Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3670
Gene name
LocationContig_232:7515..9090
Strand-
Gene length (bp)1575
Transcript length (bp)1509
Coding sequence length (bp)1509
Protein length (aa) 503

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00899 ThiF ThiF family 4.0E-41 103 355

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P36101|TCD2_YEAST tRNA threonylcarbamoyladenosine dehydratase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TCD2 PE=1 SV=1 14 502 2.0E-108
sp|O13861|TCD_SCHPO tRNA threonylcarbamoyladenosine dehydratase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1A6.10 PE=3 SV=1 20 499 8.0E-98
sp|P38756|TCD1_YEAST tRNA threonylcarbamoyladenosine dehydratase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TCD1 PE=1 SV=1 89 494 2.0E-81
sp|O32037|TCDA_BACSU tRNA threonylcarbamoyladenosine dehydratase OS=Bacillus subtilis (strain 168) GN=tcdA PE=3 SV=3 97 349 6.0E-30
sp|Q57097|TCDA_HAEIN tRNA threonylcarbamoyladenosine dehydratase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=tcdA PE=3 SV=1 102 296 2.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P36101|TCD2_YEAST tRNA threonylcarbamoyladenosine dehydratase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TCD2 PE=1 SV=1 14 502 2.0E-108
sp|O13861|TCD_SCHPO tRNA threonylcarbamoyladenosine dehydratase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1A6.10 PE=3 SV=1 20 499 8.0E-98
sp|P38756|TCD1_YEAST tRNA threonylcarbamoyladenosine dehydratase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TCD1 PE=1 SV=1 89 494 2.0E-81
sp|O32037|TCDA_BACSU tRNA threonylcarbamoyladenosine dehydratase OS=Bacillus subtilis (strain 168) GN=tcdA PE=3 SV=3 97 349 6.0E-30
sp|Q57097|TCDA_HAEIN tRNA threonylcarbamoyladenosine dehydratase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=tcdA PE=3 SV=1 102 296 2.0E-27
sp|Q46927|TCDA_ECOLI tRNA threonylcarbamoyladenosine dehydratase OS=Escherichia coli (strain K12) GN=tcdA PE=1 SV=1 108 291 3.0E-23
sp|P45211|MOEB_HAEIN Molybdopterin-synthase adenylyltransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=moeB PE=3 SV=1 108 241 3.0E-13
sp|P12282|MOEB_ECOLI Molybdopterin-synthase adenylyltransferase OS=Escherichia coli (strain K12) GN=moeB PE=1 SV=1 108 241 2.0E-12
sp|Q7PY41|MOCS3_ANOGA Adenylyltransferase and sulfurtransferase MOCS3 OS=Anopheles gambiae GN=AGAP001737 PE=3 SV=4 108 232 6.0E-12
sp|P51335|MOEB_PORPU Probable molybdopterin-synthase adenylyltransferase OS=Porphyra purpurea GN=moeB PE=3 SV=1 108 243 8.0E-11
sp|P9WMN7|MOEZ_MYCTU Probable adenylyltransferase/sulfurtransferase MoeZ OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=moeZ PE=1 SV=1 108 225 3.0E-10
sp|P9WMN6|MOEZ_MYCTO Probable adenylyltransferase/sulfurtransferase MoeZ OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=moeZ PE=3 SV=1 108 225 3.0E-10
sp|P30138|THIF_ECOLI Sulfur carrier protein ThiS adenylyltransferase OS=Escherichia coli (strain K12) GN=thiF PE=1 SV=2 108 246 2.0E-09
sp|Q17CA7|MOCS3_AEDAE Adenylyltransferase and sulfurtransferase MOCS3 OS=Aedes aegypti GN=AAEL004607 PE=3 SV=1 108 242 2.0E-09
sp|B0W377|MOCS3_CULQU Adenylyltransferase and sulfurtransferase MOCS3 OS=Culex quinquefasciatus GN=CPIJ001621 PE=3 SV=1 108 242 3.0E-09
sp|B4N7R4|MOCS3_DROWI Adenylyltransferase and sulfurtransferase MOCS3 OS=Drosophila willistoni GN=GK18675 PE=3 SV=1 38 232 3.0E-09
sp|B4JBC4|MOCS3_DROGR Adenylyltransferase and sulfurtransferase MOCS3 OS=Drosophila grimshawi GN=GH10959 PE=3 SV=1 16 232 8.0E-09
sp|Q9ZNW0|MOCS3_ARATH Adenylyltransferase and sulfurtransferase MOCS3 OS=Arabidopsis thaliana GN=MOCS3 PE=2 SV=1 108 232 1.0E-08
sp|B4KI53|MOCS3_DROMO Adenylyltransferase and sulfurtransferase MOCS3 OS=Drosophila mojavensis GN=GI10453 PE=3 SV=1 112 232 2.0E-08
sp|O42939|UBA2_SCHPO Ubiquitin-activating enzyme E1-like OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=uba2 PE=1 SV=1 108 246 6.0E-08
sp|B4LRB9|MOCS3_DROVI Adenylyltransferase and sulfurtransferase MOCS3 OS=Drosophila virilis GN=GJ21670 PE=3 SV=1 60 232 1.0E-07
sp|A4RPM5|UBA4_MAGO7 Adenylyltransferase and sulfurtransferase uba4 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=UBA4 PE=3 SV=1 108 242 2.0E-07
sp|Q6B908|MOEB_GRATL Probable molybdopterin-synthase adenylyltransferase OS=Gracilaria tenuistipitata var. liui GN=moeB PE=3 SV=1 109 243 2.0E-07
sp|O23034|UBA5_ARATH Ubiquitin-like modifier-activating enzyme 5 OS=Arabidopsis thaliana GN=At1g05350 PE=3 SV=2 98 232 4.0E-07
sp|Q58E95|MOCS3_XENLA Adenylyltransferase and sulfurtransferase MOCS3 OS=Xenopus laevis GN=mocs3 PE=2 SV=1 108 242 4.0E-07
sp|Q56067|MOEB_SALTY Molybdopterin-synthase adenylyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=moeB PE=3 SV=2 108 241 4.0E-07
sp|Q6FR35|UBA4_CANGA Adenylyltransferase and sulfurtransferase UBA4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=UBA4 PE=3 SV=1 70 260 6.0E-07
sp|A7THV5|UBA4_VANPO Adenylyltransferase and sulfurtransferase UBA4 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=UBA4 PE=3 SV=1 108 246 6.0E-07
sp|B3MLX7|MOCS3_DROAN Adenylyltransferase and sulfurtransferase MOCS3 OS=Drosophila ananassae GN=GF15533 PE=3 SV=1 36 250 6.0E-07
sp|Q9V6U8|UBA3_DROME Nedd8-activating enzyme E1 catalytic subunit OS=Drosophila melanogaster GN=Uba3 PE=1 SV=1 98 197 8.0E-07
sp|P55586|Y4OA_RHISN Uncharacterized protein y4oA OS=Rhizobium sp. (strain NGR234) GN=NGR_a02280 PE=4 SV=1 113 184 9.0E-07
sp|A5DSR2|UBA4_LODEL Adenylyltransferase and sulfurtransferase UBA4 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=UBA4 PE=3 SV=1 112 221 1.0E-06
sp|A2R3H4|UBA4_ASPNC Adenylyltransferase and sulfurtransferase uba4 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=uba4 PE=3 SV=1 40 225 1.0E-06
sp|Q6BHZ2|UBA4_DEBHA Adenylyltransferase and sulfurtransferase UBA4 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=UBA4 PE=3 SV=1 112 220 1.0E-06
sp|B4NXF7|MOCS3_DROYA Adenylyltransferase and sulfurtransferase MOCS3 OS=Drosophila yakuba GN=GE18783 PE=3 SV=1 108 250 2.0E-06
sp|A6ZT19|UBA4_YEAS7 Adenylyltransferase and sulfurtransferase UBA4 OS=Saccharomyces cerevisiae (strain YJM789) GN=UBA4 PE=3 SV=1 112 260 5.0E-06
sp|P38820|UBA4_YEAST Adenylyltransferase and sulfurtransferase UBA4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBA4 PE=1 SV=1 112 260 5.0E-06
sp|B5VK45|UBA4_YEAS6 Adenylyltransferase and sulfurtransferase UBA4 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=UBA4 PE=3 SV=1 112 260 5.0E-06
sp|B3LSM6|UBA4_YEAS1 Adenylyltransferase and sulfurtransferase UBA4 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=UBA4 PE=3 SV=1 112 260 5.0E-06
sp|O31619|THIF_BACSU Sulfur carrier protein ThiS adenylyltransferase OS=Bacillus subtilis (strain 168) GN=thiF PE=3 SV=1 107 226 7.0E-06
sp|B5DS72|MOC31_DROPS Adenylyltransferase and sulfurtransferase MOCS3-1 OS=Drosophila pseudoobscura pseudoobscura GN=GA24966 PE=3 SV=1 108 250 7.0E-06
sp|B4GKQ3|MOCS3_DROPE Adenylyltransferase and sulfurtransferase MOCS3 OS=Drosophila persimilis GN=GL26133 PE=3 SV=1 108 250 7.0E-06
sp|Q8AWD2|MOCS3_DANRE Adenylyltransferase and sulfurtransferase MOCS3 OS=Danio rerio GN=mocs3 PE=2 SV=1 118 242 7.0E-06
sp|Q29PG5|MOC32_DROPS Adenylyltransferase and sulfurtransferase MOCS3-2 OS=Drosophila pseudoobscura pseudoobscura GN=GA12041 PE=3 SV=1 108 250 7.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.5

Transmembrane Domains

Domain # Start End Length
1 15 37 22
2 116 135 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3670
MPSFVADTLQSPRFPLIAAAALSAISTAALIFGYQSLEREERLLELKKSIPSSTGDGQHRQLDSYGGTALSDEDA
RSLALAQRAQAGDFDQDLISEQLARNGVFLTPEGLDKLRKAFVIVVGCGGVGSHATAALARSGVSRIRLIDFDQV
TLSSLNRHAVATLTDVGIPKVHCLHRRLVAIAPWVRFDLQQEKFDETVAARMLGPWQGGGQPDFIIDAIDNIDTK
VELLKYCYKSKLRVISAMGAGCKSDPTRIMVGDIGASTDDRLSRATRRRLKLQGITSGIPVVFSTEQSAEGKAEL
LPLPEDEFQKGAVGDLGVLANFRVRILPVLGTMPAIFGLTAANHVILSISGYPLNYAVAKGRDKMYEGILTYVQS
TEDRLARMFEPDTLGLKTPLTLGDVSFLTEELYHGRSAISGISTRLVLIRWRRPATTSMTVIGEGANVQKCSTVR
LGDLVCMTKEEAMRHEKQIFKAAKALEHVYDEATIKRVDAKLAEAALWEQHR*
Coding >OphauB2|3670
ATGCCCTCATTCGTTGCCGACACGCTGCAAAGTCCGCGATTTCCATTAATCGCAGCCGCAGCTCTCTCGGCCATC
TCTACGGCAGCCCTCATCTTTGGATATCAGAGCCTTGAGCGGGAGGAGAGATTGCTTGAGCTGAAAAAGTCTATT
CCCTCGAGCACGGGAGACGGCCAACATAGGCAACTCGACAGCTACGGCGGCACAGCTCTAAGCGACGAGGATGCG
AGAAGCTTGGCTCTTGCGCAGCGGGCACAGGCGGGCGACTTTGACCAAGATTTGATTTCAGAACAACTGGCGCGC
AATGGCGTTTTTTTGACACCCGAGGGTCTCGACAAGCTTCGCAAGGCCTTTGTCATTGTCGTGGGCTGTGGAGGC
GTAGGCTCGCACGCCACGGCGGCATTGGCCCGTTCCGGAGTCTCTCGGATTCGACTCATCGATTTCGACCAGGTG
ACGCTCAGCTCGCTCAACCGCCATGCTGTGGCCACTCTGACCGACGTGGGCATCCCCAAGGTGCATTGCCTGCAC
CGGCGACTCGTTGCCATAGCGCCTTGGGTCAGGTTTGACCTGCAACAGGAAAAGTTTGACGAGACGGTGGCAGCG
AGGATGCTGGGGCCGTGGCAGGGCGGCGGCCAGCCAGACTTCATCATTGACGCCATTGACAACATTGACACCAAG
GTGGAGCTGCTCAAGTACTGCTACAAGAGCAAGTTGCGCGTCATCAGTGCAATGGGAGCGGGATGTAAGAGTGAT
CCCACTCGCATCATGGTGGGCGACATTGGTGCCAGCACAGACGACCGACTGTCGAGGGCAACGAGACGGAGGCTG
AAGCTGCAAGGCATCACCAGCGGCATTCCTGTTGTGTTTTCCACCGAGCAGTCGGCCGAGGGCAAGGCCGAGCTG
CTGCCGCTGCCAGAGGACGAGTTCCAAAAGGGTGCCGTTGGCGACTTGGGTGTCTTGGCCAATTTTCGCGTCAGA
ATCCTGCCCGTGCTGGGAACCATGCCTGCCATTTTTGGCCTCACGGCAGCAAATCATGTCATTCTCTCCATTTCG
GGCTATCCCCTAAACTACGCAGTGGCTAAAGGTCGGGACAAGATGTACGAGGGCATCCTTACATATGTGCAAAGC
ACCGAGGACCGACTGGCGAGGATGTTTGAGCCGGATACACTCGGCCTCAAGACGCCACTGACTCTGGGCGATGTC
TCCTTCCTAACTGAGGAGCTCTACCATGGTCGCAGTGCCATCAGCGGCATCTCGACCCGGCTGGTGCTTATACGA
TGGCGTAGGCCGGCCACGACGAGCATGACGGTCATTGGTGAGGGTGCCAATGTGCAAAAATGCTCAACGGTGCGC
CTTGGCGACCTGGTGTGTATGACCAAGGAGGAAGCAATGCGCCACGAAAAACAAATCTTCAAGGCAGCAAAGGCG
CTGGAGCATGTTTACGACGAAGCGACGATTAAACGGGTCGATGCAAAGCTTGCCGAAGCAGCTCTCTGGGAGCAG
CACCGGTGA
Transcript >OphauB2|3670
ATGCCCTCATTCGTTGCCGACACGCTGCAAAGTCCGCGATTTCCATTAATCGCAGCCGCAGCTCTCTCGGCCATC
TCTACGGCAGCCCTCATCTTTGGATATCAGAGCCTTGAGCGGGAGGAGAGATTGCTTGAGCTGAAAAAGTCTATT
CCCTCGAGCACGGGAGACGGCCAACATAGGCAACTCGACAGCTACGGCGGCACAGCTCTAAGCGACGAGGATGCG
AGAAGCTTGGCTCTTGCGCAGCGGGCACAGGCGGGCGACTTTGACCAAGATTTGATTTCAGAACAACTGGCGCGC
AATGGCGTTTTTTTGACACCCGAGGGTCTCGACAAGCTTCGCAAGGCCTTTGTCATTGTCGTGGGCTGTGGAGGC
GTAGGCTCGCACGCCACGGCGGCATTGGCCCGTTCCGGAGTCTCTCGGATTCGACTCATCGATTTCGACCAGGTG
ACGCTCAGCTCGCTCAACCGCCATGCTGTGGCCACTCTGACCGACGTGGGCATCCCCAAGGTGCATTGCCTGCAC
CGGCGACTCGTTGCCATAGCGCCTTGGGTCAGGTTTGACCTGCAACAGGAAAAGTTTGACGAGACGGTGGCAGCG
AGGATGCTGGGGCCGTGGCAGGGCGGCGGCCAGCCAGACTTCATCATTGACGCCATTGACAACATTGACACCAAG
GTGGAGCTGCTCAAGTACTGCTACAAGAGCAAGTTGCGCGTCATCAGTGCAATGGGAGCGGGATGTAAGAGTGAT
CCCACTCGCATCATGGTGGGCGACATTGGTGCCAGCACAGACGACCGACTGTCGAGGGCAACGAGACGGAGGCTG
AAGCTGCAAGGCATCACCAGCGGCATTCCTGTTGTGTTTTCCACCGAGCAGTCGGCCGAGGGCAAGGCCGAGCTG
CTGCCGCTGCCAGAGGACGAGTTCCAAAAGGGTGCCGTTGGCGACTTGGGTGTCTTGGCCAATTTTCGCGTCAGA
ATCCTGCCCGTGCTGGGAACCATGCCTGCCATTTTTGGCCTCACGGCAGCAAATCATGTCATTCTCTCCATTTCG
GGCTATCCCCTAAACTACGCAGTGGCTAAAGGTCGGGACAAGATGTACGAGGGCATCCTTACATATGTGCAAAGC
ACCGAGGACCGACTGGCGAGGATGTTTGAGCCGGATACACTCGGCCTCAAGACGCCACTGACTCTGGGCGATGTC
TCCTTCCTAACTGAGGAGCTCTACCATGGTCGCAGTGCCATCAGCGGCATCTCGACCCGGCTGGTGCTTATACGA
TGGCGTAGGCCGGCCACGACGAGCATGACGGTCATTGGTGAGGGTGCCAATGTGCAAAAATGCTCAACGGTGCGC
CTTGGCGACCTGGTGTGTATGACCAAGGAGGAAGCAATGCGCCACGAAAAACAAATCTTCAAGGCAGCAAAGGCG
CTGGAGCATGTTTACGACGAAGCGACGATTAAACGGGTCGATGCAAAGCTTGCCGAAGCAGCTCTCTGGGAGCAG
CACCGGTGA
Gene >OphauB2|3670
ATGCCCTCATTCGTTGCCGACACGCTGCAAAGTCCGCGATTTCCATTAATCGCAGCCGCAGCTCTCTCGGCCATC
TCTACGGCAGCCCTCATCTTTGGATATCAGAGCCTTGAGCGGGAGGAGAGATTGCTTGAGCTGAAAAAGTCTATT
CCCTCGAGCACGGGAGACGGCCAACATGTGAGACTAGCTCTCTACTCGGGACCTGCAGGCATTGGAATAACAAGA
TATACCAATTGTATATAGAGGCAACTCGACAGCTACGGCGGCACAGCTCTAAGCGACGAGGATGCGAGAAGCTTG
GCTCTTGCGCAGCGGGCACAGGCGGGCGACTTTGACCAAGATTTGATTTCAGAACAACTGGCGCGCAATGGCGTT
TTTTTGACACCCGAGGGTCTCGACAAGCTTCGCAAGGCCTTTGTCATTGTCGTGGGCTGTGGAGGCGTAGGCTCG
CACGCCACGGCGGCATTGGCCCGTTCCGGAGTCTCTCGGATTCGACTCATCGATTTCGACCAGGTGACGCTCAGC
TCGCTCAACCGCCATGCTGTGGCCACTCTGACCGACGTGGGCATCCCCAAGGTGCATTGCCTGCACCGGCGACTC
GTTGCCATAGCGCCTTGGGTCAGGTTTGACCTGCAACAGGAAAAGTTTGACGAGACGGTGGCAGCGAGGATGCTG
GGGCCGTGGCAGGGCGGCGGCCAGCCAGACTTCATCATTGACGCCATTGACAACATTGACACCAAGGTGGAGCTG
CTCAAGTACTGCTACAAGAGCAAGTTGCGCGTCATCAGTGCAATGGGAGCGGGATGTAAGAGTGATCCCACTCGC
ATCATGGTGGGCGACATTGGTGCCAGCACAGACGACCGACTGTCGAGGGCAACGAGACGGAGGCTGAAGCTGCAA
GGCATCACCAGCGGCATTCCTGTTGTGTTTTCCACCGAGCAGTCGGCCGAGGGCAAGGCCGAGCTGCTGCCGCTG
CCAGAGGACGAGTTCCAAAAGGGTGCCGTTGGCGACTTGGGTGTCTTGGCCAATTTTCGCGTCAGAATCCTGCCC
GTGCTGGGAACCATGCCTGCCATTTTTGGCCTCACGGCAGCAAATCATGTCATTCTCTCCATTTCGGGCTATCCC
CTAAACTACGCAGTGGCTAAAGGTCGGGACAAGATGTACGAGGGCATCCTTACATATGTGCAAAGCACCGAGGAC
CGACTGGCGAGGATGTTTGAGCCGGATACACTCGGCCTCAAGACGCCACTGACTCTGGGCGATGTCTCCTTCCTA
ACTGAGGAGCTCTACCATGGTCGCAGTGCCATCAGCGGCATCTCGACCCGGCTGGTGCTTATACGATGGCGTAGG
CCGGCCACGACGAGCATGACGGTCATTGGTGAGGGTGCCAATGTGCAAAAATGCTCAACGGTGCGCCTTGGCGAC
CTGGTGTGTATGACCAAGGAGGAAGCAATGCGCCACGAAAAACAAATCTTCAAGGCAGCAAAGGCGCTGGAGCAT
GTTTACGACGAAGCGACGATTAAACGGGTCGATGCAAAGCTTGCCGAAGCAGCTCTCTGGGAGCAGCACCGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail