Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3701
Gene name
LocationContig_236:16350..18518
Strand-
Gene length (bp)2168
Transcript length (bp)1893
Coding sequence length (bp)1893
Protein length (aa) 631

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00743 FMO-like Flavin-binding monooxygenase-like 9.8E-06 10 129
PF13738 Pyr_redox_3 Pyridine nucleotide-disulphide oxidoreductase 3.0E-09 11 213

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q93TJ5|HAPMO_PSEFL 4-hydroxyacetophenone monooxygenase OS=Pseudomonas fluorescens GN=hapE PE=1 SV=1 2 192 8.0E-12
sp|Q9RKB5|BVMO2_STRCO Baeyer-Villiger monooxygenase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO3172 PE=1 SV=1 6 167 1.0E-10
sp|P64746|Y916_MYCBO Uncharacterized monooxygenase Mb0916 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb0916 PE=3 SV=1 10 168 6.0E-10
sp|P9WNG1|Y892_MYCTU Uncharacterized monooxygenase Rv0892 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0892 PE=1 SV=1 10 168 6.0E-10
sp|P9WNG0|Y892_MYCTO Uncharacterized monooxygenase MT0916 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0916 PE=3 SV=1 10 168 6.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q93TJ5|HAPMO_PSEFL 4-hydroxyacetophenone monooxygenase OS=Pseudomonas fluorescens GN=hapE PE=1 SV=1 2 192 8.0E-12
sp|Q9RKB5|BVMO2_STRCO Baeyer-Villiger monooxygenase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO3172 PE=1 SV=1 6 167 1.0E-10
sp|P64746|Y916_MYCBO Uncharacterized monooxygenase Mb0916 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb0916 PE=3 SV=1 10 168 6.0E-10
sp|P9WNG1|Y892_MYCTU Uncharacterized monooxygenase Rv0892 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0892 PE=1 SV=1 10 168 6.0E-10
sp|P9WNG0|Y892_MYCTO Uncharacterized monooxygenase MT0916 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0916 PE=3 SV=1 10 168 6.0E-10
sp|Q47PU3|PAMO_THEFY Phenylacetone monooxygenase OS=Thermobifida fusca (strain YX) GN=pamO PE=1 SV=1 6 166 4.0E-09
sp|Q8MP06|SNO1_TYRJA Senecionine N-oxygenase OS=Tyria jacobaeae GN=sno1 PE=1 SV=1 10 203 9.0E-09
sp|A0R665|ETHA_MYCS2 FAD-containing monooxygenase EthA OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=ethA PE=3 SV=1 6 362 1.0E-08
sp|P9WNF6|MYMA_MYCTO Putative FAD-containing monooxygenase MymA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mymA PE=3 SV=1 6 362 2.0E-08
sp|P9WNF7|MYMA_MYCTU Putative FAD-containing monooxygenase MymA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mymA PE=1 SV=1 6 362 2.0E-08
sp|Q8VHG0|FMO4_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 4 OS=Mus musculus GN=Fmo4 PE=1 SV=3 10 373 5.0E-08
sp|Q8K4B7|FMO4_RAT Dimethylaniline monooxygenase [N-oxide-forming] 4 OS=Rattus norvegicus GN=Fmo4 PE=2 SV=3 10 168 3.0E-07
sp|P9WNF9|ETHA_MYCTU FAD-containing monooxygenase EthA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ethA PE=1 SV=1 6 204 2.0E-06
sp|P9WNF8|ETHA_MYCTO FAD-containing monooxygenase EthA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ethA PE=3 SV=1 6 204 2.0E-06
sp|Q7TVI2|ETHA_MYCBO FAD-containing monooxygenase EthA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ethA PE=1 SV=1 6 204 2.0E-06
sp|Q9SXE1|GSOX3_ARATH Flavin-containing monooxygenase FMO GS-OX3 OS=Arabidopsis thaliana GN=FMOGS-OX3 PE=2 SV=1 10 166 3.0E-06
sp|Q9C8U0|GSXL5_ARATH Flavin-containing monooxygenase FMO GS-OX-like 5 OS=Arabidopsis thaliana GN=At1g63370 PE=2 SV=2 10 161 4.0E-06
sp|Q9SXD5|GSXL3_ARATH Flavin-containing monooxygenase FMO GS-OX-like 3 OS=Arabidopsis thaliana GN=At1g62620 PE=2 SV=2 10 161 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0050661 NADP binding Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0004499 N,N-dimethylaniline monooxygenase activity Yes
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0036094 small molecule binding No
GO:0043168 anion binding No
GO:0004497 monooxygenase activity No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:1901363 heterocyclic compound binding No
GO:0016491 oxidoreductase activity No
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0016709 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen No
GO:0000166 nucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1179
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2169
Ophiocordyceps australis 1348a (Ghana) OphauG2|2520
Ophiocordyceps australis map64 (Brazil) OphauB2|3701 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|473
Ophiocordyceps subramaniannii Hirsu2|10304
Ophiocordyceps subramaniannii Hirsu2|6972

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3701
MVSRAEKVDVVVVGAGWNGLISAKTYLELQPSANVIIVDEQASIGGVWSREKIYPSLYAQIKHGLFEYSFYPMRH
EGVTADGYVSGDTIHAYLNDFASDFGLVPRLRLGTRVSQVSRRAGGGWRLEVQHQRAIECDKLIYASGATSHPVV
PAWPRSPGFSAPVIHSSETGSHLEALAKTPSATVVGGAKSSFDSVFLLLSNGTRVDWVIRDHGSGPLALMPPTLL
GAVNTMDVVTTRFVALMGTTIMNTDGAARQFLQRTLLGRLLAHVFWLVVNWIADRHAGYSKSANASKLRPEPHGN
GIYWANAGLGAASVPDFWKTVHEGRCTIHRSDIASLGHDNTIHLQNGTSFTTDYVVLSTGFDKSFHVFSESLQRE
LALVHDESQADKSTRLDTAADAAIDALLPSLKHTPFSGRSLEREHTAGGRKLLHGPSRHFRRLIVPALAAQGDRS
IVFPGFIHSIYTPMVSEVQALWGAAFLLGLTEMPSQEAMDVEVAEWNAWTRKRYGAQGHKHAYAIFDFLAYIDLL
LKDLGINPYRKQGWLRHLFTPAYPREYRGILSEFKASLPPAADASAACSTPELGASTPVSLASTPLPATPRNETL
VPLANLDNQDESCSPSRLVVKDLDLSRIVA*
Coding >OphauB2|3701
ATGGTGTCGAGGGCAGAAAAAGTCGACGTGGTGGTTGTGGGCGCAGGATGGAACGGGCTCATCTCGGCAAAGACC
TATCTGGAGCTGCAGCCGTCGGCCAATGTCATCATTGTCGACGAGCAGGCGTCCATTGGCGGGGTATGGAGCAGA
GAAAAGATATACCCCAGCCTGTATGCGCAAATCAAGCACGGGCTGTTTGAGTACTCCTTCTACCCCATGCGGCAC
GAGGGCGTCACGGCCGACGGCTACGTGTCGGGCGACACCATCCACGCCTATCTCAACGACTTTGCCAGCGACTTT
GGCCTGGTGCCGCGACTGCGACTGGGCACCCGCGTCTCCCAAGTGTCGCGCAGGGCGGGGGGCGGCTGGCGGCTC
GAGGTGCAGCACCAGAGGGCCATTGAGTGCGACAAGCTCATCTACGCCTCGGGCGCCACGTCGCACCCCGTCGTG
CCGGCCTGGCCTCGCAGCCCGGGCTTTTCGGCGCCCGTCATACACTCGAGCGAGACGGGCAGCCATCTCGAGGCG
CTGGCAAAGACACCCTCGGCCACCGTGGTGGGCGGAGCCAAGTCGTCCTTTGACAGCGTCTTCCTGCTCCTCAGC
AATGGCACGCGCGTCGACTGGGTCATTCGCGATCACGGCTCGGGCCCCCTGGCCCTCATGCCGCCCACGCTGCTG
GGCGCCGTCAACACCATGGATGTCGTCACAACGCGCTTCGTCGCCCTCATGGGCACCACCATCATGAACACTGAC
GGCGCCGCCCGCCAGTTCCTGCAGCGCACCCTGCTGGGGCGCCTCTTGGCCCATGTCTTTTGGCTCGTGGTCAAC
TGGATTGCCGACCGCCATGCAGGCTACTCCAAGTCGGCCAATGCGAGCAAGCTGCGTCCAGAGCCCCACGGCAAC
GGCATCTACTGGGCCAATGCTGGCCTCGGCGCCGCCAGCGTGCCCGACTTTTGGAAAACGGTCCACGAGGGCCGC
TGCACCATCCATCGCTCCGATATTGCCTCGCTCGGCCACGACAACACCATCCACCTCCAAAACGGCACCAGCTTC
ACCACCGACTACGTCGTCCTCTCCACCGGCTTCGACAAGTCGTTTCACGTCTTCAGCGAGTCTCTGCAGCGCGAG
CTAGCCCTTGTCCACGACGAGTCCCAGGCCGACAAGTCGACGCGTCTCGACACCGCCGCCGACGCCGCCATTGAC
GCTCTCTTGCCCAGTCTCAAGCACACGCCCTTTTCTGGCCGCAGTCTGGAGCGCGAGCACACTGCTGGCGGCCGC
AAGCTGCTCCACGGCCCAAGTAGGCATTTCCGCCGCCTCATTGTGCCCGCTCTGGCCGCTCAGGGCGACCGCTCC
ATTGTCTTTCCGGGCTTTATCCACTCCATATACACTCCCATGGTGTCCGAGGTCCAGGCCCTGTGGGGAGCAGCC
TTTTTGCTTGGCCTGACCGAGATGCCCAGCCAAGAGGCCATGGACGTTGAAGTGGCAGAGTGGAATGCATGGACA
CGCAAGCGCTATGGCGCTCAGGGCCACAAGCACGCCTATGCCATATTTGACTTTCTCGCGTACATCGACCTCCTC
CTCAAGGACCTCGGCATCAACCCATACCGCAAGCAAGGCTGGCTTCGCCACCTCTTCACACCTGCCTACCCCCGC
GAATATCGCGGCATTCTGTCTGAATTCAAAGCCTCGCTTCCCCCCGCCGCCGACGCATCAGCCGCCTGCTCTACC
CCTGAGCTGGGTGCCTCGACCCCCGTGTCCTTGGCCAGCACGCCCCTGCCCGCCACGCCTCGCAACGAGACGCTT
GTGCCCCTTGCCAATCTAGATAATCAAGACGAGTCTTGCAGCCCAAGTCGCCTTGTGGTCAAGGACCTCGACCTG
TCGAGAATTGTCGCTTAA
Transcript >OphauB2|3701
ATGGTGTCGAGGGCAGAAAAAGTCGACGTGGTGGTTGTGGGCGCAGGATGGAACGGGCTCATCTCGGCAAAGACC
TATCTGGAGCTGCAGCCGTCGGCCAATGTCATCATTGTCGACGAGCAGGCGTCCATTGGCGGGGTATGGAGCAGA
GAAAAGATATACCCCAGCCTGTATGCGCAAATCAAGCACGGGCTGTTTGAGTACTCCTTCTACCCCATGCGGCAC
GAGGGCGTCACGGCCGACGGCTACGTGTCGGGCGACACCATCCACGCCTATCTCAACGACTTTGCCAGCGACTTT
GGCCTGGTGCCGCGACTGCGACTGGGCACCCGCGTCTCCCAAGTGTCGCGCAGGGCGGGGGGCGGCTGGCGGCTC
GAGGTGCAGCACCAGAGGGCCATTGAGTGCGACAAGCTCATCTACGCCTCGGGCGCCACGTCGCACCCCGTCGTG
CCGGCCTGGCCTCGCAGCCCGGGCTTTTCGGCGCCCGTCATACACTCGAGCGAGACGGGCAGCCATCTCGAGGCG
CTGGCAAAGACACCCTCGGCCACCGTGGTGGGCGGAGCCAAGTCGTCCTTTGACAGCGTCTTCCTGCTCCTCAGC
AATGGCACGCGCGTCGACTGGGTCATTCGCGATCACGGCTCGGGCCCCCTGGCCCTCATGCCGCCCACGCTGCTG
GGCGCCGTCAACACCATGGATGTCGTCACAACGCGCTTCGTCGCCCTCATGGGCACCACCATCATGAACACTGAC
GGCGCCGCCCGCCAGTTCCTGCAGCGCACCCTGCTGGGGCGCCTCTTGGCCCATGTCTTTTGGCTCGTGGTCAAC
TGGATTGCCGACCGCCATGCAGGCTACTCCAAGTCGGCCAATGCGAGCAAGCTGCGTCCAGAGCCCCACGGCAAC
GGCATCTACTGGGCCAATGCTGGCCTCGGCGCCGCCAGCGTGCCCGACTTTTGGAAAACGGTCCACGAGGGCCGC
TGCACCATCCATCGCTCCGATATTGCCTCGCTCGGCCACGACAACACCATCCACCTCCAAAACGGCACCAGCTTC
ACCACCGACTACGTCGTCCTCTCCACCGGCTTCGACAAGTCGTTTCACGTCTTCAGCGAGTCTCTGCAGCGCGAG
CTAGCCCTTGTCCACGACGAGTCCCAGGCCGACAAGTCGACGCGTCTCGACACCGCCGCCGACGCCGCCATTGAC
GCTCTCTTGCCCAGTCTCAAGCACACGCCCTTTTCTGGCCGCAGTCTGGAGCGCGAGCACACTGCTGGCGGCCGC
AAGCTGCTCCACGGCCCAAGTAGGCATTTCCGCCGCCTCATTGTGCCCGCTCTGGCCGCTCAGGGCGACCGCTCC
ATTGTCTTTCCGGGCTTTATCCACTCCATATACACTCCCATGGTGTCCGAGGTCCAGGCCCTGTGGGGAGCAGCC
TTTTTGCTTGGCCTGACCGAGATGCCCAGCCAAGAGGCCATGGACGTTGAAGTGGCAGAGTGGAATGCATGGACA
CGCAAGCGCTATGGCGCTCAGGGCCACAAGCACGCCTATGCCATATTTGACTTTCTCGCGTACATCGACCTCCTC
CTCAAGGACCTCGGCATCAACCCATACCGCAAGCAAGGCTGGCTTCGCCACCTCTTCACACCTGCCTACCCCCGC
GAATATCGCGGCATTCTGTCTGAATTCAAAGCCTCGCTTCCCCCCGCCGCCGACGCATCAGCCGCCTGCTCTACC
CCTGAGCTGGGTGCCTCGACCCCCGTGTCCTTGGCCAGCACGCCCCTGCCCGCCACGCCTCGCAACGAGACGCTT
GTGCCCCTTGCCAATCTAGATAATCAAGACGAGTCTTGCAGCCCAAGTCGCCTTGTGGTCAAGGACCTCGACCTG
TCGAGAATTGTCGCTTAA
Gene >OphauB2|3701
ATGGTGTCGAGGGCAGAAAAAGTCGACGTGGTGGTTGTGGGCGCAGGTAGCTGGACAGACACCCAGTCCCTCGGC
TCGTGAGGCTAACAAGGGCAGGATGGAACGGGCTCATCTCGGCAAAGACCTATCTGGAGCTGCAGCCGTCGGCCA
ATGTCATCATTGTCGACGAGCAGGCGTCCATTGGCGGGGTATGGAGCAGAGAAAAGATATACCCCAGCCTGTATG
CGCAAATCAAGCACGGGCTGTTTGAGTACTCCTTCTACCCCATGCGGCACGAGGGCGTCACGGCCGACGGCTACG
TGTCGGGCGACACCATCCACGCCTATCTCAACGACTTTGCCAGCGACTTTGGCCTGGTGCCGCGACTGCGACTGG
GCACCCGCGTCTCCCAAGTGTCGCGCAGGGCGGGGGGCGGCTGGCGGCTCGAGGTGCAGCACCAGAGGGCCATTG
AGTGCGACAAGCTCATCTACGCCTCGGGCGCCACGTCGCACCCCGTCGTGCCGGCCTGGCCTCGCAGCCCGGGCT
TTTCGGCGCCCGTCATACACTCGAGCGAGACGGGCAGCCATCTCGAGGCGCTGGCAAAGACACCCTCGGCCACCG
TGGTGGGCGGAGCCAAGTCGTCCTTTGACAGCGTCTTCCTGCTCCTCAGCAATGGCACGCGCGTCGACTGGGTCA
TTCGCGATCACGGCTCGGGCCCCCTGGCCCTCATGCCGCCCACGCTGCTGGGCGCCGTCAACACCATGGATGTCG
TCACAACGCGCTTCGTCGCCCTCATGGGCACCACCATCATGAACACTGACGGCGCCGCCCGCCAGTTCCTGCAGC
GCACCCTGCTGGGGCGCCTCTTGGCCCATGTCTTTTGGCTCGTGGTCAACTGGATTGCCGACCGCCATGCAGGCT
ACTCCAAGTCGGCCAATGCGAGCAAGCTGCGTCCAGAGCCCCACGGCAACGGGTATGCTGTAGACAACACTCCTC
CTCCCCTCCCTCTGGCCGCTGACGCCTCGTGTCCAGCATCTACTGGGCCAATGCTGGCCTCGGCGCCGCCAGCGT
GCCCGACTTTTGGAAAACGGTCCACGAGGGCCGCTGCACCATCCATCGCTCCGATATTGCCTCGCTCGGCCACGA
CAACACCATCCACCTCCAAAACGGCACCAGCTTCACCACCGACTACGTCGTCCTCTCCACCGGCTTCGACAAGTC
GTTTCACGTCTTCAGCGAGTCTCTGCAGCGCGAGCTAGCCCTTGTCCACGACGAGTCCCAGGCCGACAAGTCGAC
GCGTCTCGACACCGCCGCCGACGCCGCCATTGACGCTCTCTTGCCCAGTCTCAAGCACACGCCCTTTTCTGGCCG
CAGTCTGGAGCGCGAGCACACTGCTGGCGGCCGCAAGCTGCTCCACGGCCCAAGTAGGCATTTCCGCCGCCTCAT
TGTGCCCGCTCTGGCCGCTCAGGGCGACCGCTCCATTGTCTTTCCGGGCTTTATCCACTCCATATACACTCCCAT
GGTGTCCGAGGTCCAGGCCCTGTGGGGAGCAGCCTTTTTGCTTGGCCTGACCGAGATGCCCAGCCAAGAGGCCAT
GGACGTTGAAGTGGCAGAGTGGAATGCATGGACACGCAAGCGCTATGGCGCTCAGGGCCACAAGCACGCCTATGC
CATATTTGACTTTCTCGCGGTAGGTGCCATTTTCTCTGGTCTCGTTTTTTTTCTCTTTTTTTCTCTCTCTTTTGA
AACGAATAAGAAAGACGATGAAAAGGAAGATGATGGCGGGGGGGAAAAGAGAGAGAAAAGAGAGAGAAAAAGCTA
CATCCACATCAGCTGACCTGCCTGACCCACAAAAGTACATCGACCTCCTCCTCAAGGACCTCGGCATCAACCCAT
ACCGCAAGCAAGGCTGGCTTCGCCACCTCTTCACACCTGCCTACCCCCGCGAATATCGCGGCATTCTGTCTGAAT
TCAAAGCCTCGCTTCCCCCCGCCGCCGACGCATCAGCCGCCTGCTCTACCCCTGAGCTGGGTGCCTCGACCCCCG
TGTCCTTGGCCAGCACGCCCCTGCCCGCCACGCCTCGCAACGAGACGCTTGTGCCCCTTGCCAATCTAGATAATC
AAGACGAGTCTTGCAGCCCAAGTCGCCTTGTGGTCAAGGACCTCGACCTGTCGAGAATTGTCGCTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail