Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3701
Gene name
LocationContig_236:16350..18518
Strand-
Gene length (bp)2168
Transcript length (bp)1893
Coding sequence length (bp)1893
Protein length (aa) 631

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00743 FMO-like Flavin-binding monooxygenase-like 9.8E-06 10 129
PF13738 Pyr_redox_3 Pyridine nucleotide-disulphide oxidoreductase 3.0E-09 11 213

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q93TJ5|HAPMO_PSEFL 4-hydroxyacetophenone monooxygenase OS=Pseudomonas fluorescens GN=hapE PE=1 SV=1 2 192 8.0E-12
sp|Q9RKB5|BVMO2_STRCO Baeyer-Villiger monooxygenase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO3172 PE=1 SV=1 6 167 1.0E-10
sp|P64746|Y916_MYCBO Uncharacterized monooxygenase Mb0916 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb0916 PE=3 SV=1 10 168 6.0E-10
sp|P9WNG1|Y892_MYCTU Uncharacterized monooxygenase Rv0892 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0892 PE=1 SV=1 10 168 6.0E-10
sp|P9WNG0|Y892_MYCTO Uncharacterized monooxygenase MT0916 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0916 PE=3 SV=1 10 168 6.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q93TJ5|HAPMO_PSEFL 4-hydroxyacetophenone monooxygenase OS=Pseudomonas fluorescens GN=hapE PE=1 SV=1 2 192 8.0E-12
sp|Q9RKB5|BVMO2_STRCO Baeyer-Villiger monooxygenase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO3172 PE=1 SV=1 6 167 1.0E-10
sp|P64746|Y916_MYCBO Uncharacterized monooxygenase Mb0916 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb0916 PE=3 SV=1 10 168 6.0E-10
sp|P9WNG1|Y892_MYCTU Uncharacterized monooxygenase Rv0892 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0892 PE=1 SV=1 10 168 6.0E-10
sp|P9WNG0|Y892_MYCTO Uncharacterized monooxygenase MT0916 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0916 PE=3 SV=1 10 168 6.0E-10
sp|Q47PU3|PAMO_THEFY Phenylacetone monooxygenase OS=Thermobifida fusca (strain YX) GN=pamO PE=1 SV=1 6 166 4.0E-09
sp|Q8MP06|SNO1_TYRJA Senecionine N-oxygenase OS=Tyria jacobaeae GN=sno1 PE=1 SV=1 10 203 9.0E-09
sp|A0R665|ETHA_MYCS2 FAD-containing monooxygenase EthA OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=ethA PE=3 SV=1 6 362 1.0E-08
sp|P9WNF6|MYMA_MYCTO Putative FAD-containing monooxygenase MymA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mymA PE=3 SV=1 6 362 2.0E-08
sp|P9WNF7|MYMA_MYCTU Putative FAD-containing monooxygenase MymA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mymA PE=1 SV=1 6 362 2.0E-08
sp|Q8VHG0|FMO4_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 4 OS=Mus musculus GN=Fmo4 PE=1 SV=3 10 373 5.0E-08
sp|Q8K4B7|FMO4_RAT Dimethylaniline monooxygenase [N-oxide-forming] 4 OS=Rattus norvegicus GN=Fmo4 PE=2 SV=3 10 168 3.0E-07
sp|P9WNF9|ETHA_MYCTU FAD-containing monooxygenase EthA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ethA PE=1 SV=1 6 204 2.0E-06
sp|P9WNF8|ETHA_MYCTO FAD-containing monooxygenase EthA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ethA PE=3 SV=1 6 204 2.0E-06
sp|Q7TVI2|ETHA_MYCBO FAD-containing monooxygenase EthA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ethA PE=1 SV=1 6 204 2.0E-06
sp|Q9SXE1|GSOX3_ARATH Flavin-containing monooxygenase FMO GS-OX3 OS=Arabidopsis thaliana GN=FMOGS-OX3 PE=2 SV=1 10 166 3.0E-06
sp|Q9C8U0|GSXL5_ARATH Flavin-containing monooxygenase FMO GS-OX-like 5 OS=Arabidopsis thaliana GN=At1g63370 PE=2 SV=2 10 161 4.0E-06
sp|Q9SXD5|GSXL3_ARATH Flavin-containing monooxygenase FMO GS-OX-like 3 OS=Arabidopsis thaliana GN=At1g62620 PE=2 SV=2 10 161 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0050661 NADP binding Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0004499 N,N-dimethylaniline monooxygenase activity Yes
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0036094 small molecule binding No
GO:0043168 anion binding No
GO:0004497 monooxygenase activity No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:1901363 heterocyclic compound binding No
GO:0016491 oxidoreductase activity No
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0016709 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen No
GO:0000166 nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3701
MVSRAEKVDVVVVGAGWNGLISAKTYLELQPSANVIIVDEQASIGGVWSREKIYPSLYAQIKHGLFEYSFYPMRH
EGVTADGYVSGDTIHAYLNDFASDFGLVPRLRLGTRVSQVSRRAGGGWRLEVQHQRAIECDKLIYASGATSHPVV
PAWPRSPGFSAPVIHSSETGSHLEALAKTPSATVVGGAKSSFDSVFLLLSNGTRVDWVIRDHGSGPLALMPPTLL
GAVNTMDVVTTRFVALMGTTIMNTDGAARQFLQRTLLGRLLAHVFWLVVNWIADRHAGYSKSANASKLRPEPHGN
GIYWANAGLGAASVPDFWKTVHEGRCTIHRSDIASLGHDNTIHLQNGTSFTTDYVVLSTGFDKSFHVFSESLQRE
LALVHDESQADKSTRLDTAADAAIDALLPSLKHTPFSGRSLEREHTAGGRKLLHGPSRHFRRLIVPALAAQGDRS
IVFPGFIHSIYTPMVSEVQALWGAAFLLGLTEMPSQEAMDVEVAEWNAWTRKRYGAQGHKHAYAIFDFLAYIDLL
LKDLGINPYRKQGWLRHLFTPAYPREYRGILSEFKASLPPAADASAACSTPELGASTPVSLASTPLPATPRNETL
VPLANLDNQDESCSPSRLVVKDLDLSRIVA*
Coding >OphauB2|3701
ATGGTGTCGAGGGCAGAAAAAGTCGACGTGGTGGTTGTGGGCGCAGGATGGAACGGGCTCATCTCGGCAAAGACC
TATCTGGAGCTGCAGCCGTCGGCCAATGTCATCATTGTCGACGAGCAGGCGTCCATTGGCGGGGTATGGAGCAGA
GAAAAGATATACCCCAGCCTGTATGCGCAAATCAAGCACGGGCTGTTTGAGTACTCCTTCTACCCCATGCGGCAC
GAGGGCGTCACGGCCGACGGCTACGTGTCGGGCGACACCATCCACGCCTATCTCAACGACTTTGCCAGCGACTTT
GGCCTGGTGCCGCGACTGCGACTGGGCACCCGCGTCTCCCAAGTGTCGCGCAGGGCGGGGGGCGGCTGGCGGCTC
GAGGTGCAGCACCAGAGGGCCATTGAGTGCGACAAGCTCATCTACGCCTCGGGCGCCACGTCGCACCCCGTCGTG
CCGGCCTGGCCTCGCAGCCCGGGCTTTTCGGCGCCCGTCATACACTCGAGCGAGACGGGCAGCCATCTCGAGGCG
CTGGCAAAGACACCCTCGGCCACCGTGGTGGGCGGAGCCAAGTCGTCCTTTGACAGCGTCTTCCTGCTCCTCAGC
AATGGCACGCGCGTCGACTGGGTCATTCGCGATCACGGCTCGGGCCCCCTGGCCCTCATGCCGCCCACGCTGCTG
GGCGCCGTCAACACCATGGATGTCGTCACAACGCGCTTCGTCGCCCTCATGGGCACCACCATCATGAACACTGAC
GGCGCCGCCCGCCAGTTCCTGCAGCGCACCCTGCTGGGGCGCCTCTTGGCCCATGTCTTTTGGCTCGTGGTCAAC
TGGATTGCCGACCGCCATGCAGGCTACTCCAAGTCGGCCAATGCGAGCAAGCTGCGTCCAGAGCCCCACGGCAAC
GGCATCTACTGGGCCAATGCTGGCCTCGGCGCCGCCAGCGTGCCCGACTTTTGGAAAACGGTCCACGAGGGCCGC
TGCACCATCCATCGCTCCGATATTGCCTCGCTCGGCCACGACAACACCATCCACCTCCAAAACGGCACCAGCTTC
ACCACCGACTACGTCGTCCTCTCCACCGGCTTCGACAAGTCGTTTCACGTCTTCAGCGAGTCTCTGCAGCGCGAG
CTAGCCCTTGTCCACGACGAGTCCCAGGCCGACAAGTCGACGCGTCTCGACACCGCCGCCGACGCCGCCATTGAC
GCTCTCTTGCCCAGTCTCAAGCACACGCCCTTTTCTGGCCGCAGTCTGGAGCGCGAGCACACTGCTGGCGGCCGC
AAGCTGCTCCACGGCCCAAGTAGGCATTTCCGCCGCCTCATTGTGCCCGCTCTGGCCGCTCAGGGCGACCGCTCC
ATTGTCTTTCCGGGCTTTATCCACTCCATATACACTCCCATGGTGTCCGAGGTCCAGGCCCTGTGGGGAGCAGCC
TTTTTGCTTGGCCTGACCGAGATGCCCAGCCAAGAGGCCATGGACGTTGAAGTGGCAGAGTGGAATGCATGGACA
CGCAAGCGCTATGGCGCTCAGGGCCACAAGCACGCCTATGCCATATTTGACTTTCTCGCGTACATCGACCTCCTC
CTCAAGGACCTCGGCATCAACCCATACCGCAAGCAAGGCTGGCTTCGCCACCTCTTCACACCTGCCTACCCCCGC
GAATATCGCGGCATTCTGTCTGAATTCAAAGCCTCGCTTCCCCCCGCCGCCGACGCATCAGCCGCCTGCTCTACC
CCTGAGCTGGGTGCCTCGACCCCCGTGTCCTTGGCCAGCACGCCCCTGCCCGCCACGCCTCGCAACGAGACGCTT
GTGCCCCTTGCCAATCTAGATAATCAAGACGAGTCTTGCAGCCCAAGTCGCCTTGTGGTCAAGGACCTCGACCTG
TCGAGAATTGTCGCTTAA
Transcript >OphauB2|3701
ATGGTGTCGAGGGCAGAAAAAGTCGACGTGGTGGTTGTGGGCGCAGGATGGAACGGGCTCATCTCGGCAAAGACC
TATCTGGAGCTGCAGCCGTCGGCCAATGTCATCATTGTCGACGAGCAGGCGTCCATTGGCGGGGTATGGAGCAGA
GAAAAGATATACCCCAGCCTGTATGCGCAAATCAAGCACGGGCTGTTTGAGTACTCCTTCTACCCCATGCGGCAC
GAGGGCGTCACGGCCGACGGCTACGTGTCGGGCGACACCATCCACGCCTATCTCAACGACTTTGCCAGCGACTTT
GGCCTGGTGCCGCGACTGCGACTGGGCACCCGCGTCTCCCAAGTGTCGCGCAGGGCGGGGGGCGGCTGGCGGCTC
GAGGTGCAGCACCAGAGGGCCATTGAGTGCGACAAGCTCATCTACGCCTCGGGCGCCACGTCGCACCCCGTCGTG
CCGGCCTGGCCTCGCAGCCCGGGCTTTTCGGCGCCCGTCATACACTCGAGCGAGACGGGCAGCCATCTCGAGGCG
CTGGCAAAGACACCCTCGGCCACCGTGGTGGGCGGAGCCAAGTCGTCCTTTGACAGCGTCTTCCTGCTCCTCAGC
AATGGCACGCGCGTCGACTGGGTCATTCGCGATCACGGCTCGGGCCCCCTGGCCCTCATGCCGCCCACGCTGCTG
GGCGCCGTCAACACCATGGATGTCGTCACAACGCGCTTCGTCGCCCTCATGGGCACCACCATCATGAACACTGAC
GGCGCCGCCCGCCAGTTCCTGCAGCGCACCCTGCTGGGGCGCCTCTTGGCCCATGTCTTTTGGCTCGTGGTCAAC
TGGATTGCCGACCGCCATGCAGGCTACTCCAAGTCGGCCAATGCGAGCAAGCTGCGTCCAGAGCCCCACGGCAAC
GGCATCTACTGGGCCAATGCTGGCCTCGGCGCCGCCAGCGTGCCCGACTTTTGGAAAACGGTCCACGAGGGCCGC
TGCACCATCCATCGCTCCGATATTGCCTCGCTCGGCCACGACAACACCATCCACCTCCAAAACGGCACCAGCTTC
ACCACCGACTACGTCGTCCTCTCCACCGGCTTCGACAAGTCGTTTCACGTCTTCAGCGAGTCTCTGCAGCGCGAG
CTAGCCCTTGTCCACGACGAGTCCCAGGCCGACAAGTCGACGCGTCTCGACACCGCCGCCGACGCCGCCATTGAC
GCTCTCTTGCCCAGTCTCAAGCACACGCCCTTTTCTGGCCGCAGTCTGGAGCGCGAGCACACTGCTGGCGGCCGC
AAGCTGCTCCACGGCCCAAGTAGGCATTTCCGCCGCCTCATTGTGCCCGCTCTGGCCGCTCAGGGCGACCGCTCC
ATTGTCTTTCCGGGCTTTATCCACTCCATATACACTCCCATGGTGTCCGAGGTCCAGGCCCTGTGGGGAGCAGCC
TTTTTGCTTGGCCTGACCGAGATGCCCAGCCAAGAGGCCATGGACGTTGAAGTGGCAGAGTGGAATGCATGGACA
CGCAAGCGCTATGGCGCTCAGGGCCACAAGCACGCCTATGCCATATTTGACTTTCTCGCGTACATCGACCTCCTC
CTCAAGGACCTCGGCATCAACCCATACCGCAAGCAAGGCTGGCTTCGCCACCTCTTCACACCTGCCTACCCCCGC
GAATATCGCGGCATTCTGTCTGAATTCAAAGCCTCGCTTCCCCCCGCCGCCGACGCATCAGCCGCCTGCTCTACC
CCTGAGCTGGGTGCCTCGACCCCCGTGTCCTTGGCCAGCACGCCCCTGCCCGCCACGCCTCGCAACGAGACGCTT
GTGCCCCTTGCCAATCTAGATAATCAAGACGAGTCTTGCAGCCCAAGTCGCCTTGTGGTCAAGGACCTCGACCTG
TCGAGAATTGTCGCTTAA
Gene >OphauB2|3701
ATGGTGTCGAGGGCAGAAAAAGTCGACGTGGTGGTTGTGGGCGCAGGTAGCTGGACAGACACCCAGTCCCTCGGC
TCGTGAGGCTAACAAGGGCAGGATGGAACGGGCTCATCTCGGCAAAGACCTATCTGGAGCTGCAGCCGTCGGCCA
ATGTCATCATTGTCGACGAGCAGGCGTCCATTGGCGGGGTATGGAGCAGAGAAAAGATATACCCCAGCCTGTATG
CGCAAATCAAGCACGGGCTGTTTGAGTACTCCTTCTACCCCATGCGGCACGAGGGCGTCACGGCCGACGGCTACG
TGTCGGGCGACACCATCCACGCCTATCTCAACGACTTTGCCAGCGACTTTGGCCTGGTGCCGCGACTGCGACTGG
GCACCCGCGTCTCCCAAGTGTCGCGCAGGGCGGGGGGCGGCTGGCGGCTCGAGGTGCAGCACCAGAGGGCCATTG
AGTGCGACAAGCTCATCTACGCCTCGGGCGCCACGTCGCACCCCGTCGTGCCGGCCTGGCCTCGCAGCCCGGGCT
TTTCGGCGCCCGTCATACACTCGAGCGAGACGGGCAGCCATCTCGAGGCGCTGGCAAAGACACCCTCGGCCACCG
TGGTGGGCGGAGCCAAGTCGTCCTTTGACAGCGTCTTCCTGCTCCTCAGCAATGGCACGCGCGTCGACTGGGTCA
TTCGCGATCACGGCTCGGGCCCCCTGGCCCTCATGCCGCCCACGCTGCTGGGCGCCGTCAACACCATGGATGTCG
TCACAACGCGCTTCGTCGCCCTCATGGGCACCACCATCATGAACACTGACGGCGCCGCCCGCCAGTTCCTGCAGC
GCACCCTGCTGGGGCGCCTCTTGGCCCATGTCTTTTGGCTCGTGGTCAACTGGATTGCCGACCGCCATGCAGGCT
ACTCCAAGTCGGCCAATGCGAGCAAGCTGCGTCCAGAGCCCCACGGCAACGGGTATGCTGTAGACAACACTCCTC
CTCCCCTCCCTCTGGCCGCTGACGCCTCGTGTCCAGCATCTACTGGGCCAATGCTGGCCTCGGCGCCGCCAGCGT
GCCCGACTTTTGGAAAACGGTCCACGAGGGCCGCTGCACCATCCATCGCTCCGATATTGCCTCGCTCGGCCACGA
CAACACCATCCACCTCCAAAACGGCACCAGCTTCACCACCGACTACGTCGTCCTCTCCACCGGCTTCGACAAGTC
GTTTCACGTCTTCAGCGAGTCTCTGCAGCGCGAGCTAGCCCTTGTCCACGACGAGTCCCAGGCCGACAAGTCGAC
GCGTCTCGACACCGCCGCCGACGCCGCCATTGACGCTCTCTTGCCCAGTCTCAAGCACACGCCCTTTTCTGGCCG
CAGTCTGGAGCGCGAGCACACTGCTGGCGGCCGCAAGCTGCTCCACGGCCCAAGTAGGCATTTCCGCCGCCTCAT
TGTGCCCGCTCTGGCCGCTCAGGGCGACCGCTCCATTGTCTTTCCGGGCTTTATCCACTCCATATACACTCCCAT
GGTGTCCGAGGTCCAGGCCCTGTGGGGAGCAGCCTTTTTGCTTGGCCTGACCGAGATGCCCAGCCAAGAGGCCAT
GGACGTTGAAGTGGCAGAGTGGAATGCATGGACACGCAAGCGCTATGGCGCTCAGGGCCACAAGCACGCCTATGC
CATATTTGACTTTCTCGCGGTAGGTGCCATTTTCTCTGGTCTCGTTTTTTTTCTCTTTTTTTCTCTCTCTTTTGA
AACGAATAAGAAAGACGATGAAAAGGAAGATGATGGCGGGGGGGAAAAGAGAGAGAAAAGAGAGAGAAAAAGCTA
CATCCACATCAGCTGACCTGCCTGACCCACAAAAGTACATCGACCTCCTCCTCAAGGACCTCGGCATCAACCCAT
ACCGCAAGCAAGGCTGGCTTCGCCACCTCTTCACACCTGCCTACCCCCGCGAATATCGCGGCATTCTGTCTGAAT
TCAAAGCCTCGCTTCCCCCCGCCGCCGACGCATCAGCCGCCTGCTCTACCCCTGAGCTGGGTGCCTCGACCCCCG
TGTCCTTGGCCAGCACGCCCCTGCCCGCCACGCCTCGCAACGAGACGCTTGTGCCCCTTGCCAATCTAGATAATC
AAGACGAGTCTTGCAGCCCAAGTCGCCTTGTGGTCAAGGACCTCGACCTGTCGAGAATTGTCGCTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail