Q0UG82|INO80_PHANO Putative DNA helicase INO80 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=INO80 PE=3 SV=2 410 736 3.0E-37
sp|Q6ZRS2|SRCAP_HUMAN Helicase SRCAP OS=Homo sapiens GN=SRCAP PE=1 SV=3 420 734 3.0E-37
sp|Q74Z27|INO80_ASHGO Putative DNA helicase INO80 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=INO80 PE=3 SV=2 410 736 3.0E-37
sp|A4R227|INO80_MAGO7 Putative DNA helicase INO80 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=INO80 PE=3 SV=1 404 736 4.0E-37
sp|A5E0W5|INO80_LODEL Putative DNA helicase ino80 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=INO80 PE=3 SV=1 404 739 7.0E-37
sp|A7TJI3|INO80_VANPO Putative DNA helicase INO80 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=INO80 PE=3 SV=1 371 736 7.0E-37
sp|Q4IL82|INO80_GIBZE Putative DNA helicase INO80 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=INO80 PE=3 SV=1 404 736 8.0E-37
sp|Q9NRZ9|HELLS_HUMAN Lymphoid-specific helicase OS=Homo sapiens GN=HELLS PE=1 SV=1 420 719 8.0E-37
sp|Q6CA87|SWR1_YARLI Helicase SWR1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SWR1 PE=3 SV=1 751 928 1.0E-36
sp|P0CO16|INO80_CRYNJ Putative DNA helicase INO80 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=INO80 PE=3 SV=1 420 785 2.0E-36
sp|P0CO17|INO80_CRYNB Putative DNA helicase INO80 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=INO80 PE=3 SV=1 420 785 2.0E-36
sp|Q9VDY1|INO80_DROME Putative DNA helicase Ino80 OS=Drosophila melanogaster GN=Ino80 PE=1 SV=2 393 791 2.0E-36
sp|Q60848|HELLS_MOUSE Lymphocyte-specific helicase OS=Mus musculus GN=Hells PE=1 SV=2 420 719 3.0E-36
sp|Q4IAK7|SWR1_GIBZE Helicase SWR1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SWR1 PE=3 SV=1 751 910 3.0E-34
sp|Q9NDJ2|DOM_DROME Helicase domino OS=Drosophila melanogaster GN=dom PE=1 SV=2 753 933 3.0E-34
sp|Q7X9V2|PIE1_ARATH Protein PHOTOPERIOD-INDEPENDENT EARLY FLOWERING 1 OS=Arabidopsis thaliana GN=PIE1 PE=1 SV=1 751 910 5.0E-34
sp|O13682|SWR1_SCHPO Helicase swr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swr1 PE=3 SV=1 625 902 8.0E-34
sp|Q7S133|SWR1_NEUCR Helicase swr-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=crf1-1 PE=3 SV=1 751 910 1.0E-33
sp|Q9NRZ9|HELLS_HUMAN Lymphoid-specific helicase OS=Homo sapiens GN=HELLS PE=1 SV=1 722 889 2.0E-33
sp|Q9NEL2|SSL1_CAEEL Helicase ssl-1 OS=Caenorhabditis elegans GN=ssl-1 PE=2 SV=4 707 889 3.0E-33
sp|Q6ZRS2|SRCAP_HUMAN Helicase SRCAP OS=Homo sapiens GN=SRCAP PE=1 SV=3 724 918 1.0E-32
sp|Q60848|HELLS_MOUSE Lymphocyte-specific helicase OS=Mus musculus GN=Hells PE=1 SV=2 722 889 1.0E-32
sp|Q6CJ38|SWR1_KLULA Helicase SWR1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SWR1 PE=3 SV=1 734 902 2.0E-32
sp|Q759G7|SWR1_ASHGO Helicase SWR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SWR1 PE=3 SV=2 734 902 4.0E-32
sp|O74842|FFT2_SCHPO ATP-dependent helicase fft2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fft2 PE=1 SV=1 397 700 5.0E-32
sp|Q4WAS9|SWR1_ASPFU Helicase swr1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=swr1 PE=3 SV=1 769 953 7.0E-32
sp|Q05471|SWR1_YEAST Helicase SWR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWR1 PE=1 SV=1 734 910 1.0E-31
sp|Q8RXS6|INO80_ARATH DNA helicase INO80 OS=Arabidopsis thaliana GN=INO80 PE=2 SV=2 744 889 2.0E-31
sp|Q6BKC2|SWR1_DEBHA Helicase SWR1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SWR1 PE=3 SV=2 734 910 4.0E-31
sp|Q6FK48|SWR1_CANGA Helicase SWR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SWR1 PE=3 SV=1 769 886 6.0E-31
sp|Q5ARK3|SWR1_EMENI Helicase swr1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=swr1 PE=3 SV=2 769 910 7.0E-31
sp|Q59U81|SWR1_CANAL Helicase SWR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SWR1 PE=3 SV=1 751 910 7.0E-31
sp|Q872I5|INO80_NEUCR Putative DNA helicase ino80 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=crf2-1 PE=3 SV=3 752 894 1.0E-30
sp|A4R227|INO80_MAGO7 Putative DNA helicase INO80 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=INO80 PE=3 SV=1 769 894 2.0E-30
sp|Q4P328|SWR1_USTMA Helicase SWR1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SWR1 PE=3 SV=1 759 902 5.0E-30
sp|C0H4W3|HEPF1_PLAF7 Probable ATP-dependent helicase PF08_0048 OS=Plasmodium falciparum (isolate 3D7) GN=PF08_0048 PE=3 SV=1 769 898 5.0E-30
sp|Q4PGL2|INO80_USTMA Putative DNA helicase INO80 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=INO80 PE=3 SV=1 759 886 5.0E-30
sp|A1C9W6|INO80_ASPCL Putative DNA helicase ino80 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ino80 PE=3 SV=1 667 894 5.0E-30
sp|Q4IL82|INO80_GIBZE Putative DNA helicase INO80 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=INO80 PE=3 SV=1 751 902 6.0E-30
sp|P0CO16|INO80_CRYNJ Putative DNA helicase INO80 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=INO80 PE=3 SV=1 751 886 6.0E-30
sp|P0CO17|INO80_CRYNB Putative DNA helicase INO80 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=INO80 PE=3 SV=1 751 886 6.0E-30
sp|Q9VDY1|INO80_DROME Putative DNA helicase Ino80 OS=Drosophila melanogaster GN=Ino80 PE=1 SV=2 768 889 7.0E-30
sp|Q6ZPV2|INO80_MOUSE DNA helicase INO80 OS=Mus musculus GN=Ino80 PE=1 SV=2 769 889 8.0E-30
sp|Q99NG0|ARIP4_MOUSE Helicase ARIP4 OS=Mus musculus GN=Rad54l2 PE=1 SV=1 743 934 8.0E-30
sp|Q9Y4B4|ARIP4_HUMAN Helicase ARIP4 OS=Homo sapiens GN=RAD54L2 PE=1 SV=4 743 934 9.0E-30
sp|A7EQA8|INO80_SCLS1 Putative DNA helicase INO80 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=INO80 PE=3 SV=1 769 901 1.0E-29
sp|Q9GQN5|ATRX_DROME Transcriptional regulator ATRX homolog OS=Drosophila melanogaster GN=XNP PE=1 SV=2 769 921 1.0E-29
sp|O14148|INO80_SCHPO Putative DNA helicase ino80 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ino80 PE=1 SV=4 751 889 2.0E-29
sp|P0CO18|SWR1_CRYNJ Helicase SWR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SWR1 PE=3 SV=1 743 903 2.0E-29
sp|P0CO19|SWR1_CRYNB Helicase SWR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SWR1 PE=3 SV=1 743 903 2.0E-29
sp|Q0UG82|INO80_PHANO Putative DNA helicase INO80 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=INO80 PE=3 SV=2 759 901 2.0E-29
sp|A4IHD2|ARIP4_XENTR Helicase ARIP4 OS=Xenopus tropicalis GN=rad54l2 PE=2 SV=1 743 948 2.0E-29
sp|Q9ULG1|INO80_HUMAN DNA helicase INO80 OS=Homo sapiens GN=INO80 PE=1 SV=2 769 889 3.0E-29
sp|Q1DUF9|INO80_COCIM Putative DNA helicase INO80 OS=Coccidioides immitis (strain RS) GN=INO80 PE=3 SV=1 769 894 3.0E-29
sp|Q59KI4|INO80_CANAL Putative DNA helicase INO80 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=INO80 PE=3 SV=1 769 889 3.0E-29
sp|Q0CA78|INO80_ASPTN Putative DNA helicase ino80 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ino80 PE=3 SV=1 728 894 4.0E-29
sp|Q4WTV7|INO80_ASPFU Putative DNA helicase ino80 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ino80 PE=3 SV=1 684 894 5.0E-29
sp|F4I8S3|CLSY3_ARATH SNF2 domain-containing protein CLASSY 3 OS=Arabidopsis thaliana GN=CLSY3 PE=1 SV=1 408 890 5.0E-29
sp|Q2UTQ9|INO80_ASPOR Putative DNA helicase ino80 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ino80 PE=3 SV=1 769 894 7.0E-29
sp|A2R9H9|INO80_ASPNC Putative DNA helicase ino80 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=ino80 PE=3 SV=1 769 894 8.0E-29
sp|Q6NZP1|ZRAB3_MOUSE DNA annealing helicase and endonuclease ZRANB3 OS=Mus musculus GN=Zranb3 PE=1 SV=1 409 887 9.0E-29
sp|A1CZE5|INO80_NEOFI Putative DNA helicase ino80 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ino80 PE=3 SV=1 769 894 1.0E-28
sp|Q6BGY8|INO80_DEBHA Putative DNA helicase INO80 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=INO80 PE=3 SV=2 768 889 2.0E-28
sp|A4IHD2|ARIP4_XENTR Helicase ARIP4 OS=Xenopus tropicalis GN=rad54l2 PE=2 SV=1 435 740 3.0E-28
sp|Q96L91|EP400_HUMAN E1A-binding protein p400 OS=Homo sapiens GN=EP400 PE=1 SV=4 410 734 3.0E-28
sp|Q9Y4B4|ARIP4_HUMAN Helicase ARIP4 OS=Homo sapiens GN=RAD54L2 PE=1 SV=4 435 744 4.0E-28
sp|A6ZU34|INO80_YEAS7 Putative DNA helicase INO80 OS=Saccharomyces cerevisiae (strain YJM789) GN=INO80 PE=3 SV=1 751 889 6.0E-28
sp|Q5BAZ5|INO80_EMENI Putative DNA helicase ino80 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ino80 PE=3 SV=1 769 894 6.0E-28
sp|P53115|INO80_YEAST Putative DNA helicase INO80 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=INO80 PE=1 SV=1 751 889 6.0E-28
sp|Q6FV37|INO80_CANGA Putative DNA helicase INO80 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=INO80 PE=3 SV=1 751 889 9.0E-28
sp|E1BB03|ZRAB3_BOVIN DNA annealing helicase and endonuclease ZRANB3 OS=Bos taurus GN=ZRANB3 PE=3 SV=3 409 887 1.0E-27
sp|Q8CHI8|EP400_MOUSE E1A-binding protein p400 OS=Mus musculus GN=Ep400 PE=1 SV=3 410 753 1.0E-27
sp|Q6CNY4|INO80_KLULA Putative DNA helicase INO80 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=INO80 PE=3 SV=1 751 889 2.0E-27
sp|Q7YQM3|ATRX_PONPY Transcriptional regulator ATRX OS=Pongo pygmaeus GN=ATRX PE=2 SV=1 769 921 3.0E-27
sp|P46100|ATRX_HUMAN Transcriptional regulator ATRX OS=Homo sapiens GN=ATRX PE=1 SV=5 769 921 3.0E-27
sp|Q7YQM4|ATRX_PANTR Transcriptional regulator ATRX OS=Pan troglodytes GN=ATRX PE=2 SV=1 769 921 3.0E-27
sp|Q61687|ATRX_MOUSE Transcriptional regulator ATRX OS=Mus musculus GN=Atrx PE=1 SV=3 769 921 4.0E-27
sp|B2ZFP3|SMAL1_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Danio rerio GN=smarcal1 PE=2 SV=1 416 887 5.0E-27
sp|Q99NG0|ARIP4_MOUSE Helicase ARIP4 OS=Mus musculus GN=Rad54l2 PE=1 SV=1 435 740 6.0E-27
sp|O74842|FFT2_SCHPO ATP-dependent helicase fft2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fft2 PE=1 SV=1 751 886 1.0E-26
sp|A5E0W5|INO80_LODEL Putative DNA helicase ino80 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=INO80 PE=3 SV=1 770 889 2.0E-26
sp|A7TJI3|INO80_VANPO Putative DNA helicase INO80 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=INO80 PE=3 SV=1 751 889 2.0E-26
sp|Q9LK10|CLSY4_ARATH SNF2 domain-containing protein CLASSY 4 OS=Arabidopsis thaliana GN=CLSY4 PE=1 SV=1 409 907 2.0E-26
sp|Q4DCH3|JBP2_TRYCC Bifunctional helicase and thymine dioxygenase JBP2 OS=Trypanosoma cruzi (strain CL Brener) GN=JBP2 PE=3 SV=1 407 879 2.0E-26
sp|Q5FWF4|ZRAB3_HUMAN DNA annealing helicase and endonuclease ZRANB3 OS=Homo sapiens GN=ZRANB3 PE=1 SV=2 399 887 2.0E-26
sp|Q9M297|CLSY1_ARATH SNF2 domain-containing protein CLASSY 1 OS=Arabidopsis thaliana GN=CLSY1 PE=1 SV=1 437 914 3.0E-26
sp|Q74Z27|INO80_ASHGO Putative DNA helicase INO80 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=INO80 PE=3 SV=2 751 889 5.0E-26
sp|Q8BJL0|SMAL1_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Mus musculus GN=Smarcal1 PE=1 SV=1 416 912 6.0E-26
sp|Q9VMX6|SMAL1_DROME SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Drosophila melanogaster GN=Marcal1 PE=1 SV=2 439 900 4.0E-25
sp|Q9SIW2|CHR35_ARATH Protein CHROMATIN REMODELING 35 OS=Arabidopsis thaliana GN=DRD1 PE=1 SV=1 295 910 5.0E-25
sp|F4K493|CLSY2_ARATH SNF2 domain-containing protein CLASSY 2 OS=Arabidopsis thaliana GN=CLSY2 PE=1 SV=1 437 903 1.0E-24
sp|B4F769|SMAL1_RAT SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Rattus norvegicus GN=Smarcal1 PE=2 SV=1 416 912 1.0E-24
sp|Q57X81|JBP2_TRYB2 Bifunctional helicase and thymine dioxygenase JBP2 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=JBP2 PE=1 SV=1 407 876 2.0E-24
sp|B6EU02|JBP2_LEITA Bifunctional helicase and thymine dioxygenase JBP2 OS=Leishmania tarentolae GN=JBP2 PE=1 SV=1 407 878 4.0E-24
sp|Q0P4U8|SMAL1_XENTR SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Xenopus tropicalis GN=smarcal1 PE=2 SV=1 416 933 6.0E-24
sp|Q8MNV7|SMAL1_CAEEL Putative SMARCAL1-like protein OS=Caenorhabditis elegans GN=C16A3.1 PE=3 SV=1 417 888 1.0E-23
sp|A4H7G5|JBP2_LEIBR Bifunctional helicase and thymine dioxygenase JBP2 OS=Leishmania braziliensis GN=JBP2 PE=3 SV=1 407 878 2.0E-23
sp|Q498E7|SMAL1_XENLA SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Xenopus laevis GN=smarcal1 PE=2 SV=1 408 933 2.0E-23
sp|Q9NZC9|SMAL1_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Homo sapiens GN=SMARCAL1 PE=1 SV=1 416 912 2.0E-23
sp|A4HVU6|JBP2_LEIIN Bifunctional helicase and thymine dioxygenase JBP2 OS=Leishmania infantum GN=JBP2 PE=3 SV=2 407 878 2.0E-23
sp|Q9FNI6|SM3L2_ARATH Putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 2 OS=Arabidopsis thaliana GN=At5g22750 PE=2 SV=1 768 920 2.0E-23
sp|Q4QFY1|JBP2_LEIMA Bifunctional helicase and thymine dioxygenase JBP2 OS=Leishmania major GN=JBP2 PE=3 SV=2 407 878 4.0E-23
sp|Q9U7E0|ATRX_CAEEL Transcriptional regulator ATRX homolog OS=Caenorhabditis elegans GN=xnp-1 PE=1 SV=1 750 922 9.0E-23
sp|Q10332|YBMA_SCHPO Uncharacterized ATP-dependent helicase C582.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC582.10c PE=1 SV=1 409 734 1.0E-22
sp|Q10332|YBMA_SCHPO Uncharacterized ATP-dependent helicase C582.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC582.10c PE=1 SV=1 771 920 3.0E-22
sp|Q7YQM3|ATRX_PONPY Transcriptional regulator ATRX OS=Pongo pygmaeus GN=ATRX PE=2 SV=1 420 701 5.0E-22
sp|P46100|ATRX_HUMAN Transcriptional regulator ATRX OS=Homo sapiens GN=ATRX PE=1 SV=5 420 701 5.0E-22
sp|Q7YQM4|ATRX_PANTR Transcriptional regulator ATRX OS=Pan troglodytes GN=ATRX PE=2 SV=1 420 701 5.0E-22
sp|Q61687|ATRX_MOUSE Transcriptional regulator ATRX OS=Mus musculus GN=Atrx PE=1 SV=3 420 701 8.0E-22
sp|O60177|YG42_SCHPO Uncharacterized ATP-dependent helicase C23E6.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC23E6.02 PE=3 SV=1 771 920 1.0E-21
sp|P34739|TTF2_DROME Transcription termination factor 2 OS=Drosophila melanogaster GN=lds PE=1 SV=2 735 919 3.0E-21
sp|Q9UNY4|TTF2_HUMAN Transcription termination factor 2 OS=Homo sapiens GN=TTF2 PE=1 SV=2 771 919 6.0E-21
sp|Q5NC05|TTF2_MOUSE Transcription termination factor 2 OS=Mus musculus GN=Ttf2 PE=1 SV=2 767 919 6.0E-21
sp|O13762|YF2C_SCHPO Uncharacterized ATP-dependent helicase C17A2.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17A2.12 PE=3 SV=1 733 890 2.0E-20
sp|Q9FIY7|SM3L3_ARATH Putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 3 OS=Arabidopsis thaliana GN=At5g43530 PE=3 SV=1 768 919 3.0E-20
sp|Q94BR5|CHR28_ARATH Helicase-like transcription factor CHR28 OS=Arabidopsis thaliana GN=CHR28 PE=1 SV=1 771 897 3.0E-20
sp|Q9LHE4|CHR27_ARATH Helicase-like transcription factor CHR27 OS=Arabidopsis thaliana GN=CHR27 PE=1 SV=1 771 897 5.0E-20
sp|Q9GQN5|ATRX_DROME Transcriptional regulator ATRX homolog OS=Drosophila melanogaster GN=XNP PE=1 SV=2 269 730 6.0E-20
sp|P0CQ66|RAD5_CRYNJ DNA repair protein RAD5 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RAD5 PE=3 SV=1 771 925 1.0E-19
sp|P0CQ67|RAD5_CRYNB DNA repair protein RAD5 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RAD5 PE=3 SV=1 771 925 1.0E-19
sp|P36607|RAD5_SCHPO DNA repair protein rad8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rad8 PE=1 SV=1 771 921 2.0E-19
sp|Q5NC05|TTF2_MOUSE Transcription termination factor 2 OS=Mus musculus GN=Ttf2 PE=1 SV=2 406 702 4.0E-19
sp|P79051|RHP16_SCHPO ATP-dependent helicase rhp16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp16 PE=3 SV=2 771 920 4.0E-19
sp|P36607|RAD5_SCHPO DNA repair protein rad8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rad8 PE=1 SV=1 437 733 7.0E-19
sp|O60177|YG42_SCHPO Uncharacterized ATP-dependent helicase C23E6.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC23E6.02 PE=3 SV=1 410 706 8.0E-19
sp|Q9TTA5|SMAL1_BOVIN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Bos taurus GN=SMARCAL1 PE=2 SV=2 416 887 8.0E-19
sp|O13762|YF2C_SCHPO Uncharacterized ATP-dependent helicase C17A2.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17A2.12 PE=3 SV=1 416 736 2.0E-18
sp|Q9FF61|SM3L1_ARATH Putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 1 OS=Arabidopsis thaliana GN=At5g05130 PE=2 SV=1 767 902 4.0E-18
sp|O55764|172L_IIV6 Putative helicase 172L OS=Invertebrate iridescent virus 6 GN=IIV6-172L PE=3 SV=1 416 886 5.0E-18
sp|Q9U7E0|ATRX_CAEEL Transcriptional regulator ATRX homolog OS=Caenorhabditis elegans GN=xnp-1 PE=1 SV=1 403 730 1.0E-17
sp|P54509|YQHH_BACSU Uncharacterized ATP-dependent helicase YqhH OS=Bacillus subtilis (strain 168) GN=yqhH PE=3 SV=1 438 933 2.0E-17
sp|P31244|RAD16_YEAST DNA repair protein RAD16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD16 PE=1 SV=1 771 890 4.0E-17
sp|Q8CHI8|EP400_MOUSE E1A-binding protein p400 OS=Mus musculus GN=Ep400 PE=1 SV=3 751 886 7.0E-17
sp|Q9UNY4|TTF2_HUMAN Transcription termination factor 2 OS=Homo sapiens GN=TTF2 PE=1 SV=2 406 702 1.0E-16
sp|Q4PGG5|RAD5_USTMA DNA repair protein RAD5 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=RAD5 PE=3 SV=1 771 902 1.0E-16
sp|Q96L91|EP400_HUMAN E1A-binding protein p400 OS=Homo sapiens GN=EP400 PE=1 SV=4 751 886 2.0E-16
sp|Q6CJM4|RAD5_KLULA DNA repair protein RAD5 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RAD5 PE=3 SV=1 437 736 2.0E-16
sp|Q753V5|RAD5_ASHGO DNA repair protein RAD5 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RAD5 PE=3 SV=2 407 733 2.0E-16
sp|Q4WVM1|RAD5_ASPFU DNA repair protein rad5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rad5 PE=3 SV=2 433 732 2.0E-16
sp|Q08562|ULS1_YEAST ATP-dependent helicase ULS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ULS1 PE=1 SV=1 744 904 3.0E-16
sp|Q4IJ84|RAD5_GIBZE DNA repair protein RAD5 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=RAD5 PE=3 SV=1 771 920 4.0E-16
sp|Q08562|ULS1_YEAST ATP-dependent helicase ULS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ULS1 PE=1 SV=1 399 615 5.0E-16
sp|P31244|RAD16_YEAST DNA repair protein RAD16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD16 PE=1 SV=1 402 746 1.0E-15
sp|Q7S1P9|RAD5_NEUCR DNA repair protein rad5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mus-41 PE=3 SV=3 771 920 1.0E-15
sp|Q4IJ84|RAD5_GIBZE DNA repair protein RAD5 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=RAD5 PE=3 SV=1 433 733 2.0E-15
sp|Q7S1P9|RAD5_NEUCR DNA repair protein rad5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mus-41 PE=3 SV=3 433 733 3.0E-15
sp|Q6C2R8|RAD5_YARLI DNA repair protein RAD5 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RAD5 PE=3 SV=1 437 733 3.0E-15
sp|Q5ACX1|RAD5_CANAL DNA repair protein RAD5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RAD5 PE=3 SV=1 437 733 5.0E-15
sp|Q6PCN7|HLTF_MOUSE Helicase-like transcription factor OS=Mus musculus GN=Hltf PE=1 SV=1 771 918 9.0E-15
sp|Q5ACX1|RAD5_CANAL DNA repair protein RAD5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RAD5 PE=3 SV=1 743 890 1.0E-14
sp|Q6C2R8|RAD5_YARLI DNA repair protein RAD5 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RAD5 PE=3 SV=1 760 890 2.0E-14
sp|Q6CJM4|RAD5_KLULA DNA repair protein RAD5 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RAD5 PE=3 SV=1 769 919 3.0E-14
sp|Q9FNI6|SM3L2_ARATH Putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 2 OS=Arabidopsis thaliana GN=At5g22750 PE=2 SV=1 437 733 6.0E-14
sp|Q6PCN7|HLTF_MOUSE Helicase-like transcription factor OS=Mus musculus GN=Hltf PE=1 SV=1 467 766 6.0E-14
sp|Q95216|HLTF_RABIT Helicase-like transcription factor OS=Oryctolagus cuniculus GN=HLTF PE=1 SV=1 771 918 6.0E-14
sp|Q753V5|RAD5_ASHGO DNA repair protein RAD5 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RAD5 PE=3 SV=2 771 890 1.0E-13
sp|Q14527|HLTF_HUMAN Helicase-like transcription factor OS=Homo sapiens GN=HLTF PE=1 SV=2 748 890 1.0E-13
sp|Q6BIP2|RAD5_DEBHA DNA repair protein RAD5 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RAD5 PE=3 SV=2 743 890 1.0E-13
sp|P79051|RHP16_SCHPO ATP-dependent helicase rhp16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp16 PE=3 SV=2 410 733 3.0E-13
sp|Q5BHD6|RAD5_EMENI DNA repair protein rad5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rad5 PE=3 SV=1 433 732 4.0E-13
sp|Q9FIY7|SM3L3_ARATH Putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 3 OS=Arabidopsis thaliana GN=At5g43530 PE=3 SV=1 437 733 5.0E-13
sp|Q6FY76|RAD5_CANGA DNA repair protein RAD5 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RAD5 PE=3 SV=1 769 890 1.0E-12
sp|Q95216|HLTF_RABIT Helicase-like transcription factor OS=Oryctolagus cuniculus GN=HLTF PE=1 SV=1 467 738 2.0E-12
sp|Q6BIP2|RAD5_DEBHA DNA repair protein RAD5 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RAD5 PE=3 SV=2 437 733 2.0E-12
sp|Q149N8|SHPRH_HUMAN E3 ubiquitin-protein ligase SHPRH OS=Homo sapiens GN=SHPRH PE=1 SV=2 769 920 2.0E-12
sp|Q7TPQ3|SHPRH_MOUSE E3 ubiquitin-protein ligase SHPRH OS=Mus musculus GN=Shprh PE=1 SV=1 769 886 3.0E-12
sp|P34739|TTF2_DROME Transcription termination factor 2 OS=Drosophila melanogaster GN=lds PE=1 SV=2 410 702 6.0E-12
sp|Q14527|HLTF_HUMAN Helicase-like transcription factor OS=Homo sapiens GN=HLTF PE=1 SV=2 467 738 7.0E-12
sp|Q5BHD6|RAD5_EMENI DNA repair protein rad5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rad5 PE=3 SV=1 748 890 1.0E-11
sp|Q9UTL9|YIV5_SCHPO Uncharacterized ATP-dependent helicase C144.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC144.05 PE=3 SV=1 771 894 7.0E-11
sp|Q6FY76|RAD5_CANGA DNA repair protein RAD5 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RAD5 PE=3 SV=1 411 733 2.0E-10
sp|P32849|RAD5_YEAST DNA repair protein RAD5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD5 PE=1 SV=1 769 890 2.0E-10
sp|P0CQ67|RAD5_CRYNB DNA repair protein RAD5 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RAD5 PE=3 SV=1 467 733 3.0E-10
sp|P0CQ66|RAD5_CRYNJ DNA repair protein RAD5 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RAD5 PE=3 SV=1 467 733 4.0E-10
sp|Q9FF61|SM3L1_ARATH Putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 1 OS=Arabidopsis thaliana GN=At5g05130 PE=2 SV=1 393 698 5.0E-10
sp|Q06554|IRC20_YEAST Uncharacterized ATP-dependent helicase IRC20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRC20 PE=1 SV=1 771 886 5.0E-09
sp|Q9LHE4|CHR27_ARATH Helicase-like transcription factor CHR27 OS=Arabidopsis thaliana GN=CHR27 PE=1 SV=1 466 698 2.0E-08
sp|Q94BR5|CHR28_ARATH Helicase-like transcription factor CHR28 OS=Arabidopsis thaliana GN=CHR28 PE=1 SV=1 466 735 4.0E-08
sp|Q4PGG5|RAD5_USTMA DNA repair protein RAD5 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=RAD5 PE=3 SV=1 457 736 4.0E-08
sp|Q9M658|MOM1_ARATH Helicase protein MOM1 OS=Arabidopsis thaliana GN=MOM1 PE=1 SV=1 720 894 4.0E-08
sp|Q9M1I1|FB304_ARATH F-box protein At3g54460 OS=Arabidopsis thaliana GN=At3g54460 PE=2 SV=1 771 886 2.0E-07
sp|Q9UTL9|YIV5_SCHPO Uncharacterized ATP-dependent helicase C144.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC144.05 PE=3 SV=1 437 603 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0005524 ATP binding Yes
GO:0140658 ATP-dependent chromatin remodeler activity Yes
GO:0003677 DNA binding Yes
GO:0017076 purine nucleotide binding No
GO:0140097 catalytic activity, acting on DNA No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0032553 ribonucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0043168 anion binding No
GO:0097159 organic cyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0140657 ATP-dependent activity No
GO:0003676 nucleic acid binding No
GO:0008094 ATP-dependent activity, acting on DNA No
GO:0030554 adenyl nucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4672
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1769
Ophiocordyceps australis map64 (Brazil) OphauB2|3711 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|01343
Ophiocordyceps camponoti-rufipedis Ophun1|2373
Ophiocordyceps kimflemingae Ophio5|7589
Ophiocordyceps subramaniannii Hirsu2|9843

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3711
MEEEGGRGGVGEGEEEEEQQQQQQQRTSGLNEEQQQQQQQSTSGLSEEQQQQQSMTGLSEEDALKNLTGSVRDQN
DLERDITLQANAALVEAEDKKDTNRIDKLDAARQRLQLQLDKEKKQLERVAGNPYQSRKVQKEIARLDEEVERVK
SDIADFQARITKRHQENPLESTDQAKSKRLAGESHRDYLIRTGKITPFAKIGGARPQDLQGSLADSLLDAEDEAA
ANEYQQETSGPTSHQSLRRPGFADEIETPKDGAPADTARVPATAAQAEFSLRPRKKRRVEQQRQRSPSADFEPEQ
TSAESDAGPLVWQQGTDEDLVREQRRKTKSKDKARQQEEVDLSSIDDGNEAFYKKRLEDWVTRRSRARRARRQAA
ESGAAVAESDGEEEEWFKPSPDYADHYIDHGLKLPGDIHPSLFGYQKTGVQWLAELYKQGVGGIVGDEMGLGKTV
QLIAFIAALHCSAKLKRPVIVVAPATLLRQWVSEFHRWWPPLRVAILHSSGSGMMNARAQDEDDVDTTHGPVAKK
SLAAARKIVKGVVEKGHVLVTTYTGLQTYADELLPVAWEYAVLDEGHKIRNPNAEMTVTCKELNTPNRIILSGTP
VQNNLTELWSLFDFIYPMRLGTLVNFRAQFEIPIRQGGYANASNLQVMTAEKCAEALKETIGDYLLQRLKVDVAA
DLPAKTEQVLFCKLTESQREAYETFLSSDEVSAILSRRRQSLYGIDILRKICNHPDLLDKSLARKAGYNFGHARL
SAKLQLTRDLVEKVMIPNGHKTLLFSQGKLMLNIIEKSMREQGISYLRMDGETPVDQRQPMIDRFNTDPSIHVFL
MTTRTGGLGTNLTGADRIIIFDPDWNPSTDLQARERAWRLGQNKPVKIYRLMTEGTIEEKIYHRQIFKQFMTNKV
LKDPKQRSSYDLSDLYDLFSYSRGDEAAHARSDVFKGAQVSPAAADLPDQEAASVQHIKTVAAVEAYPPGQDDAA
HDERRMLQGIFARSVKSAYDHEQIVGGGQTTPSKLAADVAVLRHEADEMGRLAAAHLSRAAEDARRVPIGTVTWT
GEVGEAGRPGRARRRARGPGSAAVLSNLAERQGLRGSGGAQTQTRDYGALIKAFVARHGGQVPSKMLVDHFNPLC
PGKKQSDEFKMALDRIAVLKRGGAAGRGMWSLKPGVN*
Coding >OphauB2|3711
ATGGAAGAGGAGGGCGGGAGAGGGGGGGTGGGTGAGGGCGAGGAGGAGGAGGAGCAGCAGCAGCAGCAGCAACAG
AGGACGAGTGGCCTGAATGAAGAGCAGCAACAGCAACAGCAACAGAGTACGAGTGGCCTGAGCGAAGAGCAGCAG
CAACAGCAAAGCATGACTGGGCTGAGCGAAGAGGATGCACTTAAGAACCTGACTGGCAGCGTCAGAGACCAAAAT
GACTTGGAGCGAGACATTACGCTACAGGCAAATGCGGCTCTGGTCGAGGCCGAGGACAAAAAGGACACGAACCGA
ATAGACAAGCTGGACGCGGCCCGCCAGCGGCTGCAGCTGCAGTTGGACAAGGAGAAGAAGCAGCTGGAGCGAGTA
GCTGGGAACCCATATCAGTCGCGCAAAGTGCAAAAAGAAATAGCCAGGCTCGACGAGGAAGTTGAGCGGGTCAAG
AGCGACATTGCGGATTTCCAGGCGCGCATCACCAAGCGGCACCAAGAGAATCCGCTCGAGAGCACCGACCAGGCC
AAGTCGAAGCGCCTTGCTGGCGAGAGCCATCGCGACTACCTGATTCGCACGGGCAAGATTACTCCGTTTGCCAAG
ATTGGCGGCGCCAGGCCCCAGGATCTTCAGGGCTCCTTGGCCGATAGTCTTCTCGATGCCGAAGATGAGGCTGCG
GCCAACGAGTATCAGCAAGAGACGTCGGGACCAACATCACATCAATCCCTGCGTCGGCCGGGGTTTGCCGACGAG
ATTGAAACGCCAAAGGATGGAGCACCCGCCGACACAGCTCGGGTTCCGGCTACGGCGGCCCAAGCCGAGTTTTCT
TTGCGGCCACGCAAGAAGCGCCGAGTAGAGCAGCAGCGACAACGGAGCCCTTCGGCCGACTTTGAGCCGGAGCAA
ACATCAGCCGAGTCAGACGCTGGCCCTTTGGTGTGGCAGCAGGGCACCGATGAGGACTTGGTGCGCGAGCAGCGA
CGCAAGACAAAGTCCAAGGACAAGGCTCGGCAGCAGGAAGAGGTGGACCTCAGCTCCATTGACGACGGCAACGAA
GCCTTTTACAAGAAGAGACTCGAGGACTGGGTGACGAGGAGAAGCCGTGCCAGACGGGCTCGCAGACAGGCGGCC
GAGTCTGGCGCAGCAGTAGCGGAGAGCGATGGCGAAGAAGAGGAGTGGTTCAAGCCGTCGCCCGACTATGCCGAC
CACTACATTGACCATGGCCTCAAGCTTCCCGGCGACATCCATCCCTCGCTCTTTGGATACCAAAAGACGGGAGTG
CAGTGGCTGGCGGAGCTGTACAAGCAGGGCGTGGGCGGCATCGTTGGAGACGAAATGGGCCTGGGGAAGACGGTG
CAGCTGATTGCCTTTATCGCCGCCCTCCACTGCAGTGCAAAGCTGAAGCGGCCCGTCATCGTGGTGGCTCCAGCA
ACGCTGCTGCGGCAATGGGTCAGCGAGTTCCACCGCTGGTGGCCTCCCCTCCGAGTGGCCATTCTTCACTCGTCG
GGCAGCGGCATGATGAATGCGCGGGCCCAAGACGAGGACGACGTTGACACGACGCACGGCCCCGTGGCCAAGAAG
TCGCTGGCTGCAGCGCGCAAGATTGTCAAGGGCGTGGTGGAAAAGGGGCATGTCCTGGTGACGACGTATACAGGC
CTGCAAACATATGCCGACGAGCTGCTGCCGGTGGCGTGGGAGTACGCCGTCTTGGACGAGGGCCACAAGATCCGC
AACCCAAATGCCGAAATGACGGTGACGTGCAAGGAGCTGAATACGCCCAACCGCATCATCCTGTCGGGCACGCCG
GTGCAGAACAATCTGACGGAGCTGTGGTCTCTCTTTGACTTTATCTACCCCATGCGCCTCGGCACCCTCGTCAAC
TTTCGCGCGCAGTTTGAGATTCCCATTCGGCAGGGCGGATACGCCAATGCGTCCAATCTGCAGGTCATGACGGCG
GAAAAGTGCGCCGAGGCCCTCAAAGAAACCATTGGCGACTACCTGCTGCAGCGGCTCAAGGTGGACGTGGCGGCC
GACTTGCCCGCCAAGACGGAGCAGGTGCTCTTTTGCAAGCTGACCGAGAGTCAGCGCGAGGCATACGAAACCTTT
CTCAGCTCGGACGAGGTGTCTGCCATTCTCAGCCGGCGGCGACAGTCTCTGTACGGCATCGACATTCTGCGCAAG
ATTTGCAACCATCCCGACCTGCTCGACAAGAGCCTGGCGCGCAAGGCGGGCTACAACTTTGGCCACGCCCGTCTC
TCAGCCAAGCTGCAGCTGACGCGCGACCTGGTGGAAAAAGTCATGATTCCAAACGGCCACAAGACGCTCCTCTTT
TCCCAGGGCAAGCTGATGCTCAACATTATTGAAAAGAGCATGCGCGAGCAGGGCATTTCCTACCTGCGCATGGAC
GGCGAGACGCCCGTCGACCAGCGCCAGCCCATGATTGACCGCTTCAACACGGATCCCTCCATTCACGTCTTCCTC
ATGACGACGCGCACCGGCGGCCTGGGCACCAATCTGACGGGCGCCGACCGCATCATCATTTTTGACCCCGACTGG
AATCCGTCGACGGACCTGCAGGCGCGGGAGCGCGCGTGGCGCCTGGGCCAGAACAAGCCCGTCAAGATTTACCGC
CTCATGACGGAGGGCACGATTGAGGAAAAGATTTACCACCGGCAAATCTTTAAGCAATTCATGACCAACAAGGTG
CTCAAGGACCCCAAGCAGCGCAGCTCGTACGACTTGTCCGATCTCTACGACTTGTTTAGCTACAGCCGCGGCGAC
GAGGCGGCCCACGCGCGCAGCGACGTCTTCAAGGGCGCCCAGGTCAGTCCCGCCGCCGCCGACCTGCCGGACCAG
GAAGCCGCGTCGGTGCAGCACATCAAGACGGTTGCCGCCGTTGAGGCGTATCCTCCGGGCCAAGACGACGCAGCG
CACGACGAGCGCCGCATGCTGCAGGGCATCTTTGCGCGCTCGGTAAAGAGCGCCTATGACCATGAGCAAATCGTT
GGCGGCGGCCAGACGACGCCCAGCAAGTTGGCAGCCGACGTGGCTGTCCTGCGCCACGAGGCAGACGAGATGGGC
AGGCTGGCGGCTGCGCATCTGAGCCGCGCGGCAGAGGATGCGCGCCGGGTGCCCATTGGTACGGTGACGTGGACG
GGCGAGGTGGGCGAGGCGGGGCGGCCGGGGCGGGCAAGACGCCGTGCAAGGGGGCCGGGGTCGGCAGCCGTCTTG
AGCAATTTGGCCGAGAGGCAGGGCTTGCGCGGGAGCGGGGGCGCGCAGACGCAGACAAGAGACTATGGGGCTCTC
ATCAAGGCCTTTGTGGCGCGCCATGGTGGGCAGGTGCCGAGTAAGATGCTCGTGGACCATTTTAATCCGCTGTGT
CCAGGGAAGAAGCAGAGCGACGAGTTTAAAATGGCCCTCGACAGGATTGCGGTGCTCAAGAGAGGGGGTGCTGCG
GGAAGGGGCATGTGGTCGCTCAAGCCGGGCGTCAATTAG
Transcript >OphauB2|3711
ATGGAAGAGGAGGGCGGGAGAGGGGGGGTGGGTGAGGGCGAGGAGGAGGAGGAGCAGCAGCAGCAGCAGCAACAG
AGGACGAGTGGCCTGAATGAAGAGCAGCAACAGCAACAGCAACAGAGTACGAGTGGCCTGAGCGAAGAGCAGCAG
CAACAGCAAAGCATGACTGGGCTGAGCGAAGAGGATGCACTTAAGAACCTGACTGGCAGCGTCAGAGACCAAAAT
GACTTGGAGCGAGACATTACGCTACAGGCAAATGCGGCTCTGGTCGAGGCCGAGGACAAAAAGGACACGAACCGA
ATAGACAAGCTGGACGCGGCCCGCCAGCGGCTGCAGCTGCAGTTGGACAAGGAGAAGAAGCAGCTGGAGCGAGTA
GCTGGGAACCCATATCAGTCGCGCAAAGTGCAAAAAGAAATAGCCAGGCTCGACGAGGAAGTTGAGCGGGTCAAG
AGCGACATTGCGGATTTCCAGGCGCGCATCACCAAGCGGCACCAAGAGAATCCGCTCGAGAGCACCGACCAGGCC
AAGTCGAAGCGCCTTGCTGGCGAGAGCCATCGCGACTACCTGATTCGCACGGGCAAGATTACTCCGTTTGCCAAG
ATTGGCGGCGCCAGGCCCCAGGATCTTCAGGGCTCCTTGGCCGATAGTCTTCTCGATGCCGAAGATGAGGCTGCG
GCCAACGAGTATCAGCAAGAGACGTCGGGACCAACATCACATCAATCCCTGCGTCGGCCGGGGTTTGCCGACGAG
ATTGAAACGCCAAAGGATGGAGCACCCGCCGACACAGCTCGGGTTCCGGCTACGGCGGCCCAAGCCGAGTTTTCT
TTGCGGCCACGCAAGAAGCGCCGAGTAGAGCAGCAGCGACAACGGAGCCCTTCGGCCGACTTTGAGCCGGAGCAA
ACATCAGCCGAGTCAGACGCTGGCCCTTTGGTGTGGCAGCAGGGCACCGATGAGGACTTGGTGCGCGAGCAGCGA
CGCAAGACAAAGTCCAAGGACAAGGCTCGGCAGCAGGAAGAGGTGGACCTCAGCTCCATTGACGACGGCAACGAA
GCCTTTTACAAGAAGAGACTCGAGGACTGGGTGACGAGGAGAAGCCGTGCCAGACGGGCTCGCAGACAGGCGGCC
GAGTCTGGCGCAGCAGTAGCGGAGAGCGATGGCGAAGAAGAGGAGTGGTTCAAGCCGTCGCCCGACTATGCCGAC
CACTACATTGACCATGGCCTCAAGCTTCCCGGCGACATCCATCCCTCGCTCTTTGGATACCAAAAGACGGGAGTG
CAGTGGCTGGCGGAGCTGTACAAGCAGGGCGTGGGCGGCATCGTTGGAGACGAAATGGGCCTGGGGAAGACGGTG
CAGCTGATTGCCTTTATCGCCGCCCTCCACTGCAGTGCAAAGCTGAAGCGGCCCGTCATCGTGGTGGCTCCAGCA
ACGCTGCTGCGGCAATGGGTCAGCGAGTTCCACCGCTGGTGGCCTCCCCTCCGAGTGGCCATTCTTCACTCGTCG
GGCAGCGGCATGATGAATGCGCGGGCCCAAGACGAGGACGACGTTGACACGACGCACGGCCCCGTGGCCAAGAAG
TCGCTGGCTGCAGCGCGCAAGATTGTCAAGGGCGTGGTGGAAAAGGGGCATGTCCTGGTGACGACGTATACAGGC
CTGCAAACATATGCCGACGAGCTGCTGCCGGTGGCGTGGGAGTACGCCGTCTTGGACGAGGGCCACAAGATCCGC
AACCCAAATGCCGAAATGACGGTGACGTGCAAGGAGCTGAATACGCCCAACCGCATCATCCTGTCGGGCACGCCG
GTGCAGAACAATCTGACGGAGCTGTGGTCTCTCTTTGACTTTATCTACCCCATGCGCCTCGGCACCCTCGTCAAC
TTTCGCGCGCAGTTTGAGATTCCCATTCGGCAGGGCGGATACGCCAATGCGTCCAATCTGCAGGTCATGACGGCG
GAAAAGTGCGCCGAGGCCCTCAAAGAAACCATTGGCGACTACCTGCTGCAGCGGCTCAAGGTGGACGTGGCGGCC
GACTTGCCCGCCAAGACGGAGCAGGTGCTCTTTTGCAAGCTGACCGAGAGTCAGCGCGAGGCATACGAAACCTTT
CTCAGCTCGGACGAGGTGTCTGCCATTCTCAGCCGGCGGCGACAGTCTCTGTACGGCATCGACATTCTGCGCAAG
ATTTGCAACCATCCCGACCTGCTCGACAAGAGCCTGGCGCGCAAGGCGGGCTACAACTTTGGCCACGCCCGTCTC
TCAGCCAAGCTGCAGCTGACGCGCGACCTGGTGGAAAAAGTCATGATTCCAAACGGCCACAAGACGCTCCTCTTT
TCCCAGGGCAAGCTGATGCTCAACATTATTGAAAAGAGCATGCGCGAGCAGGGCATTTCCTACCTGCGCATGGAC
GGCGAGACGCCCGTCGACCAGCGCCAGCCCATGATTGACCGCTTCAACACGGATCCCTCCATTCACGTCTTCCTC
ATGACGACGCGCACCGGCGGCCTGGGCACCAATCTGACGGGCGCCGACCGCATCATCATTTTTGACCCCGACTGG
AATCCGTCGACGGACCTGCAGGCGCGGGAGCGCGCGTGGCGCCTGGGCCAGAACAAGCCCGTCAAGATTTACCGC
CTCATGACGGAGGGCACGATTGAGGAAAAGATTTACCACCGGCAAATCTTTAAGCAATTCATGACCAACAAGGTG
CTCAAGGACCCCAAGCAGCGCAGCTCGTACGACTTGTCCGATCTCTACGACTTGTTTAGCTACAGCCGCGGCGAC
GAGGCGGCCCACGCGCGCAGCGACGTCTTCAAGGGCGCCCAGGTCAGTCCCGCCGCCGCCGACCTGCCGGACCAG
GAAGCCGCGTCGGTGCAGCACATCAAGACGGTTGCCGCCGTTGAGGCGTATCCTCCGGGCCAAGACGACGCAGCG
CACGACGAGCGCCGCATGCTGCAGGGCATCTTTGCGCGCTCGGTAAAGAGCGCCTATGACCATGAGCAAATCGTT
GGCGGCGGCCAGACGACGCCCAGCAAGTTGGCAGCCGACGTGGCTGTCCTGCGCCACGAGGCAGACGAGATGGGC
AGGCTGGCGGCTGCGCATCTGAGCCGCGCGGCAGAGGATGCGCGCCGGGTGCCCATTGGTACGGTGACGTGGACG
GGCGAGGTGGGCGAGGCGGGGCGGCCGGGGCGGGCAAGACGCCGTGCAAGGGGGCCGGGGTCGGCAGCCGTCTTG
AGCAATTTGGCCGAGAGGCAGGGCTTGCGCGGGAGCGGGGGCGCGCAGACGCAGACAAGAGACTATGGGGCTCTC
ATCAAGGCCTTTGTGGCGCGCCATGGTGGGCAGGTGCCGAGTAAGATGCTCGTGGACCATTTTAATCCGCTGTGT
CCAGGGAAGAAGCAGAGCGACGAGTTTAAAATGGCCCTCGACAGGATTGCGGTGCTCAAGAGAGGGGGTGCTGCG
GGAAGGGGCATGTGGTCGCTCAAGCCGGGCGTCAATTAG
Gene >OphauB2|3711
ATGGAAGAGGAGGGCGGGAGAGGGGGGGTGGGTGAGGGCGAGGAGGAGGAGGAGCAGCAGCAGCAGCAGCAACAG
AGGACGAGTGGCCTGAATGAAGAGCAGCAACAGCAACAGCAACAGAGTACGAGTGGCCTGAGCGAAGAGCAGCAG
CAACAGCAAAGCATGACTGGGCTGAGCGAAGAGGATGCACTTAAGAACCTGACTGGCAGCGTCAGAGACCAAAAT
GACTTGGAGCGAGACATTACGCTACAGGCAAATGCGGCTCTGGTCGAGGCCGAGGACAAAAAGGACACGAACCGA
ATAGACAAGCTGGACGCGGCCCGCCAGCGGCTGCAGCTGCAGTTGGACAAGGAGAAGAAGCAGCTGGAGCGAGTA
GCTGGGAACCCATATCAGTCGCGCAAAGTGCAAAAAGAAATAGCCAGGCTCGACGAGGAAGTTGAGCGGGTCAAG
AGCGACATTGCGGATTTCCAGGCGCGCATCACCAAGCGGCACCAAGAGAATCCGCTCGAGAGCACCGACCAGGCC
AAGTCGAAGCGCCTTGCTGGCGAGAGCCATCGCGACTACCTGATTCGCACGGGCAAGATTACTCCGTTTGCCAAG
ATTGGCGGCGCCAGGCCCCAGGATCTTCAGGGCTCCTTGGCCGATAGTCTTCTCGATGCCGAAGATGAGGCTGCG
GCCAACGAGTATCAGCAAGAGACGTCGGGACCAACATCACATCAATCCCTGCGTCGGCCGGGGTTTGCCGACGAG
ATTGAAACGCCAAAGGATGGAGCACCCGCCGACACAGCTCGGGTTCCGGCTACGGCGGCCCAAGCCGAGTTTTCT
TTGCGGCCACGCAAGAAGCGCCGAGTAGAGCAGCAGCGACAACGGAGCCCTTCGGCCGACTTTGAGCCGGAGCAA
ACATCAGCCGAGTCAGACGCTGGCCCTTTGGTGTGGCAGCAGGGCACCGATGAGGACTTGGTGCGCGAGCAGCGA
CGCAAGACAAAGTCCAAGGACAAGGCTCGGCAGCAGGAAGAGGTGGACCTCAGCTCCATTGACGACGGCAACGAA
GCCTTTTACAAGAAGAGACTCGAGGACTGGGTGACGAGGAGAAGCCGTGCCAGACGGGCTCGCAGACAGGCGGCC
GAGTCTGGCGCAGCAGTAGCGGAGAGCGATGGCGAAGAAGAGGAGTGGTTCAAGCCGTCGCCCGACTATGCCGAC
CACTACATTGACCATGGCCTCAAGCTTCCCGGCGACATCCATCCCTCGCTCTTTGGATACCAAAAGACGGGAGTG
CAGTGGCTGGCGGAGCTGTACAAGCAGGGCGTGGGCGGCATCGTTGGAGACGAAATGGGCCTGGGGAAGACGGTG
CAGCTGATTGCCTTTATCGCCGCCCTCCACTGCAGTGCAAAGCTGAAGCGGCCCGTCATCGTGGTGGCTCCAGCA
ACGCTGCTGCGGCAATGGGTCAGCGAGTTCCACCGCTGGTGGCCTCCCCTCCGAGTGGCCATTCTTCACTCGTCG
GGCAGCGGCATGATGAATGCGCGGGCCCAAGACGAGGACGACGTTGACACGACGCACGGCCCCGTGGCCAAGAAG
TCGCTGGCTGCAGCGCGCAAGATTGTCAAGGGCGTGGTGGAAAAGGGGCATGTCCTGGTGACGACGTATACAGGC
CTGCAAACATATGCCGACGAGCTGCTGCCGGTGGCGTGGGAGTACGCCGTCTTGGACGAGGGCCACAAGATCCGC
AACCCAAATGCCGAAATGACGGTGACGTGCAAGGAGCTGAATACGCCCAACCGCATCATCCTGTCGGGCACGCCG
GTGCAGAACAATCTGACGGAGCTGTGGTCTCTCTTTGACTTTATCTACCCCATGCGCCTCGGCACCCTCGTCAAC
TTTCGCGCGCAGTTTGAGATTCCCATTCGGCAGGGCGGATACGCCAATGCGTCCAATCTGCAGGTCATGACGGCG
GAAAAGTGCGCCGAGGCCCTCAAAGAAACCATTGGCGACTACCTGCTGCAGCGGCTCAAGGTGGACGTGGCGGCC
GACTTGCCCGCCAAGACGGAGCAGGTGCTCTTTTGCAAGCTGACCGAGAGTCAGCGCGAGGCATACGAAACCTTT
CTCAGCTCGGACGAGGTGTCTGCCATTCTCAGCCGGCGGCGACAGTCTCTGTACGGCATCGACATTCTGCGCAAG
ATTTGCAACCATCCCGACCTGCTCGACAAGAGCCTGGCGCGCAAGGCGGGCTACAACTTTGGCCACGCCCGTCTC
TCAGCCAAGCTGCAGCTGACGCGCGACCTGGTGGAAAAAGTCATGATTCCAAACGGCCACAAGACGCTCCTCTTT
TCCCAGGGCAAGCTGATGCTCAACATTATTGAAAAGAGCATGCGCGAGCAGGGCATTTCCTACCTGCGCATGGAC
GGCGAGACGCCCGTCGACCAGCGCCAGCCCATGATTGACCGCTTCAACACGGATCCCTCCATTCACGTCTTCCTC
ATGACGACGCGCACCGGCGGCCTGGGCACCAATCTGACGGGCGCCGACCGCATCATCATTTTTGACCCCGACTGG
AATCCGTCGACGGACCTGCAGGCGCGGGAGCGCGCGTGGCGCCTGGGCCAGAACAAGCCCGTCAAGATTTACCGC
CTCATGACGGAGGGCACGATTGAGGAAAAGATTTACCACCGGCAAATCTTTAAGCAATTCATGACCAACAAGGTG
CTCAAGGACCCCAAGCAGCGCAGCTCGTACGACTTGTCCGATCTCTACGACTTGTTTAGCTACAGCCGCGGCGAC
GAGGCGGCCCACGCGCGCAGCGACGTCTTCAAGGGCGCCCAGGTCAGTCCCGCCGCCGCCGACCTGCCGGACCAG
GAAGCCGCGTCGGTGCAGCACATCAAGACGGTTGCCGCCGTTGAGGCGTATCCTCCGGGCCAAGACGACGCAGCG
CACGACGAGCGCCGCATGCTGCAGGGCATCTTTGCGCGCTCGGTAAAGAGCGCCTATGACCATGAGCAAATCGTT
GGCGGCGGCCAGACGACGCCCAGCAAGTTGGCAGCCGACGTGGCTGTCCTGCGCCACGAGGCAGACGAGATGGGC
AGGCTGGCGGCTGCGCATCTGAGCCGCGCGGCAGAGGATGCGCGCCGGGTGCCCATTGGTACGGTGACGTGGACG
GGCGAGGTGGGCGAGGCGGGGCGGCCGGGGCGGGCAAGACGCCGTGCAAGGGGGCCGGGGTCGGCAGCCGTCTTG
AGCAATTTGGCCGAGAGGCAGGGCTTGCGCGGGAGCGGGGGCGCGCAGACGCAGACAAGAGACTATGGGGCTCTC
ATCAAGGCCTTTGTGGCGCGCCATGGTGGGCAGGTGCCGAGTAAGATGCTCGTGGACCATTTTAATCCGCTGTGT
CCAGGGAAGAAGCAGAGCGACGAGTTTAAAATGGCCCTCGACAGGATTGCGGTGCTCAAGAGAGGGGGTGCTGCG
GGAAGGGGCATGTGGTCGCTCAAGCCGGGCGTCAATTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail