Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3687
Gene name
LocationContig_234:14166..16050
Strand-
Gene length (bp)1884
Transcript length (bp)1884
Coding sequence length (bp)1884
Protein length (aa) 628

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12796 Ank_2 Ankyrin repeats (3 copies) 7.8E-08 235 325
PF00023 Ank Ankyrin repeat 3.4E-02 254 283
PF00023 Ank Ankyrin repeat 3.0E-02 287 326
PF13606 Ank_3 Ankyrin repeat 7.6E-04 254 281

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 254 553 1.0E-08
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 79 421 2.0E-07
sp|Q5U312|RAI14_RAT Ankycorbin OS=Rattus norvegicus GN=Rai14 PE=1 SV=2 188 424 3.0E-07
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 79 421 6.0E-07
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 79 421 1.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 254 553 1.0E-08
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 79 421 2.0E-07
sp|Q5U312|RAI14_RAT Ankycorbin OS=Rattus norvegicus GN=Rai14 PE=1 SV=2 188 424 3.0E-07
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 79 421 6.0E-07
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 79 421 1.0E-06
sp|Q5URB8|YR841_MIMIV Putative ankyrin repeat protein R841 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R841 PE=3 SV=1 268 453 2.0E-06
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 105 421 2.0E-06
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 79 421 3.0E-06
sp|Q9XZC0|LCTA_LATTR Alpha-latrocrustotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=2 SV=2 105 412 3.0E-06
sp|Q9J5I9|V012_FOWPN Putative ankyrin repeat protein FPV012 OS=Fowlpox virus (strain NVSL) GN=FPV012 PE=3 SV=1 255 371 3.0E-06
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 254 553 3.0E-06
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 79 421 5.0E-06
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 105 381 6.0E-06
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 105 421 7.0E-06
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 89 381 7.0E-06
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 105 381 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3687
MATQILVNLPIDVKMEIIDWLRCRHDFLHLAQTCRTFATIVLPRLYRFSVTHQGSECIFWAVTHKPAEGTSASLQ
DNRNVLQYAMRNGGDANVIFSLQGKARDTTPLHLAALNRMALIVYDLLKFGAKVNVANITKSDDNGLDDWLSLRF
RRSLKDDIRDALKATKWLPMVFPMVQQQHDIVCLLFAGGAPPHLGISGKRELAKRPQESQAVTIYHFYAAMTHFD
RLQKHHVEMYAALFQKHKEYVDTKIAGAGYAPLHIAVKNGNPTALKKLIKLGANVDVQCTLGRTPLMMAIQECTI
HESVDSRRVMFEIIQFLLDCNANVSHTSHRVQETPLICVMEEPITYWSSAQCQCLVTIIDLLVEYGADLNQRSFG
GKTLLHHVCLQLFHAKHTGGLKKILTHIMKKGADINMPLRGGMTMLRYCISNFMSVSPSHLRLMCQLGADIGEHE
VEGVLAEWIDCRKMRHETQVSKVLKHHAEHISDSAAYEAYQKAFDQANVDLVGQLTAILPSPADASELVAIALSK
PNLELLNMAVPLPFDANYTWKNGKSYLHIIVDKLTNEKLYKEDQAIDEATFFVKEGTSLAIKDKNGMDAIQMANK
KRERHPMFVCMLYEARDKQRGIAGEEA*
Coding >OphauB2|3687
ATGGCGACTCAAATCCTCGTCAACCTTCCTATTGACGTCAAGATGGAAATCATAGACTGGCTTCGCTGCCGCCAC
GATTTCCTTCACCTCGCTCAAACGTGCCGCACCTTCGCTACCATTGTCCTACCGCGTCTATACAGGTTCAGCGTC
ACTCACCAAGGCTCAGAGTGCATCTTTTGGGCAGTGACCCATAAACCCGCCGAGGGCACCTCCGCCAGCCTTCAA
GATAACCGCAACGTGCTCCAATACGCTATGCGCAACGGAGGCGATGCCAACGTCATATTTTCTCTCCAGGGCAAA
GCAAGAGACACCACTCCTCTGCACCTAGCCGCCTTGAATCGCATGGCACTCATTGTCTATGATCTTTTGAAGTTT
GGAGCCAAGGTCAACGTTGCGAACATTACGAAGAGCGATGACAATGGTTTGGATGACTGGTTGTCTCTGCGCTTC
CGTCGTTCTCTCAAAGATGACATCCGCGACGCCCTTAAGGCCACCAAGTGGCTGCCCATGGTGTTTCCCATGGTC
CAACAGCAGCATGATATTGTCTGCCTGCTATTTGCGGGCGGAGCACCACCCCACTTGGGAATTTCGGGCAAAAGA
GAACTGGCCAAGCGGCCGCAGGAATCTCAAGCTGTCACCATTTACCATTTCTACGCAGCCATGACGCATTTTGAT
CGTCTTCAAAAACATCACGTCGAAATGTACGCGGCGCTCTTTCAGAAACATAAGGAATATGTAGACACCAAGATC
GCAGGCGCTGGATACGCACCGCTGCACATTGCTGTCAAAAACGGCAACCCGACAGCACTGAAAAAACTCATTAAG
TTAGGCGCAAACGTCGACGTGCAGTGTACTCTGGGACGCACGCCTCTCATGATGGCCATTCAAGAGTGCACGATC
CACGAATCAGTTGACAGCCGCCGAGTCATGTTCGAAATTATTCAGTTCTTGCTGGACTGCAACGCCAATGTTAGC
CACACCTCGCACAGGGTCCAGGAAACACCTCTCATCTGCGTCATGGAGGAACCTATTACGTACTGGTCCTCAGCT
CAATGTCAATGCCTGGTAACCATCATCGATCTTCTAGTAGAGTACGGAGCCGACCTTAACCAGCGGAGTTTTGGC
GGAAAAACTCTGCTTCACCATGTGTGCCTCCAACTCTTTCACGCTAAACATACCGGGGGTCTCAAGAAGATTCTA
ACCCACATCATGAAAAAGGGCGCCGACATCAACATGCCTTTGCGTGGCGGCATGACAATGTTACGCTATTGCATA
TCCAACTTTATGTCAGTGTCTCCTAGTCATCTTCGGCTCATGTGCCAACTGGGTGCCGATATCGGAGAACATGAA
GTCGAGGGCGTGTTAGCCGAGTGGATAGATTGCCGAAAAATGCGTCACGAGACGCAGGTATCCAAAGTCTTGAAG
CATCATGCTGAGCATATTAGTGACTCCGCCGCCTACGAAGCGTACCAGAAGGCTTTCGATCAGGCCAACGTGGAC
CTTGTTGGTCAACTTACTGCAATTTTGCCATCACCAGCTGACGCGTCGGAGCTCGTTGCAATTGCCTTGTCAAAG
CCAAACCTTGAGCTTTTGAACATGGCAGTTCCACTGCCTTTCGATGCAAACTACACCTGGAAAAACGGCAAGAGC
TACCTGCACATTATTGTGGACAAGTTGACGAATGAAAAGTTGTACAAAGAAGATCAAGCCATTGATGAGGCTACT
TTTTTTGTCAAAGAGGGCACATCGCTTGCCATCAAGGACAAGAATGGCATGGATGCCATACAAATGGCAAACAAA
AAGCGCGAGCGTCACCCAATGTTTGTGTGCATGCTCTACGAGGCTAGAGACAAGCAGCGTGGGATAGCCGGAGAA
GAGGCGTGA
Transcript >OphauB2|3687
ATGGCGACTCAAATCCTCGTCAACCTTCCTATTGACGTCAAGATGGAAATCATAGACTGGCTTCGCTGCCGCCAC
GATTTCCTTCACCTCGCTCAAACGTGCCGCACCTTCGCTACCATTGTCCTACCGCGTCTATACAGGTTCAGCGTC
ACTCACCAAGGCTCAGAGTGCATCTTTTGGGCAGTGACCCATAAACCCGCCGAGGGCACCTCCGCCAGCCTTCAA
GATAACCGCAACGTGCTCCAATACGCTATGCGCAACGGAGGCGATGCCAACGTCATATTTTCTCTCCAGGGCAAA
GCAAGAGACACCACTCCTCTGCACCTAGCCGCCTTGAATCGCATGGCACTCATTGTCTATGATCTTTTGAAGTTT
GGAGCCAAGGTCAACGTTGCGAACATTACGAAGAGCGATGACAATGGTTTGGATGACTGGTTGTCTCTGCGCTTC
CGTCGTTCTCTCAAAGATGACATCCGCGACGCCCTTAAGGCCACCAAGTGGCTGCCCATGGTGTTTCCCATGGTC
CAACAGCAGCATGATATTGTCTGCCTGCTATTTGCGGGCGGAGCACCACCCCACTTGGGAATTTCGGGCAAAAGA
GAACTGGCCAAGCGGCCGCAGGAATCTCAAGCTGTCACCATTTACCATTTCTACGCAGCCATGACGCATTTTGAT
CGTCTTCAAAAACATCACGTCGAAATGTACGCGGCGCTCTTTCAGAAACATAAGGAATATGTAGACACCAAGATC
GCAGGCGCTGGATACGCACCGCTGCACATTGCTGTCAAAAACGGCAACCCGACAGCACTGAAAAAACTCATTAAG
TTAGGCGCAAACGTCGACGTGCAGTGTACTCTGGGACGCACGCCTCTCATGATGGCCATTCAAGAGTGCACGATC
CACGAATCAGTTGACAGCCGCCGAGTCATGTTCGAAATTATTCAGTTCTTGCTGGACTGCAACGCCAATGTTAGC
CACACCTCGCACAGGGTCCAGGAAACACCTCTCATCTGCGTCATGGAGGAACCTATTACGTACTGGTCCTCAGCT
CAATGTCAATGCCTGGTAACCATCATCGATCTTCTAGTAGAGTACGGAGCCGACCTTAACCAGCGGAGTTTTGGC
GGAAAAACTCTGCTTCACCATGTGTGCCTCCAACTCTTTCACGCTAAACATACCGGGGGTCTCAAGAAGATTCTA
ACCCACATCATGAAAAAGGGCGCCGACATCAACATGCCTTTGCGTGGCGGCATGACAATGTTACGCTATTGCATA
TCCAACTTTATGTCAGTGTCTCCTAGTCATCTTCGGCTCATGTGCCAACTGGGTGCCGATATCGGAGAACATGAA
GTCGAGGGCGTGTTAGCCGAGTGGATAGATTGCCGAAAAATGCGTCACGAGACGCAGGTATCCAAAGTCTTGAAG
CATCATGCTGAGCATATTAGTGACTCCGCCGCCTACGAAGCGTACCAGAAGGCTTTCGATCAGGCCAACGTGGAC
CTTGTTGGTCAACTTACTGCAATTTTGCCATCACCAGCTGACGCGTCGGAGCTCGTTGCAATTGCCTTGTCAAAG
CCAAACCTTGAGCTTTTGAACATGGCAGTTCCACTGCCTTTCGATGCAAACTACACCTGGAAAAACGGCAAGAGC
TACCTGCACATTATTGTGGACAAGTTGACGAATGAAAAGTTGTACAAAGAAGATCAAGCCATTGATGAGGCTACT
TTTTTTGTCAAAGAGGGCACATCGCTTGCCATCAAGGACAAGAATGGCATGGATGCCATACAAATGGCAAACAAA
AAGCGCGAGCGTCACCCAATGTTTGTGTGCATGCTCTACGAGGCTAGAGACAAGCAGCGTGGGATAGCCGGAGAA
GAGGCGTGA
Gene >OphauB2|3687
ATGGCGACTCAAATCCTCGTCAACCTTCCTATTGACGTCAAGATGGAAATCATAGACTGGCTTCGCTGCCGCCAC
GATTTCCTTCACCTCGCTCAAACGTGCCGCACCTTCGCTACCATTGTCCTACCGCGTCTATACAGGTTCAGCGTC
ACTCACCAAGGCTCAGAGTGCATCTTTTGGGCAGTGACCCATAAACCCGCCGAGGGCACCTCCGCCAGCCTTCAA
GATAACCGCAACGTGCTCCAATACGCTATGCGCAACGGAGGCGATGCCAACGTCATATTTTCTCTCCAGGGCAAA
GCAAGAGACACCACTCCTCTGCACCTAGCCGCCTTGAATCGCATGGCACTCATTGTCTATGATCTTTTGAAGTTT
GGAGCCAAGGTCAACGTTGCGAACATTACGAAGAGCGATGACAATGGTTTGGATGACTGGTTGTCTCTGCGCTTC
CGTCGTTCTCTCAAAGATGACATCCGCGACGCCCTTAAGGCCACCAAGTGGCTGCCCATGGTGTTTCCCATGGTC
CAACAGCAGCATGATATTGTCTGCCTGCTATTTGCGGGCGGAGCACCACCCCACTTGGGAATTTCGGGCAAAAGA
GAACTGGCCAAGCGGCCGCAGGAATCTCAAGCTGTCACCATTTACCATTTCTACGCAGCCATGACGCATTTTGAT
CGTCTTCAAAAACATCACGTCGAAATGTACGCGGCGCTCTTTCAGAAACATAAGGAATATGTAGACACCAAGATC
GCAGGCGCTGGATACGCACCGCTGCACATTGCTGTCAAAAACGGCAACCCGACAGCACTGAAAAAACTCATTAAG
TTAGGCGCAAACGTCGACGTGCAGTGTACTCTGGGACGCACGCCTCTCATGATGGCCATTCAAGAGTGCACGATC
CACGAATCAGTTGACAGCCGCCGAGTCATGTTCGAAATTATTCAGTTCTTGCTGGACTGCAACGCCAATGTTAGC
CACACCTCGCACAGGGTCCAGGAAACACCTCTCATCTGCGTCATGGAGGAACCTATTACGTACTGGTCCTCAGCT
CAATGTCAATGCCTGGTAACCATCATCGATCTTCTAGTAGAGTACGGAGCCGACCTTAACCAGCGGAGTTTTGGC
GGAAAAACTCTGCTTCACCATGTGTGCCTCCAACTCTTTCACGCTAAACATACCGGGGGTCTCAAGAAGATTCTA
ACCCACATCATGAAAAAGGGCGCCGACATCAACATGCCTTTGCGTGGCGGCATGACAATGTTACGCTATTGCATA
TCCAACTTTATGTCAGTGTCTCCTAGTCATCTTCGGCTCATGTGCCAACTGGGTGCCGATATCGGAGAACATGAA
GTCGAGGGCGTGTTAGCCGAGTGGATAGATTGCCGAAAAATGCGTCACGAGACGCAGGTATCCAAAGTCTTGAAG
CATCATGCTGAGCATATTAGTGACTCCGCCGCCTACGAAGCGTACCAGAAGGCTTTCGATCAGGCCAACGTGGAC
CTTGTTGGTCAACTTACTGCAATTTTGCCATCACCAGCTGACGCGTCGGAGCTCGTTGCAATTGCCTTGTCAAAG
CCAAACCTTGAGCTTTTGAACATGGCAGTTCCACTGCCTTTCGATGCAAACTACACCTGGAAAAACGGCAAGAGC
TACCTGCACATTATTGTGGACAAGTTGACGAATGAAAAGTTGTACAAAGAAGATCAAGCCATTGATGAGGCTACT
TTTTTTGTCAAAGAGGGCACATCGCTTGCCATCAAGGACAAGAATGGCATGGATGCCATACAAATGGCAAACAAA
AAGCGCGAGCGTCACCCAATGTTTGTGTGCATGCTCTACGAGGCTAGAGACAAGCAGCGTGGGATAGCCGGAGAA
GAGGCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail