Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3707
Gene name
LocationContig_237:8375..11114
Strand-
Gene length (bp)2739
Transcript length (bp)2607
Coding sequence length (bp)2607
Protein length (aa) 869

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05470 eIF-3c_N Eukaryotic translation initiation factor 3 subunit 8 N-terminus 1.7E-172 68 636
PF01399 PCI PCI domain 1.2E-11 651 780

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14164|EIF3C_SCHPO Eukaryotic translation initiation factor 3 subunit C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nip1 PE=1 SV=2 66 837 0.0E+00
sp|Q7SBD4|EIF3C_NEUCR Eukaryotic translation initiation factor 3 subunit C OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nip-1 PE=3 SV=1 58 868 0.0E+00
sp|P0CN47|EIF3C_CRYNB Eukaryotic translation initiation factor 3 subunit C OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=NIP1 PE=3 SV=1 64 810 0.0E+00
sp|P0CN46|EIF3C_CRYNJ Eukaryotic translation initiation factor 3 subunit C OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=NIP1 PE=3 SV=1 64 810 0.0E+00
sp|Q4P0P0|EIF3C_USTMA Eukaryotic translation initiation factor 3 subunit C OS=Ustilago maydis (strain 521 / FGSC 9021) GN=NIP1 PE=3 SV=1 59 812 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14164|EIF3C_SCHPO Eukaryotic translation initiation factor 3 subunit C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nip1 PE=1 SV=2 66 837 0.0E+00
sp|Q7SBD4|EIF3C_NEUCR Eukaryotic translation initiation factor 3 subunit C OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nip-1 PE=3 SV=1 58 868 0.0E+00
sp|P0CN47|EIF3C_CRYNB Eukaryotic translation initiation factor 3 subunit C OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=NIP1 PE=3 SV=1 64 810 0.0E+00
sp|P0CN46|EIF3C_CRYNJ Eukaryotic translation initiation factor 3 subunit C OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=NIP1 PE=3 SV=1 64 810 0.0E+00
sp|Q4P0P0|EIF3C_USTMA Eukaryotic translation initiation factor 3 subunit C OS=Ustilago maydis (strain 521 / FGSC 9021) GN=NIP1 PE=3 SV=1 59 812 0.0E+00
sp|Q6C855|EIF3C_YARLI Eukaryotic translation initiation factor 3 subunit C OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=NIP1 PE=3 SV=1 1 807 0.0E+00
sp|Q5AX75|EIF3C_EMENI Eukaryotic translation initiation factor 3 subunit C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nip1 PE=3 SV=1 59 868 0.0E+00
sp|Q1DP77|EIF3C_COCIM Eukaryotic translation initiation factor 3 subunit C OS=Coccidioides immitis (strain RS) GN=NIP1 PE=3 SV=1 63 868 0.0E+00
sp|Q2U0Q9|EIF3C_ASPOR Eukaryotic translation initiation factor 3 subunit C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=nip1 PE=3 SV=1 63 822 0.0E+00
sp|A1C987|EIF3C_ASPCL Eukaryotic translation initiation factor 3 subunit C OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nip1 PE=3 SV=1 54 868 0.0E+00
sp|A1D9P1|EIF3C_NEOFI Eukaryotic translation initiation factor 3 subunit C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=nip1 PE=3 SV=1 63 822 0.0E+00
sp|A4QSX4|EIF3C_MAGO7 Eukaryotic translation initiation factor 3 subunit C OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=NIP1 PE=3 SV=1 81 868 0.0E+00
sp|Q2H731|EIF3C_CHAGB Eukaryotic translation initiation factor 3 subunit C OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=NIP1 PE=3 SV=1 58 868 0.0E+00
sp|A7E471|EIF3C_SCLS1 Eukaryotic translation initiation factor 3 subunit C OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=nip1 PE=3 SV=1 1 866 0.0E+00
sp|A6S043|EIF3C_BOTFB Eukaryotic translation initiation factor 3 subunit C OS=Botryotinia fuckeliana (strain B05.10) GN=nip1 PE=3 SV=1 58 866 0.0E+00
sp|Q0V1H5|EIF3C_PHANO Eukaryotic translation initiation factor 3 subunit C OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=NIP1 PE=3 SV=1 1 868 0.0E+00
sp|Q4W9S8|EIF3C_ASPFU Eukaryotic translation initiation factor 3 subunit C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nip1 PE=3 SV=1 63 822 0.0E+00
sp|B0YEH1|EIF3C_ASPFC Eukaryotic translation initiation factor 3 subunit C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=nip1 PE=3 SV=1 63 822 0.0E+00
sp|Q0CVT0|EIF3C_ASPTN Eukaryotic translation initiation factor 3 subunit C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=nip1 PE=3 SV=1 63 822 0.0E+00
sp|Q6BJF7|EIF3C_DEBHA Eukaryotic translation initiation factor 3 subunit C OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=NIP1 PE=3 SV=1 83 823 3.0E-171
sp|O49160|EIF3C_ARATH Eukaryotic translation initiation factor 3 subunit C OS=Arabidopsis thaliana GN=TIF3C1 PE=1 SV=2 45 815 1.0E-165
sp|A3GGB4|EIF3C_PICST Eukaryotic translation initiation factor 3 subunit C OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=NIP1 PE=3 SV=2 59 808 4.0E-163
sp|Q9XHM1|EIF3C_MEDTR Eukaryotic translation initiation factor 3 subunit C OS=Medicago truncatula GN=TIF3C1 PE=2 SV=1 2 815 1.0E-161
sp|A5DPQ5|EIF3C_PICGU Eukaryotic translation initiation factor 3 subunit C OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=NIP1 PE=3 SV=2 59 808 4.0E-157
sp|Q5AML1|EIF3C_CANAL Eukaryotic translation initiation factor 3 subunit C OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NIP1 PE=3 SV=1 1 808 6.0E-157
sp|A5E3Q2|EIF3C_LODEL Eukaryotic translation initiation factor 3 subunit C OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=NIP1 PE=3 SV=1 81 808 3.0E-147
sp|Q751S5|EIF3C_ASHGO Eukaryotic translation initiation factor 3 subunit C OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=NIP1 PE=3 SV=1 1 795 3.0E-139
sp|Q3SYW6|EIF3C_BOVIN Eukaryotic translation initiation factor 3 subunit C OS=Bos taurus GN=EIF3C PE=2 SV=1 252 852 4.0E-139
sp|Q6PFQ2|EIF3C_DANRE Eukaryotic translation initiation factor 3 subunit C OS=Danio rerio GN=eif3c PE=1 SV=1 256 852 1.0E-138
sp|Q5RAT8|EIF3C_PONAB Eukaryotic translation initiation factor 3 subunit C OS=Pongo abelii GN=EIF3C PE=2 SV=1 252 852 9.0E-138
sp|Q99613|EIF3C_HUMAN Eukaryotic translation initiation factor 3 subunit C OS=Homo sapiens GN=EIF3C PE=1 SV=1 252 852 1.0E-137
sp|B5ME19|EIFCL_HUMAN Eukaryotic translation initiation factor 3 subunit C-like protein OS=Homo sapiens GN=EIF3CL PE=3 SV=1 252 852 1.0E-137
sp|B5DFC8|EIF3C_RAT Eukaryotic translation initiation factor 3 subunit C OS=Rattus norvegicus GN=Eif3c PE=1 SV=1 252 852 2.0E-137
sp|Q8R1B4|EIF3C_MOUSE Eukaryotic translation initiation factor 3 subunit C OS=Mus musculus GN=Eif3c PE=1 SV=1 252 852 3.0E-137
sp|Q7PMU8|EIF3C_ANOGA Eukaryotic translation initiation factor 3 subunit C OS=Anopheles gambiae GN=eIF3-S8 PE=3 SV=3 256 827 3.0E-136
sp|Q17Q06|EIF3C_AEDAE Eukaryotic translation initiation factor 3 subunit C OS=Aedes aegypti GN=eIF3-S8 PE=3 SV=1 235 827 5.0E-136
sp|O02328|EIF3C_CAEEL Eukaryotic translation initiation factor 3 subunit C OS=Caenorhabditis elegans GN=eif-3.C PE=3 SV=2 231 856 7.0E-135
sp|Q6CLH3|EIF3C_KLULA Eukaryotic translation initiation factor 3 subunit C OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=NIP1 PE=3 SV=1 59 794 2.0E-134
sp|A7TML4|EIF3C_VANPO Eukaryotic translation initiation factor 3 subunit C OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=NIP1 PE=3 SV=1 63 795 2.0E-132
sp|P32497|EIF3C_YEAST Eukaryotic translation initiation factor 3 subunit C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NIP1 PE=1 SV=2 57 795 6.0E-131
sp|A6ZN26|EIF3C_YEAS7 Eukaryotic translation initiation factor 3 subunit C OS=Saccharomyces cerevisiae (strain YJM789) GN=NIP1 PE=3 SV=1 57 795 8.0E-131
sp|A8WWU0|EIF3C_CAEBR Eukaryotic translation initiation factor 3 subunit C OS=Caenorhabditis briggsae GN=eif-3.C PE=3 SV=1 228 856 1.0E-128
sp|B4MRZ8|EIF3C_DROWI Eukaryotic translation initiation factor 3 subunit C OS=Drosophila willistoni GN=eIF3-S8 PE=3 SV=1 231 833 1.0E-128
sp|Q6FIJ6|EIF3C_CANGA Eukaryotic translation initiation factor 3 subunit C OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=NIP1 PE=3 SV=1 61 795 2.0E-128
sp|B3MIF1|EIF3C_DROAN Eukaryotic translation initiation factor 3 subunit C OS=Drosophila ananassae GN=eIF3-S8 PE=3 SV=1 256 860 5.0E-128
sp|B4P562|EIF3C_DROYA Eukaryotic translation initiation factor 3 subunit C OS=Drosophila yakuba GN=eIF3-S8 PE=3 SV=1 256 833 9.0E-128
sp|B4KN00|EIF3C_DROMO Eukaryotic translation initiation factor 3 subunit C OS=Drosophila mojavensis GN=eIF3-S8 PE=3 SV=1 256 829 2.0E-127
sp|Q0ZB76|EIF3C_BOMMO Eukaryotic translation initiation factor 3 subunit C OS=Bombyx mori GN=eIF3-S8 PE=2 SV=1 234 840 3.0E-127
sp|B3NML0|EIF3C_DROER Eukaryotic translation initiation factor 3 subunit C OS=Drosophila erecta GN=eIF3-S8 PE=3 SV=1 224 833 4.0E-127
sp|A1ZAX1|EIF3C_DROME Eukaryotic translation initiation factor 3 subunit C OS=Drosophila melanogaster GN=eIF3-S8 PE=1 SV=1 256 833 2.0E-126
sp|B4HMY3|EIF3C_DROSE Eukaryotic translation initiation factor 3 subunit C OS=Drosophila sechellia GN=eIF3-S8 PE=3 SV=1 256 833 2.0E-126
sp|B4LNA1|EIF3C_DROVI Eukaryotic translation initiation factor 3 subunit C OS=Drosophila virilis GN=eIF3-S8 PE=3 SV=1 256 829 1.0E-125
sp|B4J789|EIF3C_DROGR Eukaryotic translation initiation factor 3 subunit C OS=Drosophila grimshawi GN=eIF3-S8 PE=3 SV=1 232 850 2.0E-125
sp|B4GIB1|EIF3C_DROPE Eukaryotic translation initiation factor 3 subunit C OS=Drosophila persimilis GN=eIF3-S8 PE=3 SV=1 224 833 3.0E-125
sp|Q28Z41|EIF3C_DROPS Eukaryotic translation initiation factor 3 subunit C OS=Drosophila pseudoobscura pseudoobscura GN=eIF3-S8 PE=3 SV=1 224 833 5.0E-125
sp|Q54X97|EIF3C_DICDI Eukaryotic translation initiation factor 3 subunit C OS=Dictyostelium discoideum GN=eif3C PE=3 SV=1 238 817 2.0E-94
sp|B4KN00|EIF3C_DROMO Eukaryotic translation initiation factor 3 subunit C OS=Drosophila mojavensis GN=eIF3-S8 PE=3 SV=1 64 215 2.0E-10
sp|Q8R1B4|EIF3C_MOUSE Eukaryotic translation initiation factor 3 subunit C OS=Mus musculus GN=Eif3c PE=1 SV=1 75 213 3.0E-09
sp|Q5RAT8|EIF3C_PONAB Eukaryotic translation initiation factor 3 subunit C OS=Pongo abelii GN=EIF3C PE=2 SV=1 75 213 3.0E-09
sp|Q99613|EIF3C_HUMAN Eukaryotic translation initiation factor 3 subunit C OS=Homo sapiens GN=EIF3C PE=1 SV=1 75 213 3.0E-09
sp|B5ME19|EIFCL_HUMAN Eukaryotic translation initiation factor 3 subunit C-like protein OS=Homo sapiens GN=EIF3CL PE=3 SV=1 75 213 3.0E-09
sp|B4LNA1|EIF3C_DROVI Eukaryotic translation initiation factor 3 subunit C OS=Drosophila virilis GN=eIF3-S8 PE=3 SV=1 64 212 1.0E-08
sp|Q6P1V4|EIF3C_XENTR Eukaryotic translation initiation factor 3 subunit C OS=Xenopus tropicalis GN=eif3c PE=2 SV=1 77 210 1.0E-08
sp|Q3SYW6|EIF3C_BOVIN Eukaryotic translation initiation factor 3 subunit C OS=Bos taurus GN=EIF3C PE=2 SV=1 75 210 2.0E-08
sp|A1ZAX1|EIF3C_DROME Eukaryotic translation initiation factor 3 subunit C OS=Drosophila melanogaster GN=eIF3-S8 PE=1 SV=1 64 209 3.0E-08
sp|B5DFC8|EIF3C_RAT Eukaryotic translation initiation factor 3 subunit C OS=Rattus norvegicus GN=Eif3c PE=1 SV=1 75 210 3.0E-08
sp|B4HMY3|EIF3C_DROSE Eukaryotic translation initiation factor 3 subunit C OS=Drosophila sechellia GN=eIF3-S8 PE=3 SV=1 64 209 3.0E-08
sp|B3NML0|EIF3C_DROER Eukaryotic translation initiation factor 3 subunit C OS=Drosophila erecta GN=eIF3-S8 PE=3 SV=1 64 209 3.0E-08
sp|B4P562|EIF3C_DROYA Eukaryotic translation initiation factor 3 subunit C OS=Drosophila yakuba GN=eIF3-S8 PE=3 SV=1 64 209 3.0E-08
sp|B4GIB1|EIF3C_DROPE Eukaryotic translation initiation factor 3 subunit C OS=Drosophila persimilis GN=eIF3-S8 PE=3 SV=1 64 210 3.0E-08
sp|Q28Z41|EIF3C_DROPS Eukaryotic translation initiation factor 3 subunit C OS=Drosophila pseudoobscura pseudoobscura GN=eIF3-S8 PE=3 SV=1 64 210 3.0E-08
sp|B4MRZ8|EIF3C_DROWI Eukaryotic translation initiation factor 3 subunit C OS=Drosophila willistoni GN=eIF3-S8 PE=3 SV=1 64 199 4.0E-08
sp|Q6PFQ2|EIF3C_DANRE Eukaryotic translation initiation factor 3 subunit C OS=Danio rerio GN=eif3c PE=1 SV=1 77 213 5.0E-08
sp|B4J789|EIF3C_DROGR Eukaryotic translation initiation factor 3 subunit C OS=Drosophila grimshawi GN=eIF3-S8 PE=3 SV=1 77 212 6.0E-08
sp|Q4QR58|EIF3C_XENLA Eukaryotic translation initiation factor 3 subunit C OS=Xenopus laevis GN=eif3c PE=2 SV=1 77 210 9.0E-08
sp|B3MIF1|EIF3C_DROAN Eukaryotic translation initiation factor 3 subunit C OS=Drosophila ananassae GN=eIF3-S8 PE=3 SV=1 64 197 2.0E-07
sp|Q0ZB76|EIF3C_BOMMO Eukaryotic translation initiation factor 3 subunit C OS=Bombyx mori GN=eIF3-S8 PE=2 SV=1 77 202 8.0E-07
sp|Q54X97|EIF3C_DICDI Eukaryotic translation initiation factor 3 subunit C OS=Dictyostelium discoideum GN=eif3C PE=3 SV=1 73 197 1.0E-06
sp|B0W0S3|EIF3C_CULQU Eukaryotic translation initiation factor 3 subunit C OS=Culex quinquefasciatus GN=eIF3-S8 PE=3 SV=1 77 197 1.0E-06
sp|Q7PMU8|EIF3C_ANOGA Eukaryotic translation initiation factor 3 subunit C OS=Anopheles gambiae GN=eIF3-S8 PE=3 SV=3 77 197 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003743 translation initiation factor activity Yes
GO:0005852 eukaryotic translation initiation factor 3 complex Yes
GO:0006413 translational initiation Yes
GO:0031369 translation initiation factor binding Yes
GO:0008135 translation factor activity, RNA binding No
GO:0005575 cellular_component No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0097159 organic cyclic compound binding No
GO:0090079 translation regulator activity, nucleic acid binding No
GO:1901363 heterocyclic compound binding No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0005515 protein binding No
GO:0032991 protein-containing complex No
GO:0003676 nucleic acid binding No
GO:0045182 translation regulator activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 51 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3707
MSRFFRGGDDSSSDSSTDEEELYSGEEEGQDVDQQNSDDDSDKGSKEDSDASSSDDEGGNRQGASKFLKDIDSES
EDSDEEVRAKIKSAKDKRLDELESSIKQIENGQKNGDWTLISNEYDKLNKQVAKLPEGRKTPKQYIRIVAELEDF
MNESLAKQKVTPKTKQMNATQARARNAVKQKIKKTNKEHQAQIDEYRKDKDVYMESDEEEEEEVPIIKPKKAPKF
EIDVVTEDADDEGFATVGKGGRTLQYTPESIFKHLRTIMETRGKKNTDRTEQIKVMEKLGEIANTPYQKIRVYLT
LVSARFDLGSGTSNAMPLDHWKAAERELSSLLEILRTSQDYVVVENVEEWDDDEKPPTMQPGEKYIKVAGSIVSF
MERLDDELVRSLQNIDPHTSEYIERLQDEGALYNIIFRCLLYYERLQKEEALEIAQESINRIVVRRLEHVYFKPA
QVVKTFEENSWKAVGDDVDSAITPRQRSQDAGSLVNVLCNYLFSHDDGIRRARAMLCQVYFLALHGEYYKARDMM
LMSHLQETIPNFDVQTQILYNRTLVQVGLCAFRKGLVYDAQTTLQEICGSGRQKELLAQGVMMQRYNQVSPEQER
LEKQRQLPFHMHINLELLECVYLTCSMLLEIPLLAQTGSSPDVKKRVISKTYRRMLEYHERQIFTGPPENTRDHV
MQASKALAAGEWKKSTNFIHSIKIWDLMPNSEEIKTMLSKQIQEEGLRTYLFTYAPFYDTLALETLGGMFELDLA
KVAAVVSKMISHEELAASLDQVTSTLIFRKGVELSRLQSLALTLSDKASQLIETNERTLEQRTQGTSNAFERQGG
RGRGGARGGQRSGRGGARGGGNTQRQAGGTQFTGGALGAAVRG*
Coding >OphauB2|3707
ATGTCTCGCTTCTTTCGTGGCGGCGACGACAGTTCGTCCGACTCGTCTACCGATGAGGAGGAGCTCTACTCTGGC
GAGGAAGAGGGCCAGGATGTGGACCAGCAAAACTCGGACGACGACTCGGACAAGGGGTCCAAGGAAGATAGCGAC
GCCAGCTCAAGCGACGACGAGGGCGGTAATCGCCAGGGTGCGAGCAAGTTCTTAAAGGACATTGACTCGGAAAGC
GAAGATAGCGATGAGGAGGTTCGCGCCAAGATTAAGAGCGCCAAGGACAAGCGCTTGGATGAGCTCGAGTCGTCA
ATCAAGCAGATTGAAAATGGGCAAAAAAATGGCGACTGGACCCTTATTTCTAACGAGTACGACAAGCTCAACAAG
CAAGTGGCCAAGCTGCCAGAGGGACGCAAGACGCCCAAGCAATACATTCGCATCGTTGCCGAGTTGGAAGACTTT
ATGAATGAGTCATTGGCGAAGCAAAAAGTGACGCCCAAAACCAAACAAATGAACGCGACACAAGCCAGGGCCCGC
AACGCCGTCAAGCAAAAAATTAAAAAGACAAACAAGGAACACCAGGCCCAGATTGACGAGTATCGCAAGGACAAG
GACGTCTACATGGAGTCGGATGAGGAGGAGGAGGAGGAAGTGCCGATTATCAAGCCCAAAAAAGCGCCCAAGTTT
GAAATCGATGTCGTGACTGAAGATGCCGACGATGAAGGGTTTGCCACTGTCGGCAAGGGCGGTCGCACGCTGCAG
TACACGCCCGAAAGCATCTTTAAGCACCTCCGGACCATTATGGAGACGCGTGGCAAGAAGAATACGGACCGCACG
GAGCAAATCAAGGTGATGGAGAAGCTTGGCGAAATCGCCAACACGCCGTACCAAAAGATTCGCGTCTACCTCACC
CTCGTTTCGGCGCGCTTTGACTTGGGCTCTGGCACGTCAAACGCCATGCCTCTGGATCACTGGAAGGCTGCGGAA
AGGGAGCTGTCCTCTCTCCTTGAGATTCTCCGCACAAGCCAAGACTATGTGGTTGTTGAGAATGTGGAAGAGTGG
GACGATGACGAGAAGCCACCGACGATGCAGCCTGGCGAAAAGTACATCAAGGTTGCAGGCAGCATTGTCTCCTTT
ATGGAAAGGCTCGACGACGAACTTGTTCGCTCTCTTCAGAATATCGACCCTCACACATCCGAGTACATTGAACGT
TTGCAGGACGAAGGCGCGCTCTATAACATTATATTTCGCTGTTTGCTCTACTATGAGCGCTTGCAAAAGGAAGAG
GCCCTCGAGATTGCCCAGGAGAGCATCAATCGCATTGTTGTTCGAAGATTGGAGCATGTCTACTTCAAGCCTGCT
CAGGTTGTCAAGACGTTTGAGGAGAATTCGTGGAAGGCGGTGGGAGACGACGTCGACTCGGCCATTACCCCGCGT
CAACGTTCCCAGGACGCGGGCAGCCTGGTCAATGTCCTCTGCAACTACCTCTTTAGCCACGACGATGGTATCCGA
CGCGCGAGGGCCATGTTGTGCCAAGTTTACTTCTTGGCCCTCCATGGCGAGTACTACAAGGCTCGTGACATGATG
CTCATGTCGCATCTGCAAGAGACGATTCCCAACTTTGATGTGCAGACACAGATTCTGTATAACCGGACGCTTGTG
CAGGTTGGTCTGTGTGCCTTTCGCAAGGGCCTCGTGTACGATGCGCAGACGACACTCCAGGAGATTTGCGGCAGT
GGGCGGCAAAAGGAGCTCTTGGCTCAGGGCGTCATGATGCAGAGATATAACCAAGTGTCACCGGAGCAGGAACGG
CTGGAGAAGCAGCGGCAGCTGCCCTTTCACATGCACATCAACCTGGAGCTGCTTGAGTGTGTATACTTGACGTGC
AGCATGCTGCTCGAGATTCCGCTGCTGGCGCAGACGGGATCGTCGCCCGATGTCAAGAAGCGCGTCATCAGCAAG
ACTTATCGACGGATGCTTGAGTATCACGAGCGGCAAATCTTTACGGGGCCGCCCGAGAACACGCGAGACCATGTG
ATGCAGGCGTCCAAGGCGTTGGCAGCGGGCGAGTGGAAAAAGTCGACCAACTTTATCCACAGCATCAAGATTTGG
GACCTGATGCCCAACTCTGAGGAAATCAAGACGATGCTTTCAAAACAGATACAAGAGGAGGGTCTGCGGACATAT
CTGTTTACGTATGCGCCATTTTACGACACGCTGGCGCTGGAGACGCTGGGGGGCATGTTTGAGCTCGACTTGGCC
AAGGTGGCGGCGGTTGTGAGCAAAATGATTAGCCACGAGGAGCTGGCAGCATCACTAGACCAGGTGACGTCGACG
CTCATATTCCGCAAGGGCGTGGAGCTCAGCCGGCTGCAGTCGCTGGCATTGACCTTGTCGGACAAGGCGAGCCAG
TTGATTGAGACGAATGAGCGGACACTGGAGCAGCGGACGCAGGGCACGTCGAATGCGTTTGAGCGCCAAGGCGGG
CGAGGCCGAGGCGGAGCTAGAGGCGGCCAGCGGTCAGGACGAGGCGGCGCACGCGGCGGCGGAAACACGCAGAGA
CAGGCTGGAGGAACACAATTTACGGGCGGAGCATTGGGAGCGGCGGTGAGGGGATAA
Transcript >OphauB2|3707
ATGTCTCGCTTCTTTCGTGGCGGCGACGACAGTTCGTCCGACTCGTCTACCGATGAGGAGGAGCTCTACTCTGGC
GAGGAAGAGGGCCAGGATGTGGACCAGCAAAACTCGGACGACGACTCGGACAAGGGGTCCAAGGAAGATAGCGAC
GCCAGCTCAAGCGACGACGAGGGCGGTAATCGCCAGGGTGCGAGCAAGTTCTTAAAGGACATTGACTCGGAAAGC
GAAGATAGCGATGAGGAGGTTCGCGCCAAGATTAAGAGCGCCAAGGACAAGCGCTTGGATGAGCTCGAGTCGTCA
ATCAAGCAGATTGAAAATGGGCAAAAAAATGGCGACTGGACCCTTATTTCTAACGAGTACGACAAGCTCAACAAG
CAAGTGGCCAAGCTGCCAGAGGGACGCAAGACGCCCAAGCAATACATTCGCATCGTTGCCGAGTTGGAAGACTTT
ATGAATGAGTCATTGGCGAAGCAAAAAGTGACGCCCAAAACCAAACAAATGAACGCGACACAAGCCAGGGCCCGC
AACGCCGTCAAGCAAAAAATTAAAAAGACAAACAAGGAACACCAGGCCCAGATTGACGAGTATCGCAAGGACAAG
GACGTCTACATGGAGTCGGATGAGGAGGAGGAGGAGGAAGTGCCGATTATCAAGCCCAAAAAAGCGCCCAAGTTT
GAAATCGATGTCGTGACTGAAGATGCCGACGATGAAGGGTTTGCCACTGTCGGCAAGGGCGGTCGCACGCTGCAG
TACACGCCCGAAAGCATCTTTAAGCACCTCCGGACCATTATGGAGACGCGTGGCAAGAAGAATACGGACCGCACG
GAGCAAATCAAGGTGATGGAGAAGCTTGGCGAAATCGCCAACACGCCGTACCAAAAGATTCGCGTCTACCTCACC
CTCGTTTCGGCGCGCTTTGACTTGGGCTCTGGCACGTCAAACGCCATGCCTCTGGATCACTGGAAGGCTGCGGAA
AGGGAGCTGTCCTCTCTCCTTGAGATTCTCCGCACAAGCCAAGACTATGTGGTTGTTGAGAATGTGGAAGAGTGG
GACGATGACGAGAAGCCACCGACGATGCAGCCTGGCGAAAAGTACATCAAGGTTGCAGGCAGCATTGTCTCCTTT
ATGGAAAGGCTCGACGACGAACTTGTTCGCTCTCTTCAGAATATCGACCCTCACACATCCGAGTACATTGAACGT
TTGCAGGACGAAGGCGCGCTCTATAACATTATATTTCGCTGTTTGCTCTACTATGAGCGCTTGCAAAAGGAAGAG
GCCCTCGAGATTGCCCAGGAGAGCATCAATCGCATTGTTGTTCGAAGATTGGAGCATGTCTACTTCAAGCCTGCT
CAGGTTGTCAAGACGTTTGAGGAGAATTCGTGGAAGGCGGTGGGAGACGACGTCGACTCGGCCATTACCCCGCGT
CAACGTTCCCAGGACGCGGGCAGCCTGGTCAATGTCCTCTGCAACTACCTCTTTAGCCACGACGATGGTATCCGA
CGCGCGAGGGCCATGTTGTGCCAAGTTTACTTCTTGGCCCTCCATGGCGAGTACTACAAGGCTCGTGACATGATG
CTCATGTCGCATCTGCAAGAGACGATTCCCAACTTTGATGTGCAGACACAGATTCTGTATAACCGGACGCTTGTG
CAGGTTGGTCTGTGTGCCTTTCGCAAGGGCCTCGTGTACGATGCGCAGACGACACTCCAGGAGATTTGCGGCAGT
GGGCGGCAAAAGGAGCTCTTGGCTCAGGGCGTCATGATGCAGAGATATAACCAAGTGTCACCGGAGCAGGAACGG
CTGGAGAAGCAGCGGCAGCTGCCCTTTCACATGCACATCAACCTGGAGCTGCTTGAGTGTGTATACTTGACGTGC
AGCATGCTGCTCGAGATTCCGCTGCTGGCGCAGACGGGATCGTCGCCCGATGTCAAGAAGCGCGTCATCAGCAAG
ACTTATCGACGGATGCTTGAGTATCACGAGCGGCAAATCTTTACGGGGCCGCCCGAGAACACGCGAGACCATGTG
ATGCAGGCGTCCAAGGCGTTGGCAGCGGGCGAGTGGAAAAAGTCGACCAACTTTATCCACAGCATCAAGATTTGG
GACCTGATGCCCAACTCTGAGGAAATCAAGACGATGCTTTCAAAACAGATACAAGAGGAGGGTCTGCGGACATAT
CTGTTTACGTATGCGCCATTTTACGACACGCTGGCGCTGGAGACGCTGGGGGGCATGTTTGAGCTCGACTTGGCC
AAGGTGGCGGCGGTTGTGAGCAAAATGATTAGCCACGAGGAGCTGGCAGCATCACTAGACCAGGTGACGTCGACG
CTCATATTCCGCAAGGGCGTGGAGCTCAGCCGGCTGCAGTCGCTGGCATTGACCTTGTCGGACAAGGCGAGCCAG
TTGATTGAGACGAATGAGCGGACACTGGAGCAGCGGACGCAGGGCACGTCGAATGCGTTTGAGCGCCAAGGCGGG
CGAGGCCGAGGCGGAGCTAGAGGCGGCCAGCGGTCAGGACGAGGCGGCGCACGCGGCGGCGGAAACACGCAGAGA
CAGGCTGGAGGAACACAATTTACGGGCGGAGCATTGGGAGCGGCGGTGAGGGGATAA
Gene >OphauB2|3707
ATGTCTCGCTTCTTTCGTGGCGGCGACGACAGTTCGTCCGACTCGTCTACCGATGAGGAGGAGCTCTACTCTGGC
GAGGAAGAGGGCCAGGATGTGGACCAGCAAAACTCGGACGACGACTCGGACAAGGGGTCCAAGGAAGATAGCGAC
GCCAGCTCAAGCGACGACGAGGGCGGTAATCGCCAGGGTGCGAGCAAGTTCTTAAAGGACATTGACTCGGAAAGC
GAAGATAGCGATGAGGAGGTTCGCGCCAAGATTAAGAGCGCCAAGGACAAGCGCTTGGATGAGCTCGAGTCGTCA
ATCAAGCAGATTGAAAATGGGCAAAAAAATGGCGACTGGACCCTTATTTCTAACGGTATGTGCTTGAATGGTTCT
TGGGACAGCGCCAGCTCTTTATTTGGTCAAGACTGACCTTTGAGCGATAGAGTACGACAAGCTCAACAAGCAAGT
GGCCAAGCTGCCAGAGGGACGCAAGACGCCCAAGCAATACATTCGCATCGTTGCCGAGTTGGAAGACTTTATGAA
TGAGTCATTGGCGAAGCAAAAAGTGACGCCCAAAACCAAACAAATGAACGCGACACAAGCCAGGGCCCGCAACGC
CGTCAAGCAAAAAATTAAAAAGACAAACAAGGAACACCAGGCCCAGATTGACGAGTATCGCAAGGACAAGGACGT
CTACATGGAGTCGGATGAGGAGGAGGAGGAGGAAGTGCCGATTATCAAGCCCAAAAAAGCGCCCAAGTTTGAAAT
CGATGTCGTGACTGAAGATGCCGACGATGAAGGGTTTGCCACTGTCGGCAAGGGCGGTCGCACGCTGCAGTACAC
GCCCGAAAGCATCTTTAAGCACCTCCGGACCATTATGGAGACGCGTGGCAAGAAGAATACGGACCGCACGGAGCA
AATCAAGGTGATGGAGAAGCTTGGCGAAATCGCCAACACGCCGTACCAAAAGATTCGCGTCTACCTCACCCTCGT
TTCGGCGCGCTTTGACTTGGGCTCTGGCACGTCAAACGCCATGCCTCTGGATCACTGGAAGGCTGCGGAAAGGGA
GCTGTCCTCTCTCCTTGAGATTCTCCGCACAAGCCAAGACTATGTGGTTGTTGAGAATGTGGAAGAGTGGGACGA
TGACGAGAAGCCACCGACGATGCAGCCTGGCGAAAAGTACATCAAGGTTGCAGGCAGCATTGTCTCCTTTATGGA
AAGGCTCGACGACGAACTTGTTCGCTCTCTTCAGAATATCGACCCTCACACATCCGAGTACATTGAACGTTTGCA
GGACGAAGGCGCGCTCTATAACATTATATTTCGCTGTTTGCTCTACTATGAGCGCTTGCAAAAGGAAGAGGCCCT
CGAGATTGCCCAGGAGAGCATCAATCGCATTGTTGTTCGAAGATTGGAGCATGTCTACTTCAAGGTATGGGAAAC
CATTTTTTTGTCCACGCCAACCAAGCACTGTTTTGTCTAACACTGCACTAGCCTGCTCAGGTTGTCAAGACGTTT
GAGGAGAATTCGTGGAAGGCGGTGGGAGACGACGTCGACTCGGCCATTACCCCGCGTCAACGTTCCCAGGACGCG
GGCAGCCTGGTCAATGTCCTCTGCAACTACCTCTTTAGCCACGACGATGGTATCCGACGCGCGAGGGCCATGTTG
TGCCAAGTTTACTTCTTGGCCCTCCATGGCGAGTACTACAAGGCTCGTGACATGATGCTCATGTCGCATCTGCAA
GAGACGATTCCCAACTTTGATGTGCAGACACAGATTCTGTATAACCGGACGCTTGTGCAGGTTGGTCTGTGTGCC
TTTCGCAAGGGCCTCGTGTACGATGCGCAGACGACACTCCAGGAGATTTGCGGCAGTGGGCGGCAAAAGGAGCTC
TTGGCTCAGGGCGTCATGATGCAGAGATATAACCAAGTGTCACCGGAGCAGGAACGGCTGGAGAAGCAGCGGCAG
CTGCCCTTTCACATGCACATCAACCTGGAGCTGCTTGAGTGTGTATACTTGACGTGCAGCATGCTGCTCGAGATT
CCGCTGCTGGCGCAGACGGGATCGTCGCCCGATGTCAAGAAGCGCGTCATCAGCAAGACTTATCGACGGATGCTT
GAGTATCACGAGCGGCAAATCTTTACGGGGCCGCCCGAGAACACGCGAGACCATGTGATGCAGGCGTCCAAGGCG
TTGGCAGCGGGCGAGTGGAAAAAGTCGACCAACTTTATCCACAGCATCAAGATTTGGGACCTGATGCCCAACTCT
GAGGAAATCAAGACGATGCTTTCAAAACAGATACAAGAGGAGGGTCTGCGGACATATCTGTTTACGTATGCGCCA
TTTTACGACACGCTGGCGCTGGAGACGCTGGGGGGCATGTTTGAGCTCGACTTGGCCAAGGTGGCGGCGGTTGTG
AGCAAAATGATTAGCCACGAGGAGCTGGCAGCATCACTAGACCAGGTGACGTCGACGCTCATATTCCGCAAGGGC
GTGGAGCTCAGCCGGCTGCAGTCGCTGGCATTGACCTTGTCGGACAAGGCGAGCCAGTTGATTGAGACGAATGAG
CGGACACTGGAGCAGCGGACGCAGGGCACGTCGAATGCGTTTGAGCGCCAAGGCGGGCGAGGCCGAGGCGGAGCT
AGAGGCGGCCAGCGGTCAGGACGAGGCGGCGCACGCGGCGGCGGAAACACGCAGAGACAGGCTGGAGGAACACAA
TTTACGGGCGGAGCATTGGGAGCGGCGGTGAGGGGATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail