Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3661
Gene name
LocationContig_231:1075..7640
Strand-
Gene length (bp)6565
Transcript length (bp)6312
Coding sequence length (bp)6312
Protein length (aa) 2104

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00520 Ion_trans Ion transport protein 3.5E-40 321 715
PF00520 Ion_trans Ion transport protein 4.2E-24 754 978
PF00520 Ion_trans Ion transport protein 1.7E-33 1184 1458
PF00520 Ion_trans Ion transport protein 6.7E-23 1509 1757

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14234|CCH1_SCHPO Calcium-channel protein cch1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cch1 PE=3 SV=1 321 1950 0.0E+00
sp|P50077|CCH1_YEAST Calcium-channel protein CCH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCH1 PE=1 SV=1 292 1925 0.0E+00
sp|Q8IZF0|NALCN_HUMAN Sodium leak channel non-selective protein OS=Homo sapiens GN=NALCN PE=1 SV=1 1079 1786 1.0E-52
sp|Q6Q760|NALCN_RAT Sodium leak channel non-selective protein OS=Rattus norvegicus GN=Nalcn PE=1 SV=1 1109 1786 2.0E-52
sp|Q8BXR5|NALCN_MOUSE Sodium leak channel non-selective protein OS=Mus musculus GN=Nalcn PE=1 SV=2 1109 1786 5.0E-52
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14234|CCH1_SCHPO Calcium-channel protein cch1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cch1 PE=3 SV=1 321 1950 0.0E+00
sp|P50077|CCH1_YEAST Calcium-channel protein CCH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCH1 PE=1 SV=1 292 1925 0.0E+00
sp|Q8IZF0|NALCN_HUMAN Sodium leak channel non-selective protein OS=Homo sapiens GN=NALCN PE=1 SV=1 1079 1786 1.0E-52
sp|Q6Q760|NALCN_RAT Sodium leak channel non-selective protein OS=Rattus norvegicus GN=Nalcn PE=1 SV=1 1109 1786 2.0E-52
sp|Q8BXR5|NALCN_MOUSE Sodium leak channel non-selective protein OS=Mus musculus GN=Nalcn PE=1 SV=2 1109 1786 5.0E-52
sp|P91645|CAC1A_DROME Voltage-dependent calcium channel type A subunit alpha-1 OS=Drosophila melanogaster GN=cac PE=1 SV=3 1138 1786 8.0E-41
sp|C9D7C2|CAC1A_APIME Voltage-dependent calcium channel type A subunit alpha-1 OS=Apis mellifera GN=CAC PE=2 SV=1 1138 1786 9.0E-41
sp|Q9R053|SCNBA_MOUSE Sodium channel protein type 11 subunit alpha OS=Mus musculus GN=Scn11a PE=2 SV=2 771 1786 2.0E-39
sp|Q00975|CAC1B_HUMAN Voltage-dependent N-type calcium channel subunit alpha-1B OS=Homo sapiens GN=CACNA1B PE=1 SV=1 1138 1799 4.0E-39
sp|O08562|SCN9A_RAT Sodium channel protein type 9 subunit alpha OS=Rattus norvegicus GN=Scn9a PE=1 SV=1 1218 1786 1.0E-38
sp|Q15858|SCN9A_HUMAN Sodium channel protein type 9 subunit alpha OS=Homo sapiens GN=SCN9A PE=1 SV=3 1218 1786 1.0E-38
sp|Q28644|SCN9A_RABIT Sodium channel protein type 9 subunit alpha OS=Oryctolagus cuniculus GN=SCN9A PE=2 SV=1 1218 1786 3.0E-38
sp|O55017|CAC1B_MOUSE Voltage-dependent N-type calcium channel subunit alpha-1B OS=Mus musculus GN=Cacna1b PE=1 SV=1 1117 1799 6.0E-38
sp|Q05152|CAC1B_RABIT Voltage-dependent N-type calcium channel subunit alpha-1B OS=Oryctolagus cuniculus GN=CACNA1B PE=1 SV=1 1138 1799 1.0E-37
sp|Q62205|SCN9A_MOUSE Sodium channel protein type 9 subunit alpha OS=Mus musculus GN=Scn9a PE=1 SV=2 1218 1786 2.0E-37
sp|Q02294|CAC1B_RAT Voltage-dependent N-type calcium channel subunit alpha-1B OS=Rattus norvegicus GN=Cacna1b PE=1 SV=1 1117 1799 3.0E-37
sp|Q9W0Y8|SCN60_DROME Sodium channel protein 60E OS=Drosophila melanogaster GN=NaCP60E PE=2 SV=5 1187 1786 4.0E-37
sp|Q9EQ60|CAC1H_RAT Voltage-dependent T-type calcium channel subunit alpha-1H OS=Rattus norvegicus GN=Cacna1h PE=2 SV=2 1138 1697 4.0E-36
sp|O88427|CAC1H_MOUSE Voltage-dependent T-type calcium channel subunit alpha-1H OS=Mus musculus GN=Cacna1h PE=1 SV=3 1138 1697 1.0E-35
sp|Q14524|SCN5A_HUMAN Sodium channel protein type 5 subunit alpha OS=Homo sapiens GN=SCN5A PE=1 SV=2 1170 1809 2.0E-35
sp|P08104|SCN3A_RAT Sodium channel protein type 3 subunit alpha OS=Rattus norvegicus GN=Scn3a PE=1 SV=1 1175 1786 4.0E-35
sp|Q9JJV9|SCN5A_MOUSE Sodium channel protein type 5 subunit alpha OS=Mus musculus GN=Scn5a PE=1 SV=2 1170 1809 4.0E-35
sp|P15389|SCN5A_RAT Sodium channel protein type 5 subunit alpha OS=Rattus norvegicus GN=Scn5a PE=1 SV=1 1170 1809 5.0E-35
sp|P35500|SCNA_DROME Sodium channel protein para OS=Drosophila melanogaster GN=para PE=2 SV=3 1218 1809 6.0E-35
sp|O57483|CAC1S_LITCT Voltage-dependent L-type calcium channel subunit alpha-1S OS=Lithobates catesbeiana PE=2 SV=1 1138 1787 1.0E-34
sp|Q02343|CAC1E_RABIT Voltage-dependent R-type calcium channel subunit alpha-1E OS=Oryctolagus cuniculus GN=CACNA1E PE=2 SV=1 1042 1786 3.0E-34
sp|P15381|CAC1C_RABIT Voltage-dependent L-type calcium channel subunit alpha-1C OS=Oryctolagus cuniculus GN=CACNA1C PE=1 SV=1 1138 1786 5.0E-34
sp|P56699|CAC1E_DIPOM Probable voltage-dependent R-type calcium channel subunit alpha-1E OS=Diplobatis ommata PE=2 SV=1 1138 1786 6.0E-34
sp|Q01815|CAC1C_MOUSE Voltage-dependent L-type calcium channel subunit alpha-1C OS=Mus musculus GN=Cacna1c PE=1 SV=1 1138 1786 9.0E-34
sp|Q9NY46|SCN3A_HUMAN Sodium channel protein type 3 subunit alpha OS=Homo sapiens GN=SCN3A PE=1 SV=2 1175 1786 1.0E-33
sp|Q9WTU3|SCN8A_MOUSE Sodium channel protein type 8 subunit alpha OS=Mus musculus GN=Scn8a PE=1 SV=1 1218 1786 1.0E-33
sp|O88420|SCN8A_RAT Sodium channel protein type 8 subunit alpha OS=Rattus norvegicus GN=Scn8a PE=1 SV=1 1218 1786 2.0E-33
sp|Q6QIY3|SCNAA_MOUSE Sodium channel protein type 10 subunit alpha OS=Mus musculus GN=Scn10a PE=1 SV=2 1187 1818 3.0E-33
sp|P56698|CAC1B_DIPOM Probable voltage-dependent N-type calcium channel subunit alpha-1B OS=Diplobatis ommata PE=2 SV=1 1133 1787 3.0E-33
sp|P35498|SCN1A_HUMAN Sodium channel protein type 1 subunit alpha OS=Homo sapiens GN=SCN1A PE=1 SV=2 1218 1798 3.0E-33
sp|P04774|SCN1A_RAT Sodium channel protein type 1 subunit alpha OS=Rattus norvegicus GN=Scn1a PE=1 SV=1 1218 1798 4.0E-33
sp|Q9UQD0|SCN8A_HUMAN Sodium channel protein type 8 subunit alpha OS=Homo sapiens GN=SCN8A PE=1 SV=1 1218 1786 9.0E-33
sp|P0DMA5|SCNAA_ONYTO Sodium channel protein type 10 subunit alpha OS=Onychomys torridus GN=Scn10a PE=1 SV=1 1187 1818 2.0E-32
sp|Q99250|SCN2A_HUMAN Sodium channel protein type 2 subunit alpha OS=Homo sapiens GN=SCN2A PE=1 SV=3 1175 1786 2.0E-32
sp|O54898|CAC1G_RAT Voltage-dependent T-type calcium channel subunit alpha-1G OS=Rattus norvegicus GN=Cacna1g PE=1 SV=2 1140 1748 2.0E-32
sp|P22002|CAC1C_RAT Voltage-dependent L-type calcium channel subunit alpha-1C OS=Rattus norvegicus GN=Cacna1c PE=1 SV=1 1138 1786 4.0E-32
sp|O95180|CAC1H_HUMAN Voltage-dependent T-type calcium channel subunit alpha-1H OS=Homo sapiens GN=CACNA1H PE=1 SV=4 1138 1697 4.0E-32
sp|Q15878|CAC1E_HUMAN Voltage-dependent R-type calcium channel subunit alpha-1E OS=Homo sapiens GN=CACNA1E PE=1 SV=3 1136 1786 4.0E-32
sp|P04775|SCN2A_RAT Sodium channel protein type 2 subunit alpha OS=Rattus norvegicus GN=Scn2a PE=1 SV=1 1175 1786 6.0E-32
sp|P97445|CAC1A_MOUSE Voltage-dependent P/Q-type calcium channel subunit alpha-1A OS=Mus musculus GN=Cacna1a PE=1 SV=2 1133 1786 8.0E-32
sp|O88457|SCNBA_RAT Sodium channel protein type 11 subunit alpha OS=Rattus norvegicus GN=Scn11a PE=1 SV=1 1219 1790 1.0E-31
sp|Q61290|CAC1E_MOUSE Voltage-dependent R-type calcium channel subunit alpha-1E OS=Mus musculus GN=Cacna1e PE=1 SV=1 1136 1786 1.0E-31
sp|Q07652|CAC1E_RAT Voltage-dependent R-type calcium channel subunit alpha-1E OS=Rattus norvegicus GN=Cacna1e PE=1 SV=1 1136 1786 5.0E-31
sp|O46669|SCNAA_CANLF Sodium channel protein type 10 subunit alpha OS=Canis lupus familiaris GN=SCN10A PE=2 SV=1 1218 1818 7.0E-31
sp|Q9JIS7|CAC1F_MOUSE Voltage-dependent L-type calcium channel subunit alpha-1F OS=Mus musculus GN=Cacna1f PE=1 SV=1 1138 1786 8.0E-31
sp|P27884|CAC1A_RABIT Voltage-dependent P/Q-type calcium channel subunit alpha-1A OS=Oryctolagus cuniculus GN=CACNA1A PE=1 SV=1 1133 1784 8.0E-31
sp|Q25452|CAC1M_MUSDO Muscle calcium channel subunit alpha-1 OS=Musca domestica PE=2 SV=1 1220 1799 9.0E-31
sp|O00555|CAC1A_HUMAN Voltage-dependent P/Q-type calcium channel subunit alpha-1A OS=Homo sapiens GN=CACNA1A PE=1 SV=2 1133 1784 2.0E-30
sp|P54282|CAC1A_RAT Voltage-dependent P/Q-type calcium channel subunit alpha-1A OS=Rattus norvegicus GN=Cacna1a PE=1 SV=1 1133 1799 2.0E-30
sp|O60840|CAC1F_HUMAN Voltage-dependent L-type calcium channel subunit alpha-1F OS=Homo sapiens GN=CACNA1F PE=1 SV=2 1138 1786 4.0E-30
sp|Q24270|CAC1D_DROME Voltage-dependent calcium channel type D subunit alpha-1 OS=Drosophila melanogaster GN=Ca-alpha1D PE=1 SV=2 1220 1799 4.0E-30
sp|Q2XVR5|SC4AA_TETNG Sodium channel protein type 4 subunit alpha A OS=Tetraodon nigroviridis GN=scn4aa PE=3 SV=2 1218 1787 5.0E-30
sp|Q13936|CAC1C_HUMAN Voltage-dependent L-type calcium channel subunit alpha-1C OS=Homo sapiens GN=CACNA1C PE=1 SV=4 1220 1786 6.0E-30
sp|P22316|CAC1S_CYPCA Dihydropyridine-sensitive L-type skeletal muscle calcium channel subunit alpha-1 OS=Cyprinus carpio PE=2 SV=1 1138 1787 8.0E-30
sp|Q9UI33|SCNBA_HUMAN Sodium channel protein type 11 subunit alpha OS=Homo sapiens GN=SCN11A PE=1 SV=2 1144 1791 8.0E-30
sp|Q05973|SCN1_HETBL Sodium channel protein 1 brain OS=Heterololigo bleekeri PE=2 SV=1 1187 1798 9.0E-30
sp|Q9P0X4|CAC1I_HUMAN Voltage-dependent T-type calcium channel subunit alpha-1I OS=Homo sapiens GN=CACNA1I PE=1 SV=1 1138 1766 1.0E-29
sp|Q9ER60|SCN4A_MOUSE Sodium channel protein type 4 subunit alpha OS=Mus musculus GN=Scn4a PE=2 SV=1 1218 1786 2.0E-29
sp|P15390|SCN4A_RAT Sodium channel protein type 4 subunit alpha OS=Rattus norvegicus GN=Scn4a PE=1 SV=1 1218 1786 2.0E-29
sp|Q9Y5Y9|SCNAA_HUMAN Sodium channel protein type 10 subunit alpha OS=Homo sapiens GN=SCN10A PE=1 SV=2 1187 1818 2.0E-29
sp|Q62968|SCNAA_RAT Sodium channel protein type 10 subunit alpha OS=Rattus norvegicus GN=Scn10a PE=1 SV=1 1187 1818 3.0E-29
sp|Q25452|CAC1M_MUSDO Muscle calcium channel subunit alpha-1 OS=Musca domestica PE=2 SV=1 1106 1697 5.0E-29
sp|Q9Z0Y8|CAC1I_RAT Voltage-dependent T-type calcium channel subunit alpha-1I OS=Rattus norvegicus GN=Cacna1i PE=1 SV=3 1138 1766 5.0E-29
sp|P27732|CAC1D_RAT Voltage-dependent L-type calcium channel subunit alpha-1D OS=Rattus norvegicus GN=Cacna1d PE=1 SV=2 1126 1786 2.0E-28
sp|Q20JQ7|SC4AB_DANRE Sodium channel protein type 4 subunit alpha B OS=Danio rerio GN=scn4ab PE=2 SV=1 1218 1809 5.0E-28
sp|Q99246|CAC1D_MOUSE Voltage-dependent L-type calcium channel subunit alpha-1D OS=Mus musculus GN=Cacna1d PE=1 SV=3 1126 1786 5.0E-28
sp|Q2XVR6|SC4AB_TAKRU Sodium channel protein type 4 subunit alpha B OS=Takifugu rubripes GN=scn4ab PE=3 SV=1 1187 1842 5.0E-28
sp|Q01668|CAC1D_HUMAN Voltage-dependent L-type calcium channel subunit alpha-1D OS=Homo sapiens GN=CACNA1D PE=1 SV=2 1126 1786 6.0E-28
sp|Q02485|CAC1S_RAT Voltage-dependent L-type calcium channel subunit alpha-1S (Fragment) OS=Rattus norvegicus GN=Cacna1s PE=1 SV=1 1138 1787 8.0E-28
sp|Q24270|CAC1D_DROME Voltage-dependent calcium channel type D subunit alpha-1 OS=Drosophila melanogaster GN=Ca-alpha1D PE=1 SV=2 1123 1751 2.0E-27
sp|O73700|CAC1D_CHICK Voltage-dependent L-type calcium channel subunit alpha-1D OS=Gallus gallus GN=CACNA1D PE=2 SV=1 1138 1786 2.0E-27
sp|Q02789|CAC1S_MOUSE Voltage-dependent L-type calcium channel subunit alpha-1S OS=Mus musculus GN=Cacna1s PE=1 SV=2 1138 1787 2.0E-27
sp|P02719|SCNA_ELEEL Sodium channel protein OS=Electrophorus electricus PE=2 SV=1 1218 1809 4.0E-27
sp|P35499|SCN4A_HUMAN Sodium channel protein type 4 subunit alpha OS=Homo sapiens GN=SCN4A PE=1 SV=4 1218 1794 6.0E-27
sp|P07293|CAC1S_RABIT Voltage-dependent L-type calcium channel subunit alpha-1S OS=Oryctolagus cuniculus GN=CACNA1S PE=1 SV=1 1138 1787 3.0E-26
sp|Q2XVR7|SC4AA_TAKRU Sodium channel protein type 4 subunit alpha A OS=Takifugu rubripes GN=scn4aa PE=3 SV=1 1218 1786 4.0E-26
sp|Q2XVR4|SC4AB_TETNG Sodium channel protein type 4 subunit alpha B OS=Tetraodon nigroviridis GN=scn4ab PE=3 SV=1 1187 1842 5.0E-26
sp|Q99244|CAC1D_MESAU Voltage-dependent L-type calcium channel subunit alpha-1D OS=Mesocricetus auratus GN=CACNA1D PE=2 SV=2 1218 1786 3.0E-25
sp|Q2XVR3|SC4AA_DANRE Sodium channel protein type 4 subunit alpha A OS=Danio rerio GN=scn4aa PE=2 SV=2 1218 1789 4.0E-25
sp|Q13936|CAC1C_HUMAN Voltage-dependent L-type calcium channel subunit alpha-1C OS=Homo sapiens GN=CACNA1C PE=1 SV=4 1118 1697 8.0E-25
sp|Q28371|SCN4A_HORSE Sodium channel protein type 4 subunit alpha OS=Equus caballus GN=SCN4A PE=1 SV=1 1218 1786 2.0E-24
sp|Q13698|CAC1S_HUMAN Voltage-dependent L-type calcium channel subunit alpha-1S OS=Homo sapiens GN=CACNA1S PE=1 SV=4 1138 1787 2.0E-24
sp|Q13698|CAC1S_HUMAN Voltage-dependent L-type calcium channel subunit alpha-1S OS=Homo sapiens GN=CACNA1S PE=1 SV=4 1122 1695 2.0E-23
sp|P15381|CAC1C_RABIT Voltage-dependent L-type calcium channel subunit alpha-1C OS=Oryctolagus cuniculus GN=CACNA1C PE=1 SV=1 1118 1697 7.0E-23
sp|Q01815|CAC1C_MOUSE Voltage-dependent L-type calcium channel subunit alpha-1C OS=Mus musculus GN=Cacna1c PE=1 SV=1 1118 1697 7.0E-23
sp|Q02789|CAC1S_MOUSE Voltage-dependent L-type calcium channel subunit alpha-1S OS=Mus musculus GN=Cacna1s PE=1 SV=2 1122 1695 4.0E-22
sp|P22002|CAC1C_RAT Voltage-dependent L-type calcium channel subunit alpha-1C OS=Rattus norvegicus GN=Cacna1c PE=1 SV=1 1118 1456 5.0E-22
sp|Q99246|CAC1D_MOUSE Voltage-dependent L-type calcium channel subunit alpha-1D OS=Mus musculus GN=Cacna1d PE=1 SV=3 1123 1751 8.0E-22
sp|P07293|CAC1S_RABIT Voltage-dependent L-type calcium channel subunit alpha-1S OS=Oryctolagus cuniculus GN=CACNA1S PE=1 SV=1 1122 1695 1.0E-21
sp|O43497|CAC1G_HUMAN Voltage-dependent T-type calcium channel subunit alpha-1G OS=Homo sapiens GN=CACNA1G PE=2 SV=3 1140 1454 2.0E-21
sp|O57483|CAC1S_LITCT Voltage-dependent L-type calcium channel subunit alpha-1S OS=Lithobates catesbeiana PE=2 SV=1 1138 1695 4.0E-21
sp|O73700|CAC1D_CHICK Voltage-dependent L-type calcium channel subunit alpha-1D OS=Gallus gallus GN=CACNA1D PE=2 SV=1 1130 1456 6.0E-19
sp|P27732|CAC1D_RAT Voltage-dependent L-type calcium channel subunit alpha-1D OS=Rattus norvegicus GN=Cacna1d PE=1 SV=2 1123 1456 9.0E-19
sp|Q01668|CAC1D_HUMAN Voltage-dependent L-type calcium channel subunit alpha-1D OS=Homo sapiens GN=CACNA1D PE=1 SV=2 1123 1456 2.0E-18
sp|Q99244|CAC1D_MESAU Voltage-dependent L-type calcium channel subunit alpha-1D OS=Mesocricetus auratus GN=CACNA1D PE=2 SV=2 1123 1456 3.0E-18
sp|Q9JJV9|SCN5A_MOUSE Sodium channel protein type 5 subunit alpha OS=Mus musculus GN=Scn5a PE=1 SV=2 478 981 7.0E-18
sp|Q9R053|SCNBA_MOUSE Sodium channel protein type 11 subunit alpha OS=Mus musculus GN=Scn11a PE=2 SV=2 487 981 1.0E-17
sp|P15389|SCN5A_RAT Sodium channel protein type 5 subunit alpha OS=Rattus norvegicus GN=Scn5a PE=1 SV=1 478 981 1.0E-17
sp|Q25452|CAC1M_MUSDO Muscle calcium channel subunit alpha-1 OS=Musca domestica PE=2 SV=1 469 1009 1.0E-17
sp|O60840|CAC1F_HUMAN Voltage-dependent L-type calcium channel subunit alpha-1F OS=Homo sapiens GN=CACNA1F PE=1 SV=2 1116 1456 1.0E-17
sp|Q9WTU3|SCN8A_MOUSE Sodium channel protein type 8 subunit alpha OS=Mus musculus GN=Scn8a PE=1 SV=1 478 981 2.0E-17
sp|O88420|SCN8A_RAT Sodium channel protein type 8 subunit alpha OS=Rattus norvegicus GN=Scn8a PE=1 SV=1 478 981 2.0E-17
sp|O88457|SCNBA_RAT Sodium channel protein type 11 subunit alpha OS=Rattus norvegicus GN=Scn11a PE=1 SV=1 487 981 2.0E-17
sp|Q9UI33|SCNBA_HUMAN Sodium channel protein type 11 subunit alpha OS=Homo sapiens GN=SCN11A PE=1 SV=2 478 981 2.0E-17
sp|Q2XVR4|SC4AB_TETNG Sodium channel protein type 4 subunit alpha B OS=Tetraodon nigroviridis GN=scn4ab PE=3 SV=1 463 933 2.0E-17
sp|Q9UQD0|SCN8A_HUMAN Sodium channel protein type 8 subunit alpha OS=Homo sapiens GN=SCN8A PE=1 SV=1 478 981 3.0E-17
sp|P0DMA5|SCNAA_ONYTO Sodium channel protein type 10 subunit alpha OS=Onychomys torridus GN=Scn10a PE=1 SV=1 503 981 3.0E-17
sp|O43497|CAC1G_HUMAN Voltage-dependent T-type calcium channel subunit alpha-1G OS=Homo sapiens GN=CACNA1G PE=2 SV=3 713 983 3.0E-17
sp|P35500|SCNA_DROME Sodium channel protein para OS=Drosophila melanogaster GN=para PE=2 SV=3 465 981 4.0E-17
sp|Q9JIS7|CAC1F_MOUSE Voltage-dependent L-type calcium channel subunit alpha-1F OS=Mus musculus GN=Cacna1f PE=1 SV=1 1116 1456 5.0E-17
sp|Q14524|SCN5A_HUMAN Sodium channel protein type 5 subunit alpha OS=Homo sapiens GN=SCN5A PE=1 SV=2 478 981 1.0E-16
sp|Q8IZF0|NALCN_HUMAN Sodium leak channel non-selective protein OS=Homo sapiens GN=NALCN PE=1 SV=1 624 988 2.0E-16
sp|Q8BXR5|NALCN_MOUSE Sodium leak channel non-selective protein OS=Mus musculus GN=Nalcn PE=1 SV=2 624 988 2.0E-16
sp|Q6Q760|NALCN_RAT Sodium leak channel non-selective protein OS=Rattus norvegicus GN=Nalcn PE=1 SV=1 624 988 3.0E-16
sp|Q6QIY3|SCNAA_MOUSE Sodium channel protein type 10 subunit alpha OS=Mus musculus GN=Scn10a PE=1 SV=2 506 981 7.0E-16
sp|C9D7C2|CAC1A_APIME Voltage-dependent calcium channel type A subunit alpha-1 OS=Apis mellifera GN=CAC PE=2 SV=1 428 976 2.0E-15
sp|O54898|CAC1G_RAT Voltage-dependent T-type calcium channel subunit alpha-1G OS=Rattus norvegicus GN=Cacna1g PE=1 SV=2 713 985 2.0E-15
sp|Q2XVR5|SC4AA_TETNG Sodium channel protein type 4 subunit alpha A OS=Tetraodon nigroviridis GN=scn4aa PE=3 SV=2 478 981 2.0E-15
sp|Q2XVR4|SC4AB_TETNG Sodium channel protein type 4 subunit alpha B OS=Tetraodon nigroviridis GN=scn4ab PE=3 SV=1 478 981 3.0E-15
sp|Q01118|SCN7A_HUMAN Sodium channel protein type 7 subunit alpha OS=Homo sapiens GN=SCN7A PE=1 SV=2 1218 1786 3.0E-15
sp|P22316|CAC1S_CYPCA Dihydropyridine-sensitive L-type skeletal muscle calcium channel subunit alpha-1 OS=Cyprinus carpio PE=2 SV=1 1122 1476 4.0E-15
sp|Q61290|CAC1E_MOUSE Voltage-dependent R-type calcium channel subunit alpha-1E OS=Mus musculus GN=Cacna1e PE=1 SV=1 1136 1475 5.0E-15
sp|O08562|SCN9A_RAT Sodium channel protein type 9 subunit alpha OS=Rattus norvegicus GN=Scn9a PE=1 SV=1 478 981 6.0E-15
sp|Q9EQ60|CAC1H_RAT Voltage-dependent T-type calcium channel subunit alpha-1H OS=Rattus norvegicus GN=Cacna1h PE=2 SV=2 741 983 6.0E-15
sp|Q2XVR6|SC4AB_TAKRU Sodium channel protein type 4 subunit alpha B OS=Takifugu rubripes GN=scn4ab PE=3 SV=1 478 981 6.0E-15
sp|O57483|CAC1S_LITCT Voltage-dependent L-type calcium channel subunit alpha-1S OS=Lithobates catesbeiana PE=2 SV=1 463 989 7.0E-15
sp|Q02343|CAC1E_RABIT Voltage-dependent R-type calcium channel subunit alpha-1E OS=Oryctolagus cuniculus GN=CACNA1E PE=2 SV=1 1136 1475 1.0E-14
sp|Q15878|CAC1E_HUMAN Voltage-dependent R-type calcium channel subunit alpha-1E OS=Homo sapiens GN=CACNA1E PE=1 SV=3 1136 1475 1.0E-14
sp|Q9Y5Y9|SCNAA_HUMAN Sodium channel protein type 10 subunit alpha OS=Homo sapiens GN=SCN10A PE=1 SV=2 478 981 1.0E-14
sp|Q02485|CAC1S_RAT Voltage-dependent L-type calcium channel subunit alpha-1S (Fragment) OS=Rattus norvegicus GN=Cacna1s PE=1 SV=1 465 976 1.0E-14
sp|P15381|CAC1C_RABIT Voltage-dependent L-type calcium channel subunit alpha-1C OS=Oryctolagus cuniculus GN=CACNA1C PE=1 SV=1 439 976 2.0E-14
sp|P22002|CAC1C_RAT Voltage-dependent L-type calcium channel subunit alpha-1C OS=Rattus norvegicus GN=Cacna1c PE=1 SV=1 439 976 2.0E-14
sp|O95180|CAC1H_HUMAN Voltage-dependent T-type calcium channel subunit alpha-1H OS=Homo sapiens GN=CACNA1H PE=1 SV=4 741 983 2.0E-14
sp|Q07652|CAC1E_RAT Voltage-dependent R-type calcium channel subunit alpha-1E OS=Rattus norvegicus GN=Cacna1e PE=1 SV=1 1136 1475 2.0E-14
sp|C9D7C2|CAC1A_APIME Voltage-dependent calcium channel type A subunit alpha-1 OS=Apis mellifera GN=CAC PE=2 SV=1 1186 1450 3.0E-14
sp|Q62205|SCN9A_MOUSE Sodium channel protein type 9 subunit alpha OS=Mus musculus GN=Scn9a PE=1 SV=2 478 981 3.0E-14
sp|O88427|CAC1H_MOUSE Voltage-dependent T-type calcium channel subunit alpha-1H OS=Mus musculus GN=Cacna1h PE=1 SV=3 741 983 3.0E-14
sp|P56699|CAC1E_DIPOM Probable voltage-dependent R-type calcium channel subunit alpha-1E OS=Diplobatis ommata PE=2 SV=1 469 713 3.0E-14
sp|O46669|SCNAA_CANLF Sodium channel protein type 10 subunit alpha OS=Canis lupus familiaris GN=SCN10A PE=2 SV=1 445 745 4.0E-14
sp|Q02789|CAC1S_MOUSE Voltage-dependent L-type calcium channel subunit alpha-1S OS=Mus musculus GN=Cacna1s PE=1 SV=2 465 976 4.0E-14
sp|Q9NY46|SCN3A_HUMAN Sodium channel protein type 3 subunit alpha OS=Homo sapiens GN=SCN3A PE=1 SV=2 478 981 7.0E-14
sp|P56698|CAC1B_DIPOM Probable voltage-dependent N-type calcium channel subunit alpha-1B OS=Diplobatis ommata PE=2 SV=1 1136 1508 8.0E-14
sp|Q2XVR7|SC4AA_TAKRU Sodium channel protein type 4 subunit alpha A OS=Takifugu rubripes GN=scn4aa PE=3 SV=1 478 981 8.0E-14
sp|P08104|SCN3A_RAT Sodium channel protein type 3 subunit alpha OS=Rattus norvegicus GN=Scn3a PE=1 SV=1 478 981 9.0E-14
sp|Q05973|SCN1_HETBL Sodium channel protein 1 brain OS=Heterololigo bleekeri PE=2 SV=1 467 933 9.0E-14
sp|Q15858|SCN9A_HUMAN Sodium channel protein type 9 subunit alpha OS=Homo sapiens GN=SCN9A PE=1 SV=3 478 981 1.0E-13
sp|Q28644|SCN9A_RABIT Sodium channel protein type 9 subunit alpha OS=Oryctolagus cuniculus GN=SCN9A PE=2 SV=1 478 981 1.0E-13
sp|Q9W0Y8|SCN60_DROME Sodium channel protein 60E OS=Drosophila melanogaster GN=NaCP60E PE=2 SV=5 478 984 1.0E-13
sp|O46669|SCNAA_CANLF Sodium channel protein type 10 subunit alpha OS=Canis lupus familiaris GN=SCN10A PE=2 SV=1 478 981 1.0E-13
sp|Q01815|CAC1C_MOUSE Voltage-dependent L-type calcium channel subunit alpha-1C OS=Mus musculus GN=Cacna1c PE=1 SV=1 465 976 2.0E-13
sp|Q13698|CAC1S_HUMAN Voltage-dependent L-type calcium channel subunit alpha-1S OS=Homo sapiens GN=CACNA1S PE=1 SV=4 465 976 2.0E-13
sp|Q62968|SCNAA_RAT Sodium channel protein type 10 subunit alpha OS=Rattus norvegicus GN=Scn10a PE=1 SV=1 506 981 5.0E-13
sp|Q20JQ7|SC4AB_DANRE Sodium channel protein type 4 subunit alpha B OS=Danio rerio GN=scn4ab PE=2 SV=1 478 981 5.0E-13
sp|P0DMA5|SCNAA_ONYTO Sodium channel protein type 10 subunit alpha OS=Onychomys torridus GN=Scn10a PE=1 SV=1 445 709 9.0E-13
sp|P27732|CAC1D_RAT Voltage-dependent L-type calcium channel subunit alpha-1D OS=Rattus norvegicus GN=Cacna1d PE=1 SV=2 465 976 1.0E-12
sp|Q20JQ7|SC4AB_DANRE Sodium channel protein type 4 subunit alpha B OS=Danio rerio GN=scn4ab PE=2 SV=1 469 708 1.0E-12
sp|Q02789|CAC1S_MOUSE Voltage-dependent L-type calcium channel subunit alpha-1S OS=Mus musculus GN=Cacna1s PE=1 SV=2 507 989 1.0E-12
sp|P07293|CAC1S_RABIT Voltage-dependent L-type calcium channel subunit alpha-1S OS=Oryctolagus cuniculus GN=CACNA1S PE=1 SV=1 469 989 1.0E-12
sp|Q9JJV9|SCN5A_MOUSE Sodium channel protein type 5 subunit alpha OS=Mus musculus GN=Scn5a PE=1 SV=2 1136 1468 2.0E-12
sp|P15389|SCN5A_RAT Sodium channel protein type 5 subunit alpha OS=Rattus norvegicus GN=Scn5a PE=1 SV=1 1136 1468 2.0E-12
sp|O73700|CAC1D_CHICK Voltage-dependent L-type calcium channel subunit alpha-1D OS=Gallus gallus GN=CACNA1D PE=2 SV=1 465 976 2.0E-12
sp|P07293|CAC1S_RABIT Voltage-dependent L-type calcium channel subunit alpha-1S OS=Oryctolagus cuniculus GN=CACNA1S PE=1 SV=1 465 976 2.0E-12
sp|P91645|CAC1A_DROME Voltage-dependent calcium channel type A subunit alpha-1 OS=Drosophila melanogaster GN=cac PE=1 SV=3 465 713 3.0E-12
sp|P56699|CAC1E_DIPOM Probable voltage-dependent R-type calcium channel subunit alpha-1E OS=Diplobatis ommata PE=2 SV=1 1173 1475 3.0E-12
sp|P35499|SCN4A_HUMAN Sodium channel protein type 4 subunit alpha OS=Homo sapiens GN=SCN4A PE=1 SV=4 478 981 3.0E-12
sp|P91645|CAC1A_DROME Voltage-dependent calcium channel type A subunit alpha-1 OS=Drosophila melanogaster GN=cac PE=1 SV=3 438 976 4.0E-12
sp|Q14524|SCN5A_HUMAN Sodium channel protein type 5 subunit alpha OS=Homo sapiens GN=SCN5A PE=1 SV=2 1136 1468 5.0E-12
sp|Q99246|CAC1D_MOUSE Voltage-dependent L-type calcium channel subunit alpha-1D OS=Mus musculus GN=Cacna1d PE=1 SV=3 465 976 5.0E-12
sp|P91645|CAC1A_DROME Voltage-dependent calcium channel type A subunit alpha-1 OS=Drosophila melanogaster GN=cac PE=1 SV=3 1219 1450 7.0E-12
sp|O57483|CAC1S_LITCT Voltage-dependent L-type calcium channel subunit alpha-1S OS=Lithobates catesbeiana PE=2 SV=1 465 976 7.0E-12
sp|Q9Y5Y9|SCNAA_HUMAN Sodium channel protein type 10 subunit alpha OS=Homo sapiens GN=SCN10A PE=1 SV=2 445 709 7.0E-12
sp|Q00975|CAC1B_HUMAN Voltage-dependent N-type calcium channel subunit alpha-1B OS=Homo sapiens GN=CACNA1B PE=1 SV=1 1136 1450 9.0E-12
sp|Q05152|CAC1B_RABIT Voltage-dependent N-type calcium channel subunit alpha-1B OS=Oryctolagus cuniculus GN=CACNA1B PE=1 SV=1 1136 1450 9.0E-12
sp|C9D7C2|CAC1A_APIME Voltage-dependent calcium channel type A subunit alpha-1 OS=Apis mellifera GN=CAC PE=2 SV=1 1157 1767 1.0E-11
sp|Q02294|CAC1B_RAT Voltage-dependent N-type calcium channel subunit alpha-1B OS=Rattus norvegicus GN=Cacna1b PE=1 SV=1 1136 1450 1.0E-11
sp|Q6QIY3|SCNAA_MOUSE Sodium channel protein type 10 subunit alpha OS=Mus musculus GN=Scn10a PE=1 SV=2 749 1015 1.0E-11
sp|P15390|SCN4A_RAT Sodium channel protein type 4 subunit alpha OS=Rattus norvegicus GN=Scn4a PE=1 SV=1 478 981 1.0E-11
sp|Q62968|SCNAA_RAT Sodium channel protein type 10 subunit alpha OS=Rattus norvegicus GN=Scn10a PE=1 SV=1 445 729 1.0E-11
sp|Q01668|CAC1D_HUMAN Voltage-dependent L-type calcium channel subunit alpha-1D OS=Homo sapiens GN=CACNA1D PE=1 SV=2 465 976 1.0E-11
sp|Q28371|SCN4A_HORSE Sodium channel protein type 4 subunit alpha OS=Equus caballus GN=SCN4A PE=1 SV=1 412 981 1.0E-11
sp|O00555|CAC1A_HUMAN Voltage-dependent P/Q-type calcium channel subunit alpha-1A OS=Homo sapiens GN=CACNA1A PE=1 SV=2 1136 1450 2.0E-11
sp|Q05973|SCN1_HETBL Sodium channel protein 1 brain OS=Heterololigo bleekeri PE=2 SV=1 1138 1454 2.0E-11
sp|Q62968|SCNAA_RAT Sodium channel protein type 10 subunit alpha OS=Rattus norvegicus GN=Scn10a PE=1 SV=1 738 1039 2.0E-11
sp|Q2XVR3|SC4AA_DANRE Sodium channel protein type 4 subunit alpha A OS=Danio rerio GN=scn4aa PE=2 SV=2 478 981 2.0E-11
sp|Q9JIS7|CAC1F_MOUSE Voltage-dependent L-type calcium channel subunit alpha-1F OS=Mus musculus GN=Cacna1f PE=1 SV=1 439 976 3.0E-11
sp|P27884|CAC1A_RABIT Voltage-dependent P/Q-type calcium channel subunit alpha-1A OS=Oryctolagus cuniculus GN=CACNA1A PE=1 SV=1 1136 1450 3.0E-11
sp|P97445|CAC1A_MOUSE Voltage-dependent P/Q-type calcium channel subunit alpha-1A OS=Mus musculus GN=Cacna1a PE=1 SV=2 1136 1450 4.0E-11
sp|Q2XVR3|SC4AA_DANRE Sodium channel protein type 4 subunit alpha A OS=Danio rerio GN=scn4aa PE=2 SV=2 438 748 4.0E-11
sp|Q6QIY3|SCNAA_MOUSE Sodium channel protein type 10 subunit alpha OS=Mus musculus GN=Scn10a PE=1 SV=2 463 729 5.0E-11
sp|P54282|CAC1A_RAT Voltage-dependent P/Q-type calcium channel subunit alpha-1A OS=Rattus norvegicus GN=Cacna1a PE=1 SV=1 1136 1450 6.0E-11
sp|Q01815|CAC1C_MOUSE Voltage-dependent L-type calcium channel subunit alpha-1C OS=Mus musculus GN=Cacna1c PE=1 SV=1 469 717 1.0E-10
sp|P0DMA5|SCNAA_ONYTO Sodium channel protein type 10 subunit alpha OS=Onychomys torridus GN=Scn10a PE=1 SV=1 749 1010 1.0E-10
sp|P22002|CAC1C_RAT Voltage-dependent L-type calcium channel subunit alpha-1C OS=Rattus norvegicus GN=Cacna1c PE=1 SV=1 469 717 1.0E-10
sp|Q9UI33|SCNBA_HUMAN Sodium channel protein type 11 subunit alpha OS=Homo sapiens GN=SCN11A PE=1 SV=2 1220 1479 1.0E-10
sp|Q9Z0Y8|CAC1I_RAT Voltage-dependent T-type calcium channel subunit alpha-1I OS=Rattus norvegicus GN=Cacna1i PE=1 SV=3 744 983 1.0E-10
sp|Q62205|SCN9A_MOUSE Sodium channel protein type 9 subunit alpha OS=Mus musculus GN=Scn9a PE=1 SV=2 1138 1480 2.0E-10
sp|P35500|SCNA_DROME Sodium channel protein para OS=Drosophila melanogaster GN=para PE=2 SV=3 1219 1457 2.0E-10
sp|Q9NY46|SCN3A_HUMAN Sodium channel protein type 3 subunit alpha OS=Homo sapiens GN=SCN3A PE=1 SV=2 463 725 2.0E-10
sp|Q25452|CAC1M_MUSDO Muscle calcium channel subunit alpha-1 OS=Musca domestica PE=2 SV=1 469 976 2.0E-10
sp|Q9P0X4|CAC1I_HUMAN Voltage-dependent T-type calcium channel subunit alpha-1I OS=Homo sapiens GN=CACNA1I PE=1 SV=1 744 983 2.0E-10
sp|Q6Q760|NALCN_RAT Sodium leak channel non-selective protein OS=Rattus norvegicus GN=Nalcn PE=1 SV=1 508 984 3.0E-10
sp|Q28644|SCN9A_RABIT Sodium channel protein type 9 subunit alpha OS=Oryctolagus cuniculus GN=SCN9A PE=2 SV=1 1138 1477 3.0E-10
sp|Q61290|CAC1E_MOUSE Voltage-dependent R-type calcium channel subunit alpha-1E OS=Mus musculus GN=Cacna1e PE=1 SV=1 469 976 3.0E-10
sp|Q99244|CAC1D_MESAU Voltage-dependent L-type calcium channel subunit alpha-1D OS=Mesocricetus auratus GN=CACNA1D PE=2 SV=2 465 976 3.0E-10
sp|Q8IZF0|NALCN_HUMAN Sodium leak channel non-selective protein OS=Homo sapiens GN=NALCN PE=1 SV=1 508 984 4.0E-10
sp|Q15858|SCN9A_HUMAN Sodium channel protein type 9 subunit alpha OS=Homo sapiens GN=SCN9A PE=1 SV=3 1138 1477 4.0E-10
sp|Q02343|CAC1E_RABIT Voltage-dependent R-type calcium channel subunit alpha-1E OS=Oryctolagus cuniculus GN=CACNA1E PE=2 SV=1 469 976 4.0E-10
sp|Q15878|CAC1E_HUMAN Voltage-dependent R-type calcium channel subunit alpha-1E OS=Homo sapiens GN=CACNA1E PE=1 SV=3 469 976 4.0E-10
sp|Q2XVR5|SC4AA_TETNG Sodium channel protein type 4 subunit alpha A OS=Tetraodon nigroviridis GN=scn4aa PE=3 SV=2 1177 1456 4.0E-10
sp|Q8BXR5|NALCN_MOUSE Sodium leak channel non-selective protein OS=Mus musculus GN=Nalcn PE=1 SV=2 508 984 5.0E-10
sp|P08104|SCN3A_RAT Sodium channel protein type 3 subunit alpha OS=Rattus norvegicus GN=Scn3a PE=1 SV=1 463 725 5.0E-10
sp|P22316|CAC1S_CYPCA Dihydropyridine-sensitive L-type skeletal muscle calcium channel subunit alpha-1 OS=Cyprinus carpio PE=2 SV=1 443 976 5.0E-10
sp|O43497|CAC1G_HUMAN Voltage-dependent T-type calcium channel subunit alpha-1G OS=Homo sapiens GN=CACNA1G PE=2 SV=3 1491 1755 5.0E-10
sp|O54898|CAC1G_RAT Voltage-dependent T-type calcium channel subunit alpha-1G OS=Rattus norvegicus GN=Cacna1g PE=1 SV=2 1491 1755 6.0E-10
sp|P22316|CAC1S_CYPCA Dihydropyridine-sensitive L-type skeletal muscle calcium channel subunit alpha-1 OS=Cyprinus carpio PE=2 SV=1 772 1117 6.0E-10
sp|Q9Y5Y9|SCNAA_HUMAN Sodium channel protein type 10 subunit alpha OS=Homo sapiens GN=SCN10A PE=1 SV=2 749 1033 6.0E-10
sp|P04775|SCN2A_RAT Sodium channel protein type 2 subunit alpha OS=Rattus norvegicus GN=Scn2a PE=1 SV=1 463 725 7.0E-10
sp|O08562|SCN9A_RAT Sodium channel protein type 9 subunit alpha OS=Rattus norvegicus GN=Scn9a PE=1 SV=1 1138 1480 8.0E-10
sp|Q9Y5Y9|SCNAA_HUMAN Sodium channel protein type 10 subunit alpha OS=Homo sapiens GN=SCN10A PE=1 SV=2 1138 1478 9.0E-10
sp|Q6QIY3|SCNAA_MOUSE Sodium channel protein type 10 subunit alpha OS=Mus musculus GN=Scn10a PE=1 SV=2 1138 1479 1.0E-09
sp|Q07652|CAC1E_RAT Voltage-dependent R-type calcium channel subunit alpha-1E OS=Rattus norvegicus GN=Cacna1e PE=1 SV=1 469 976 1.0E-09
sp|Q05973|SCN1_HETBL Sodium channel protein 1 brain OS=Heterololigo bleekeri PE=2 SV=1 473 984 1.0E-09
sp|P02719|SCNA_ELEEL Sodium channel protein OS=Electrophorus electricus PE=2 SV=1 463 744 1.0E-09
sp|Q02343|CAC1E_RABIT Voltage-dependent R-type calcium channel subunit alpha-1E OS=Oryctolagus cuniculus GN=CACNA1E PE=2 SV=1 777 1018 2.0E-09
sp|Q99250|SCN2A_HUMAN Sodium channel protein type 2 subunit alpha OS=Homo sapiens GN=SCN2A PE=1 SV=3 463 725 2.0E-09
sp|Q24270|CAC1D_DROME Voltage-dependent calcium channel type D subunit alpha-1 OS=Drosophila melanogaster GN=Ca-alpha1D PE=1 SV=2 469 976 2.0E-09
sp|Q2XVR5|SC4AA_TETNG Sodium channel protein type 4 subunit alpha A OS=Tetraodon nigroviridis GN=scn4aa PE=3 SV=2 438 725 2.0E-09
sp|Q9UQD0|SCN8A_HUMAN Sodium channel protein type 8 subunit alpha OS=Homo sapiens GN=SCN8A PE=1 SV=1 469 730 3.0E-09
sp|Q61290|CAC1E_MOUSE Voltage-dependent R-type calcium channel subunit alpha-1E OS=Mus musculus GN=Cacna1e PE=1 SV=1 740 1018 4.0E-09
sp|Q2XVR7|SC4AA_TAKRU Sodium channel protein type 4 subunit alpha A OS=Takifugu rubripes GN=scn4aa PE=3 SV=1 438 708 4.0E-09
sp|O88457|SCNBA_RAT Sodium channel protein type 11 subunit alpha OS=Rattus norvegicus GN=Scn11a PE=1 SV=1 469 744 5.0E-09
sp|Q07652|CAC1E_RAT Voltage-dependent R-type calcium channel subunit alpha-1E OS=Rattus norvegicus GN=Cacna1e PE=1 SV=1 740 1018 7.0E-09
sp|Q62968|SCNAA_RAT Sodium channel protein type 10 subunit alpha OS=Rattus norvegicus GN=Scn10a PE=1 SV=1 1138 1479 7.0E-09
sp|Q15878|CAC1E_HUMAN Voltage-dependent R-type calcium channel subunit alpha-1E OS=Homo sapiens GN=CACNA1E PE=1 SV=3 777 1018 8.0E-09
sp|O73705|CAC1A_CHICK Voltage-dependent P/Q-type calcium channel subunit alpha-1A (Fragment) OS=Gallus gallus GN=CACNA1A PE=2 SV=1 1596 1746 8.0E-09
sp|Q9WTU3|SCN8A_MOUSE Sodium channel protein type 8 subunit alpha OS=Mus musculus GN=Scn8a PE=1 SV=1 469 730 9.0E-09
sp|O88420|SCN8A_RAT Sodium channel protein type 8 subunit alpha OS=Rattus norvegicus GN=Scn8a PE=1 SV=1 469 730 9.0E-09
sp|Q9R053|SCNBA_MOUSE Sodium channel protein type 11 subunit alpha OS=Mus musculus GN=Scn11a PE=2 SV=2 1103 1402 1.0E-08
sp|Q9UQD0|SCN8A_HUMAN Sodium channel protein type 8 subunit alpha OS=Homo sapiens GN=SCN8A PE=1 SV=1 1171 1481 1.0E-08
sp|Q9Z0Y8|CAC1I_RAT Voltage-dependent T-type calcium channel subunit alpha-1I OS=Rattus norvegicus GN=Cacna1i PE=1 SV=3 646 983 1.0E-08
sp|Q14524|SCN5A_HUMAN Sodium channel protein type 5 subunit alpha OS=Homo sapiens GN=SCN5A PE=1 SV=2 464 725 2.0E-08
sp|Q9JJV9|SCN5A_MOUSE Sodium channel protein type 5 subunit alpha OS=Mus musculus GN=Scn5a PE=1 SV=2 464 725 2.0E-08
sp|P15389|SCN5A_RAT Sodium channel protein type 5 subunit alpha OS=Rattus norvegicus GN=Scn5a PE=1 SV=1 464 725 2.0E-08
sp|Q9WTU3|SCN8A_MOUSE Sodium channel protein type 8 subunit alpha OS=Mus musculus GN=Scn8a PE=1 SV=1 1171 1481 3.0E-08
sp|Q00975|CAC1B_HUMAN Voltage-dependent N-type calcium channel subunit alpha-1B OS=Homo sapiens GN=CACNA1B PE=1 SV=1 737 986 4.0E-08
sp|O55017|CAC1B_MOUSE Voltage-dependent N-type calcium channel subunit alpha-1B OS=Mus musculus GN=Cacna1b PE=1 SV=1 737 986 4.0E-08
sp|O88420|SCN8A_RAT Sodium channel protein type 8 subunit alpha OS=Rattus norvegicus GN=Scn8a PE=1 SV=1 1171 1481 4.0E-08
sp|Q2XVR6|SC4AB_TAKRU Sodium channel protein type 4 subunit alpha B OS=Takifugu rubripes GN=scn4ab PE=3 SV=1 463 708 4.0E-08
sp|Q13698|CAC1S_HUMAN Voltage-dependent L-type calcium channel subunit alpha-1S OS=Homo sapiens GN=CACNA1S PE=1 SV=4 741 989 4.0E-08
sp|Q9R053|SCNBA_MOUSE Sodium channel protein type 11 subunit alpha OS=Mus musculus GN=Scn11a PE=2 SV=2 487 744 5.0E-08
sp|Q02294|CAC1B_RAT Voltage-dependent N-type calcium channel subunit alpha-1B OS=Rattus norvegicus GN=Cacna1b PE=1 SV=1 737 986 5.0E-08
sp|P04774|SCN1A_RAT Sodium channel protein type 1 subunit alpha OS=Rattus norvegicus GN=Scn1a PE=1 SV=1 463 725 5.0E-08
sp|O95180|CAC1H_HUMAN Voltage-dependent T-type calcium channel subunit alpha-1H OS=Homo sapiens GN=CACNA1H PE=1 SV=4 1465 1755 5.0E-08
sp|O43497|CAC1G_HUMAN Voltage-dependent T-type calcium channel subunit alpha-1G OS=Homo sapiens GN=CACNA1G PE=2 SV=3 1513 1748 5.0E-08
sp|P35498|SCN1A_HUMAN Sodium channel protein type 1 subunit alpha OS=Homo sapiens GN=SCN1A PE=1 SV=2 463 725 6.0E-08
sp|O54898|CAC1G_RAT Voltage-dependent T-type calcium channel subunit alpha-1G OS=Rattus norvegicus GN=Cacna1g PE=1 SV=2 646 978 6.0E-08
sp|Q9UI33|SCNBA_HUMAN Sodium channel protein type 11 subunit alpha OS=Homo sapiens GN=SCN11A PE=1 SV=2 771 985 6.0E-08
sp|Q2XVR3|SC4AA_DANRE Sodium channel protein type 4 subunit alpha A OS=Danio rerio GN=scn4aa PE=2 SV=2 755 933 7.0E-08
sp|Q05152|CAC1B_RABIT Voltage-dependent N-type calcium channel subunit alpha-1B OS=Oryctolagus cuniculus GN=CACNA1B PE=1 SV=1 776 976 8.0E-08
sp|P27884|CAC1A_RABIT Voltage-dependent P/Q-type calcium channel subunit alpha-1A OS=Oryctolagus cuniculus GN=CACNA1A PE=1 SV=1 701 998 8.0E-08
sp|Q00975|CAC1B_HUMAN Voltage-dependent N-type calcium channel subunit alpha-1B OS=Homo sapiens GN=CACNA1B PE=1 SV=1 776 976 9.0E-08
sp|O08562|SCN9A_RAT Sodium channel protein type 9 subunit alpha OS=Rattus norvegicus GN=Scn9a PE=1 SV=1 469 709 9.0E-08
sp|O88457|SCNBA_RAT Sodium channel protein type 11 subunit alpha OS=Rattus norvegicus GN=Scn11a PE=1 SV=1 1103 1402 9.0E-08
sp|O46669|SCNAA_CANLF Sodium channel protein type 10 subunit alpha OS=Canis lupus familiaris GN=SCN10A PE=2 SV=1 771 998 9.0E-08
sp|Q2XVR3|SC4AA_DANRE Sodium channel protein type 4 subunit alpha A OS=Danio rerio GN=scn4aa PE=2 SV=2 1177 1495 9.0E-08
sp|Q14524|SCN5A_HUMAN Sodium channel protein type 5 subunit alpha OS=Homo sapiens GN=SCN5A PE=1 SV=2 755 935 1.0E-07
sp|P56698|CAC1B_DIPOM Probable voltage-dependent N-type calcium channel subunit alpha-1B OS=Diplobatis ommata PE=2 SV=1 782 986 1.0E-07
sp|P04774|SCN1A_RAT Sodium channel protein type 1 subunit alpha OS=Rattus norvegicus GN=Scn1a PE=1 SV=1 1138 1480 1.0E-07
sp|P0DMA5|SCNAA_ONYTO Sodium channel protein type 10 subunit alpha OS=Onychomys torridus GN=Scn10a PE=1 SV=1 1138 1478 1.0E-07
sp|O60840|CAC1F_HUMAN Voltage-dependent L-type calcium channel subunit alpha-1F OS=Homo sapiens GN=CACNA1F PE=1 SV=2 752 976 1.0E-07
sp|Q9P0X4|CAC1I_HUMAN Voltage-dependent T-type calcium channel subunit alpha-1I OS=Homo sapiens GN=CACNA1I PE=1 SV=1 646 983 1.0E-07
sp|Q2XVR7|SC4AA_TAKRU Sodium channel protein type 4 subunit alpha A OS=Takifugu rubripes GN=scn4aa PE=3 SV=1 755 1029 1.0E-07
sp|Q2XVR7|SC4AA_TAKRU Sodium channel protein type 4 subunit alpha A OS=Takifugu rubripes GN=scn4aa PE=3 SV=1 1177 1456 1.0E-07
sp|O73707|CAC1C_CHICK Voltage-dependent L-type calcium channel subunit alpha-1C (Fragment) OS=Gallus gallus GN=CACNA1C PE=2 SV=1 1584 1746 1.0E-07
sp|O55017|CAC1B_MOUSE Voltage-dependent N-type calcium channel subunit alpha-1B OS=Mus musculus GN=Cacna1b PE=1 SV=1 776 976 2.0E-07
sp|Q05152|CAC1B_RABIT Voltage-dependent N-type calcium channel subunit alpha-1B OS=Oryctolagus cuniculus GN=CACNA1B PE=1 SV=1 754 987 2.0E-07
sp|P15390|SCN4A_RAT Sodium channel protein type 4 subunit alpha OS=Rattus norvegicus GN=Scn4a PE=1 SV=1 469 729 2.0E-07
sp|Q20JQ7|SC4AB_DANRE Sodium channel protein type 4 subunit alpha B OS=Danio rerio GN=scn4ab PE=2 SV=1 1079 1456 2.0E-07
sp|Q02294|CAC1B_RAT Voltage-dependent N-type calcium channel subunit alpha-1B OS=Rattus norvegicus GN=Cacna1b PE=1 SV=1 776 976 3.0E-07
sp|P35499|SCN4A_HUMAN Sodium channel protein type 4 subunit alpha OS=Homo sapiens GN=SCN4A PE=1 SV=4 469 729 3.0E-07
sp|P56699|CAC1E_DIPOM Probable voltage-dependent R-type calcium channel subunit alpha-1E OS=Diplobatis ommata PE=2 SV=1 784 976 4.0E-07
sp|O46669|SCNAA_CANLF Sodium channel protein type 10 subunit alpha OS=Canis lupus familiaris GN=SCN10A PE=2 SV=1 1138 1456 4.0E-07
sp|P04775|SCN2A_RAT Sodium channel protein type 2 subunit alpha OS=Rattus norvegicus GN=Scn2a PE=1 SV=1 1138 1340 5.0E-07
sp|Q9ER60|SCN4A_MOUSE Sodium channel protein type 4 subunit alpha OS=Mus musculus GN=Scn4a PE=2 SV=1 469 729 5.0E-07
sp|Q24270|CAC1D_DROME Voltage-dependent calcium channel type D subunit alpha-1 OS=Drosophila melanogaster GN=Ca-alpha1D PE=1 SV=2 836 994 6.0E-07
sp|P35500|SCNA_DROME Sodium channel protein para OS=Drosophila melanogaster GN=para PE=2 SV=3 471 712 7.0E-07
sp|P35498|SCN1A_HUMAN Sodium channel protein type 1 subunit alpha OS=Homo sapiens GN=SCN1A PE=1 SV=2 1138 1480 9.0E-07
sp|Q15858|SCN9A_HUMAN Sodium channel protein type 9 subunit alpha OS=Homo sapiens GN=SCN9A PE=1 SV=3 469 709 1.0E-06
sp|Q62205|SCN9A_MOUSE Sodium channel protein type 9 subunit alpha OS=Mus musculus GN=Scn9a PE=1 SV=2 469 709 1.0E-06
sp|P08104|SCN3A_RAT Sodium channel protein type 3 subunit alpha OS=Rattus norvegicus GN=Scn3a PE=1 SV=1 1138 1480 1.0E-06
sp|P56699|CAC1E_DIPOM Probable voltage-dependent R-type calcium channel subunit alpha-1E OS=Diplobatis ommata PE=2 SV=1 777 980 1.0E-06
sp|Q9NY46|SCN3A_HUMAN Sodium channel protein type 3 subunit alpha OS=Homo sapiens GN=SCN3A PE=1 SV=2 1138 1480 1.0E-06
sp|O00555|CAC1A_HUMAN Voltage-dependent P/Q-type calcium channel subunit alpha-1A OS=Homo sapiens GN=CACNA1A PE=1 SV=2 701 980 1.0E-06
sp|Q28644|SCN9A_RABIT Sodium channel protein type 9 subunit alpha OS=Oryctolagus cuniculus GN=SCN9A PE=2 SV=1 469 709 2.0E-06
sp|O88427|CAC1H_MOUSE Voltage-dependent T-type calcium channel subunit alpha-1H OS=Mus musculus GN=Cacna1h PE=1 SV=3 1545 1755 2.0E-06
sp|Q9JJV9|SCN5A_MOUSE Sodium channel protein type 5 subunit alpha OS=Mus musculus GN=Scn5a PE=1 SV=2 755 935 2.0E-06
sp|P04774|SCN1A_RAT Sodium channel protein type 1 subunit alpha OS=Rattus norvegicus GN=Scn1a PE=1 SV=1 740 935 2.0E-06
sp|Q99250|SCN2A_HUMAN Sodium channel protein type 2 subunit alpha OS=Homo sapiens GN=SCN2A PE=1 SV=3 1138 1480 2.0E-06
sp|P97445|CAC1A_MOUSE Voltage-dependent P/Q-type calcium channel subunit alpha-1A OS=Mus musculus GN=Cacna1a PE=1 SV=2 701 980 2.0E-06
sp|Q2XVR5|SC4AA_TETNG Sodium channel protein type 4 subunit alpha A OS=Tetraodon nigroviridis GN=scn4aa PE=3 SV=2 755 1029 2.0E-06
sp|Q9ER60|SCN4A_MOUSE Sodium channel protein type 4 subunit alpha OS=Mus musculus GN=Scn4a PE=2 SV=1 755 935 2.0E-06
sp|P35499|SCN4A_HUMAN Sodium channel protein type 4 subunit alpha OS=Homo sapiens GN=SCN4A PE=1 SV=4 755 935 2.0E-06
sp|Q28371|SCN4A_HORSE Sodium channel protein type 4 subunit alpha OS=Equus caballus GN=SCN4A PE=1 SV=1 469 741 2.0E-06
sp|O43497|CAC1G_HUMAN Voltage-dependent T-type calcium channel subunit alpha-1G OS=Homo sapiens GN=CACNA1G PE=2 SV=3 646 978 2.0E-06
sp|Q9EQJ0|TPC1_MOUSE Two pore calcium channel protein 1 OS=Mus musculus GN=Tpcn1 PE=1 SV=1 1177 1455 2.0E-06
sp|O55017|CAC1B_MOUSE Voltage-dependent N-type calcium channel subunit alpha-1B OS=Mus musculus GN=Cacna1b PE=1 SV=1 1187 1453 3.0E-06
sp|Q02294|CAC1B_RAT Voltage-dependent N-type calcium channel subunit alpha-1B OS=Rattus norvegicus GN=Cacna1b PE=1 SV=1 1187 1453 3.0E-06
sp|Q9EQ60|CAC1H_RAT Voltage-dependent T-type calcium channel subunit alpha-1H OS=Rattus norvegicus GN=Cacna1h PE=2 SV=2 1545 1755 3.0E-06
sp|P15389|SCN5A_RAT Sodium channel protein type 5 subunit alpha OS=Rattus norvegicus GN=Scn5a PE=1 SV=1 755 935 3.0E-06
sp|Q2XVR5|SC4AA_TETNG Sodium channel protein type 4 subunit alpha A OS=Tetraodon nigroviridis GN=scn4aa PE=3 SV=2 1187 1455 3.0E-06
sp|Q9P0X4|CAC1I_HUMAN Voltage-dependent T-type calcium channel subunit alpha-1I OS=Homo sapiens GN=CACNA1I PE=1 SV=1 466 708 3.0E-06
sp|P15390|SCN4A_RAT Sodium channel protein type 4 subunit alpha OS=Rattus norvegicus GN=Scn4a PE=1 SV=1 755 935 3.0E-06
sp|Q05152|CAC1B_RABIT Voltage-dependent N-type calcium channel subunit alpha-1B OS=Oryctolagus cuniculus GN=CACNA1B PE=1 SV=1 1187 1472 5.0E-06
sp|O42398|CAC1S_CHICK Voltage-dependent L-type calcium channel subunit alpha-1S (Fragment) OS=Gallus gallus GN=CACNA1S PE=2 SV=1 1548 1697 5.0E-06
sp|Q00975|CAC1B_HUMAN Voltage-dependent N-type calcium channel subunit alpha-1B OS=Homo sapiens GN=CACNA1B PE=1 SV=1 1187 1472 6.0E-06
sp|Q28644|SCN9A_RABIT Sodium channel protein type 9 subunit alpha OS=Oryctolagus cuniculus GN=SCN9A PE=2 SV=1 755 933 6.0E-06
sp|Q15858|SCN9A_HUMAN Sodium channel protein type 9 subunit alpha OS=Homo sapiens GN=SCN9A PE=1 SV=3 755 933 7.0E-06
sp|Q9Z0Y8|CAC1I_RAT Voltage-dependent T-type calcium channel subunit alpha-1I OS=Rattus norvegicus GN=Cacna1i PE=1 SV=3 466 708 7.0E-06
sp|Q62205|SCN9A_MOUSE Sodium channel protein type 9 subunit alpha OS=Mus musculus GN=Scn9a PE=1 SV=2 755 933 8.0E-06
sp|P97445|CAC1A_MOUSE Voltage-dependent P/Q-type calcium channel subunit alpha-1A OS=Mus musculus GN=Cacna1a PE=1 SV=2 465 976 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0006811 ion transport Yes
GO:0005216 ion channel activity Yes
GO:0055085 transmembrane transport Yes
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0015075 ion transmembrane transporter activity No
GO:0008150 biological_process No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0015267 channel activity No
GO:0051234 establishment of localization No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0022803 passive transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No
GO:0006810 transport No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.45

Transmembrane Domains

Domain # Start End Length
1 319 341 22
2 367 389 22
3 475 497 22
4 512 531 19
5 538 560 22
6 681 703 22
7 750 768 18
8 778 800 22
9 812 829 17
10 844 866 22
11 873 892 19
12 907 924 17
13 945 967 22
14 1173 1195 22
15 1215 1237 22
16 1252 1271 19
17 1310 1332 22
18 1428 1450 22
19 1509 1526 17
20 1541 1563 22
21 1570 1592 22
22 1629 1651 22
23 1725 1747 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3661
MSSTSPQQALGGSHARRRQSIPLQDLLAPAASNEPGQSRRHDAGSSNAPGISWNSPFSSSVDGAAPGSPIDPTAL
QSALPPDLWQPPARHSLPSASASLDFASPDFASPHGDDSPIHDFSDSDRVPLTSGAQPISGALAADCNGSRPPMS
RSASDMGNSSSPRNTKRLEPAFGFARRRSFGMTLNPHEYHHALSRSSSTSGALHRAGSIVRAMSQRVVNISGESE
ATEQRTSHDASMSHSRPASGHDHDRSPAVSMLIDTTYQPQKFASTEKTPDVDQVHLHPPQFPPAGGLPSNPFRGH
TLGFFSPNSRIRLKLCDLLVHPYTEPILLLLIVLQAILLAIESGPSVFSKGHERPERWGQRPIDWAMLGLFIVFT
LELFARTVVSGFFLNAAEYSTIDRKKGVRTVITEQYRALFQPEQHKWVGGHQQSAPSSQQQSAFTRSFTTIMQGQ
QALPKTVDEQQRYQLARRALLRHSFNRLDFIAVVSYWIDFALGVTGIEHRFHLYVFKMLSCLRILRLLALTNGTA
IILRSLKKAAPLLVRVAFLISFFWLLFAIIGVQSFKSSLSRQCVWLDPQDPGNFTAAYTNEMEFCGGYLDNDTGK
VKPWVKSEEPESLDKLMDGTGNGKGFICPRGSICLQQSSPFNGTVSFDNIFHSLELVFVVMSGNTFSDLMYYTMG
SDYLQAALFFGGGIMIMTLWLTNLLIAVITSSFQVIRDESKSSAFTADAETSAQVTPGQRSQRPLKLQRIYNKTV
PLWVLVITFGLLCQSFRSSVMSESREHFINAAEVVVTLLLDIEILFRLAANPRRFHRSWRNAFDLGLAVVTTIIL
IPQIRQTRAYSWLTAFQIVRVYRIVMAVPLTRKLILLVLGNSSGIANLMLFVFLMTFLVAILASQLFRGELEMED
NGEFRRISFFSIFNSFLGMYQILSSENWTEILYSVTAKTKHYHTAWIGAVFLIGWFILSFFILVNMFVAVIQENF
DVSEDEKRLEQVRAFLQRKELGHPQSNLSLSTIFSLGRSRRRKDPLDHGPAMAEMLLKDAVVRDFLDDDAAITPQ
ISGRVVPQRSATTLFGPDVKPGFLSTIWGKIVHRISNREPNPFYSNIRFETNDTFDPRQMARQAVLATSTRRKAQ
REYLARHPRYNDALYIFRPKHPLRRFCQRLVGPARGFERFDGVEPNKIAWYALSVLIYAVVVVMVVLACVTTPLY
QKEYREKHPESMWNWYVWTDTAFAAIFTVEAMVKVIADGLIWTPNAYLRSSWGIIDAVVLVTLWINVVTLLINDG
AISRAVGAFKALRALRLLNVSDSARDTFHSLIIDGWWKLLGAAFVSLSLLIPFAIYGLNLFNGLLLTCNDSDGIS
ALSSCFGEYDSSPFKDDWKLLAPRVVSNPYFNFDNFGSSLFTLFQITSQEGWTDVSFAVQSIVGRDEQPEDLAAQ
GNALFFVVFNLMATVFILTLFISVFMRNYTELTGVAFLTTEQRSWMELRKLLRHISPSKSSYKETQKAWKKWCHR
RAIEKRGKWYRAITAFLVLHLLLLVTEFRAEPGWWIITRVMIFLILILIYLANIMIRIIGLGWARFRRSSWDLYA
LVTVSGAFIATVALLSANPNGDTYVQLHKIFLVAILLLLIPRNDALDQLFKTAAASLTVIGNLLATWLVFFLVFA
IAMTQAFSLTRFGGEETNNLNFRSVPKALILLFRMSLGEGWNQIMEDFANIEPPLCVEQDRFFDSDCGSKVWARF
LFVSWNIVSMYIFVNLFVSLMYESFSYVYQRSSNVAVVDRDEIRRFKEAWRSVDPAGTGFISREAFPRLLGELSG
VFQMRIYQPEDSVRQILDHVRSDEPTRRHMSMASASALGDIDIAKLNRRLALLDVAKIRQRRRRFKVFYGEVLVT
ADPVKGIAFSDVLMILAHYNIINDSKSLKLDEFLRRRRRLQRVDDEIRRNVVQGFFHTLYWSRKFQRHMELKRAS
RMSAVPQMSVPEIFVNDDDEAQDEGGNPFKAEDGSLTRWTQLSANEACEPRGRDLAKQQHPLSQPRSCLMRQDTA
TSGFSFELDEADESEQVGPEAELEQEPDLEPEPVTEGPSMGGSASQARHMLDDSAWMESIRRSATLHRTGQGDAH
RYG*
Coding >OphauB2|3661
ATGTCGTCCACCAGCCCGCAGCAGGCTCTGGGCGGCAGCCACGCCCGGCGCCGGCAGTCGATTCCTCTGCAGGAT
CTGCTGGCCCCTGCGGCGAGCAATGAGCCAGGGCAATCACGGCGCCACGACGCGGGCAGCAGCAACGCCCCTGGC
ATCTCGTGGAACTCGCCCTTTTCGTCGTCGGTCGACGGCGCCGCTCCCGGCTCTCCAATTGATCCCACCGCCCTG
CAATCAGCCCTCCCTCCCGATCTCTGGCAGCCGCCCGCCCGCCACAGCTTGCCATCCGCCTCGGCCTCGCTTGAC
TTTGCCTCGCCCGACTTTGCCTCGCCCCACGGCGACGACTCGCCCATCCACGACTTTTCCGACTCGGATCGCGTC
CCCCTCACTTCTGGAGCCCAGCCCATTTCTGGCGCCCTCGCGGCTGATTGCAATGGCTCTCGGCCCCCCATGTCG
CGCTCAGCGTCCGACATGGGCAATAGCAGCAGCCCACGCAACACCAAGCGCCTTGAGCCGGCCTTTGGCTTTGCC
CGTCGCCGAAGCTTTGGCATGACTCTGAATCCCCATGAATATCATCATGCTCTCTCGCGCTCTTCCTCCACGTCG
GGCGCCCTGCATCGTGCTGGCTCCATTGTCCGGGCCATGTCCCAGCGTGTCGTCAATATTAGCGGAGAGAGCGAA
GCAACAGAACAGCGCACTTCTCATGATGCATCCATGTCTCATTCCCGCCCAGCCTCTGGCCATGACCATGATCGG
AGCCCTGCTGTCTCGATGCTTATTGACACTACGTATCAACCCCAAAAGTTCGCCTCGACGGAGAAGACGCCTGAT
GTAGACCAAGTTCACTTGCATCCGCCTCAATTCCCTCCTGCTGGCGGTCTGCCCTCGAATCCTTTCAGAGGACAC
ACGCTTGGCTTCTTTTCTCCAAACAGTCGCATTCGCCTGAAGCTCTGCGATCTTTTGGTGCACCCTTACACTGAA
CCTATTCTTCTCTTGCTCATTGTCCTGCAAGCAATCTTGCTCGCCATTGAATCTGGGCCAAGCGTCTTCAGCAAA
GGCCATGAGCGCCCCGAGAGATGGGGACAGCGGCCTATTGACTGGGCAATGCTGGGCCTCTTCATCGTCTTTACG
CTCGAGCTTTTTGCGCGCACCGTTGTGTCTGGCTTCTTTCTCAATGCCGCTGAATATAGCACTATTGACCGCAAG
AAGGGCGTACGTACCGTCATTACTGAGCAGTATAGAGCCCTGTTCCAGCCCGAGCAGCACAAGTGGGTTGGCGGA
CATCAACAGTCTGCTCCCTCGTCTCAACAGCAGTCGGCCTTTACTCGCTCCTTCACAACCATCATGCAGGGTCAG
CAGGCACTGCCCAAGACTGTTGATGAGCAGCAGAGATATCAACTGGCTCGCCGTGCCCTTTTGCGTCACTCGTTT
AATCGTCTCGACTTTATAGCAGTTGTCTCGTACTGGATTGACTTTGCACTTGGCGTCACGGGAATCGAACACCGC
TTCCATCTTTATGTCTTCAAGATGCTGAGCTGTTTGCGAATCTTGCGGTTGTTGGCTCTGACAAACGGCACCGCT
ATTATCCTCCGAAGCCTGAAAAAGGCGGCTCCCCTGCTTGTTCGCGTTGCCTTTCTCATCAGCTTCTTCTGGTTG
CTCTTTGCCATCATTGGAGTCCAAAGTTTCAAATCCAGCCTCAGTCGCCAGTGCGTCTGGTTGGATCCTCAGGAC
CCGGGCAATTTCACGGCAGCTTACACCAATGAGATGGAGTTTTGCGGAGGCTACTTGGACAACGATACTGGCAAA
GTCAAGCCGTGGGTCAAGTCTGAAGAGCCAGAATCTCTCGACAAGCTAATGGACGGAACGGGCAATGGCAAAGGC
TTCATATGCCCCCGAGGCTCCATCTGTCTGCAGCAAAGCAGCCCATTTAATGGAACGGTCAGCTTTGACAACATC
TTCCACTCCCTCGAGCTCGTCTTTGTTGTCATGAGTGGCAACACCTTTTCAGACCTCATGTATTATACCATGGGG
TCTGACTACTTGCAAGCAGCCCTATTTTTTGGTGGCGGCATCATGATTATGACGCTCTGGTTGACCAATTTGCTA
ATTGCCGTCATTACCTCTTCTTTTCAAGTGATACGCGACGAGAGTAAGTCAAGCGCCTTTACGGCAGATGCTGAG
ACGTCGGCTCAAGTCACACCGGGCCAACGTTCGCAACGACCGTTGAAGCTACAGCGAATCTACAATAAGACGGTG
CCGCTGTGGGTTCTCGTCATCACCTTTGGTCTTCTTTGCCAATCCTTTCGCAGCTCCGTCATGTCAGAGTCTCGC
GAACACTTCATCAATGCGGCAGAAGTCGTTGTAACTCTTTTGCTTGATATTGAGATTCTGTTCAGGCTTGCTGCC
AATCCACGCAGGTTTCACCGCAGCTGGCGCAACGCCTTTGATTTGGGCTTGGCTGTGGTTACGACAATTATTTTG
ATTCCACAGATACGACAGACGCGAGCTTATTCCTGGCTTACTGCCTTTCAAATTGTTCGTGTATACCGCATTGTC
ATGGCTGTTCCATTGACGCGGAAACTCATCCTGCTGGTTCTGGGAAATTCTTCTGGCATTGCAAATCTGATGCTC
TTTGTCTTTCTCATGACGTTTTTGGTGGCAATCCTGGCGTCTCAGTTGTTTCGAGGAGAGCTCGAGATGGAGGAC
AACGGAGAGTTCAGGCGCATCTCATTCTTCTCGATTTTCAACTCCTTTCTCGGCATGTACCAGATTCTTTCAAGT
GAGAACTGGACAGAGATTCTCTACTCAGTCACAGCCAAGACAAAACATTATCACACGGCTTGGATTGGCGCAGTC
TTCCTCATTGGCTGGTTCATCTTGTCCTTTTTCATTCTCGTCAACATGTTCGTGGCTGTTATTCAGGAGAACTTT
GATGTCTCGGAGGATGAGAAGCGTTTGGAACAGGTTCGTGCTTTTCTTCAGCGCAAAGAACTCGGCCACCCACAG
AGCAACCTGTCGCTGTCGACCATTTTCAGTCTAGGCAGATCCCGTCGTCGCAAGGACCCGCTTGACCATGGTCCG
GCCATGGCCGAGATGCTTCTCAAGGACGCCGTGGTTCGTGACTTTCTAGATGACGATGCGGCCATTACGCCGCAA
ATCTCGGGCCGAGTGGTTCCGCAGAGAAGTGCCACGACTCTGTTTGGCCCTGATGTCAAGCCTGGCTTCTTGTCG
ACAATCTGGGGCAAGATTGTACATCGCATCAGCAATCGCGAGCCAAATCCCTTTTACTCAAATATCCGCTTCGAG
ACCAATGACACCTTTGATCCTCGGCAGATGGCGCGGCAGGCGGTATTGGCAACTTCGACTCGGCGCAAGGCCCAA
CGCGAGTATCTTGCCCGTCACCCGCGATATAACGACGCCCTCTACATTTTTCGACCCAAACATCCTCTGCGACGT
TTTTGCCAACGGCTGGTTGGTCCGGCCAGGGGATTCGAGCGATTTGACGGTGTCGAGCCCAACAAGATTGCTTGG
TACGCCTTGTCGGTCCTCATATACGCCGTCGTGGTCGTCATGGTGGTTCTGGCATGTGTCACGACGCCGCTCTAC
CAAAAGGAGTATCGTGAGAAGCATCCTGAAAGCATGTGGAACTGGTATGTGTGGACCGACACAGCCTTTGCAGCC
ATCTTCACTGTCGAGGCCATGGTCAAGGTAATTGCAGACGGTCTCATCTGGACCCCCAATGCATACCTACGTAGC
TCGTGGGGAATCATTGACGCCGTGGTGCTTGTGACTCTCTGGATCAATGTGGTGACGCTTCTCATCAATGACGGC
GCAATATCACGTGCGGTTGGGGCTTTCAAGGCTCTACGGGCTCTTCGTCTACTCAATGTCAGCGACAGTGCACGA
GACACGTTTCATTCACTCATTATTGATGGGTGGTGGAAGTTGCTGGGTGCTGCCTTTGTCTCTCTTTCTCTCTTG
ATTCCCTTTGCCATTTATGGCCTCAACTTATTCAACGGGCTCCTGTTGACATGCAATGACTCGGATGGCATATCT
GCTCTAAGTAGCTGCTTTGGCGAGTACGACAGCAGCCCGTTCAAGGACGATTGGAAGCTTTTGGCCCCCCGAGTG
GTTTCAAACCCTTACTTTAATTTTGACAATTTTGGCTCCTCTCTCTTTACTCTCTTCCAAATTACCAGCCAAGAA
GGATGGACCGACGTGTCCTTTGCCGTTCAGTCTATAGTGGGGCGAGATGAGCAACCCGAAGACTTGGCGGCACAG
GGCAATGCGCTCTTCTTTGTCGTCTTCAACCTCATGGCTACAGTCTTCATTCTGACTCTTTTTATTTCCGTCTTT
ATGCGAAACTACACGGAGCTGACTGGAGTGGCCTTTCTCACAACGGAGCAGCGATCATGGATGGAGTTGCGCAAA
CTGCTACGGCATATTTCTCCCTCCAAGAGCTCATACAAGGAGACACAGAAGGCGTGGAAAAAGTGGTGTCACAGG
AGAGCCATTGAGAAACGAGGAAAATGGTACCGGGCCATTACGGCCTTTCTCGTCTTGCACCTGCTTCTCCTGGTG
ACAGAATTTCGAGCAGAGCCAGGGTGGTGGATCATTACGCGGGTCATGATATTTTTGATACTGATACTCATTTAT
CTGGCCAACATTATGATACGAATCATTGGTTTGGGTTGGGCGCGCTTTCGACGAAGCTCATGGGACCTGTACGCG
CTGGTGACGGTGTCAGGAGCCTTTATTGCGACTGTGGCTCTACTGAGCGCGAATCCAAACGGCGACACATATGTG
CAGCTTCACAAAATCTTTCTCGTGGCCATACTGCTGCTGTTGATTCCTCGCAATGATGCATTGGATCAACTGTTC
AAGACGGCCGCAGCGAGTTTGACAGTCATTGGAAACCTGCTTGCTACTTGGCTGGTATTCTTCCTCGTCTTTGCC
ATCGCCATGACACAGGCATTCAGTTTGACACGCTTTGGTGGTGAGGAAACCAACAATCTCAATTTCCGCAGTGTG
CCCAAGGCGCTCATCTTGCTCTTTCGAATGAGTCTGGGCGAGGGCTGGAACCAAATCATGGAAGACTTTGCCAAC
ATTGAGCCGCCCCTCTGCGTGGAGCAGGACAGGTTTTTCGATAGTGACTGCGGCAGCAAGGTCTGGGCGCGGTTT
CTCTTTGTTTCCTGGAACATTGTCAGCATGTACATTTTTGTCAACCTTTTTGTTTCGCTCATGTACGAGAGTTTT
AGTTATGTCTACCAGCGCTCAAGCAACGTGGCTGTTGTGGATCGGGACGAGATACGGCGCTTCAAAGAGGCATGG
CGAAGCGTGGACCCTGCCGGGACGGGCTTTATCAGCAGGGAGGCGTTTCCGCGTCTGCTCGGAGAGCTGTCGGGA
GTCTTTCAGATGCGCATCTATCAGCCCGAGGACTCGGTCCGACAGATTCTCGACCATGTGCGAAGCGACGAGCCA
ACACGGCGGCACATGTCCATGGCCTCGGCAAGCGCCTTGGGCGACATTGACATTGCCAAGCTCAACCGGCGGCTA
GCTCTGCTCGACGTGGCAAAGATTCGCCAACGGCGGCGGCGCTTCAAGGTTTTTTATGGCGAAGTCTTGGTGACT
GCAGACCCAGTCAAGGGCATCGCCTTTTCCGACGTGCTCATGATTCTGGCGCATTACAACATCATCAATGACAGC
AAGAGTCTCAAGCTGGATGAGTTTCTCAGACGACGCAGACGACTGCAGCGGGTAGACGATGAGATTCGACGCAAC
GTGGTGCAGGGCTTCTTTCATACCCTGTATTGGTCCAGGAAGTTCCAGAGGCACATGGAGCTAAAGCGGGCGTCG
CGAATGTCGGCAGTGCCCCAGATGTCGGTGCCTGAAATCTTTGTCAATGACGATGACGAGGCCCAGGACGAGGGC
GGCAACCCATTCAAAGCCGAGGATGGGTCGTTGACACGATGGACGCAATTAAGTGCAAATGAAGCATGTGAGCCG
AGGGGGCGCGATTTGGCCAAGCAGCAGCACCCATTGAGCCAGCCGCGGTCATGCTTGATGCGACAGGATACTGCA
ACGTCGGGCTTCAGCTTCGAGTTGGACGAAGCAGACGAGTCGGAGCAAGTGGGCCCAGAGGCAGAGCTAGAGCAA
GAGCCAGATCTAGAGCCAGAGCCAGTGACTGAAGGGCCGAGCATGGGCGGCTCTGCATCGCAAGCGCGGCACATG
CTGGACGATTCGGCATGGATGGAGAGCATACGACGCAGCGCGACGCTACACAGGACAGGACAGGGAGACGCGCAT
CGTTATGGCTAA
Transcript >OphauB2|3661
ATGTCGTCCACCAGCCCGCAGCAGGCTCTGGGCGGCAGCCACGCCCGGCGCCGGCAGTCGATTCCTCTGCAGGAT
CTGCTGGCCCCTGCGGCGAGCAATGAGCCAGGGCAATCACGGCGCCACGACGCGGGCAGCAGCAACGCCCCTGGC
ATCTCGTGGAACTCGCCCTTTTCGTCGTCGGTCGACGGCGCCGCTCCCGGCTCTCCAATTGATCCCACCGCCCTG
CAATCAGCCCTCCCTCCCGATCTCTGGCAGCCGCCCGCCCGCCACAGCTTGCCATCCGCCTCGGCCTCGCTTGAC
TTTGCCTCGCCCGACTTTGCCTCGCCCCACGGCGACGACTCGCCCATCCACGACTTTTCCGACTCGGATCGCGTC
CCCCTCACTTCTGGAGCCCAGCCCATTTCTGGCGCCCTCGCGGCTGATTGCAATGGCTCTCGGCCCCCCATGTCG
CGCTCAGCGTCCGACATGGGCAATAGCAGCAGCCCACGCAACACCAAGCGCCTTGAGCCGGCCTTTGGCTTTGCC
CGTCGCCGAAGCTTTGGCATGACTCTGAATCCCCATGAATATCATCATGCTCTCTCGCGCTCTTCCTCCACGTCG
GGCGCCCTGCATCGTGCTGGCTCCATTGTCCGGGCCATGTCCCAGCGTGTCGTCAATATTAGCGGAGAGAGCGAA
GCAACAGAACAGCGCACTTCTCATGATGCATCCATGTCTCATTCCCGCCCAGCCTCTGGCCATGACCATGATCGG
AGCCCTGCTGTCTCGATGCTTATTGACACTACGTATCAACCCCAAAAGTTCGCCTCGACGGAGAAGACGCCTGAT
GTAGACCAAGTTCACTTGCATCCGCCTCAATTCCCTCCTGCTGGCGGTCTGCCCTCGAATCCTTTCAGAGGACAC
ACGCTTGGCTTCTTTTCTCCAAACAGTCGCATTCGCCTGAAGCTCTGCGATCTTTTGGTGCACCCTTACACTGAA
CCTATTCTTCTCTTGCTCATTGTCCTGCAAGCAATCTTGCTCGCCATTGAATCTGGGCCAAGCGTCTTCAGCAAA
GGCCATGAGCGCCCCGAGAGATGGGGACAGCGGCCTATTGACTGGGCAATGCTGGGCCTCTTCATCGTCTTTACG
CTCGAGCTTTTTGCGCGCACCGTTGTGTCTGGCTTCTTTCTCAATGCCGCTGAATATAGCACTATTGACCGCAAG
AAGGGCGTACGTACCGTCATTACTGAGCAGTATAGAGCCCTGTTCCAGCCCGAGCAGCACAAGTGGGTTGGCGGA
CATCAACAGTCTGCTCCCTCGTCTCAACAGCAGTCGGCCTTTACTCGCTCCTTCACAACCATCATGCAGGGTCAG
CAGGCACTGCCCAAGACTGTTGATGAGCAGCAGAGATATCAACTGGCTCGCCGTGCCCTTTTGCGTCACTCGTTT
AATCGTCTCGACTTTATAGCAGTTGTCTCGTACTGGATTGACTTTGCACTTGGCGTCACGGGAATCGAACACCGC
TTCCATCTTTATGTCTTCAAGATGCTGAGCTGTTTGCGAATCTTGCGGTTGTTGGCTCTGACAAACGGCACCGCT
ATTATCCTCCGAAGCCTGAAAAAGGCGGCTCCCCTGCTTGTTCGCGTTGCCTTTCTCATCAGCTTCTTCTGGTTG
CTCTTTGCCATCATTGGAGTCCAAAGTTTCAAATCCAGCCTCAGTCGCCAGTGCGTCTGGTTGGATCCTCAGGAC
CCGGGCAATTTCACGGCAGCTTACACCAATGAGATGGAGTTTTGCGGAGGCTACTTGGACAACGATACTGGCAAA
GTCAAGCCGTGGGTCAAGTCTGAAGAGCCAGAATCTCTCGACAAGCTAATGGACGGAACGGGCAATGGCAAAGGC
TTCATATGCCCCCGAGGCTCCATCTGTCTGCAGCAAAGCAGCCCATTTAATGGAACGGTCAGCTTTGACAACATC
TTCCACTCCCTCGAGCTCGTCTTTGTTGTCATGAGTGGCAACACCTTTTCAGACCTCATGTATTATACCATGGGG
TCTGACTACTTGCAAGCAGCCCTATTTTTTGGTGGCGGCATCATGATTATGACGCTCTGGTTGACCAATTTGCTA
ATTGCCGTCATTACCTCTTCTTTTCAAGTGATACGCGACGAGAGTAAGTCAAGCGCCTTTACGGCAGATGCTGAG
ACGTCGGCTCAAGTCACACCGGGCCAACGTTCGCAACGACCGTTGAAGCTACAGCGAATCTACAATAAGACGGTG
CCGCTGTGGGTTCTCGTCATCACCTTTGGTCTTCTTTGCCAATCCTTTCGCAGCTCCGTCATGTCAGAGTCTCGC
GAACACTTCATCAATGCGGCAGAAGTCGTTGTAACTCTTTTGCTTGATATTGAGATTCTGTTCAGGCTTGCTGCC
AATCCACGCAGGTTTCACCGCAGCTGGCGCAACGCCTTTGATTTGGGCTTGGCTGTGGTTACGACAATTATTTTG
ATTCCACAGATACGACAGACGCGAGCTTATTCCTGGCTTACTGCCTTTCAAATTGTTCGTGTATACCGCATTGTC
ATGGCTGTTCCATTGACGCGGAAACTCATCCTGCTGGTTCTGGGAAATTCTTCTGGCATTGCAAATCTGATGCTC
TTTGTCTTTCTCATGACGTTTTTGGTGGCAATCCTGGCGTCTCAGTTGTTTCGAGGAGAGCTCGAGATGGAGGAC
AACGGAGAGTTCAGGCGCATCTCATTCTTCTCGATTTTCAACTCCTTTCTCGGCATGTACCAGATTCTTTCAAGT
GAGAACTGGACAGAGATTCTCTACTCAGTCACAGCCAAGACAAAACATTATCACACGGCTTGGATTGGCGCAGTC
TTCCTCATTGGCTGGTTCATCTTGTCCTTTTTCATTCTCGTCAACATGTTCGTGGCTGTTATTCAGGAGAACTTT
GATGTCTCGGAGGATGAGAAGCGTTTGGAACAGGTTCGTGCTTTTCTTCAGCGCAAAGAACTCGGCCACCCACAG
AGCAACCTGTCGCTGTCGACCATTTTCAGTCTAGGCAGATCCCGTCGTCGCAAGGACCCGCTTGACCATGGTCCG
GCCATGGCCGAGATGCTTCTCAAGGACGCCGTGGTTCGTGACTTTCTAGATGACGATGCGGCCATTACGCCGCAA
ATCTCGGGCCGAGTGGTTCCGCAGAGAAGTGCCACGACTCTGTTTGGCCCTGATGTCAAGCCTGGCTTCTTGTCG
ACAATCTGGGGCAAGATTGTACATCGCATCAGCAATCGCGAGCCAAATCCCTTTTACTCAAATATCCGCTTCGAG
ACCAATGACACCTTTGATCCTCGGCAGATGGCGCGGCAGGCGGTATTGGCAACTTCGACTCGGCGCAAGGCCCAA
CGCGAGTATCTTGCCCGTCACCCGCGATATAACGACGCCCTCTACATTTTTCGACCCAAACATCCTCTGCGACGT
TTTTGCCAACGGCTGGTTGGTCCGGCCAGGGGATTCGAGCGATTTGACGGTGTCGAGCCCAACAAGATTGCTTGG
TACGCCTTGTCGGTCCTCATATACGCCGTCGTGGTCGTCATGGTGGTTCTGGCATGTGTCACGACGCCGCTCTAC
CAAAAGGAGTATCGTGAGAAGCATCCTGAAAGCATGTGGAACTGGTATGTGTGGACCGACACAGCCTTTGCAGCC
ATCTTCACTGTCGAGGCCATGGTCAAGGTAATTGCAGACGGTCTCATCTGGACCCCCAATGCATACCTACGTAGC
TCGTGGGGAATCATTGACGCCGTGGTGCTTGTGACTCTCTGGATCAATGTGGTGACGCTTCTCATCAATGACGGC
GCAATATCACGTGCGGTTGGGGCTTTCAAGGCTCTACGGGCTCTTCGTCTACTCAATGTCAGCGACAGTGCACGA
GACACGTTTCATTCACTCATTATTGATGGGTGGTGGAAGTTGCTGGGTGCTGCCTTTGTCTCTCTTTCTCTCTTG
ATTCCCTTTGCCATTTATGGCCTCAACTTATTCAACGGGCTCCTGTTGACATGCAATGACTCGGATGGCATATCT
GCTCTAAGTAGCTGCTTTGGCGAGTACGACAGCAGCCCGTTCAAGGACGATTGGAAGCTTTTGGCCCCCCGAGTG
GTTTCAAACCCTTACTTTAATTTTGACAATTTTGGCTCCTCTCTCTTTACTCTCTTCCAAATTACCAGCCAAGAA
GGATGGACCGACGTGTCCTTTGCCGTTCAGTCTATAGTGGGGCGAGATGAGCAACCCGAAGACTTGGCGGCACAG
GGCAATGCGCTCTTCTTTGTCGTCTTCAACCTCATGGCTACAGTCTTCATTCTGACTCTTTTTATTTCCGTCTTT
ATGCGAAACTACACGGAGCTGACTGGAGTGGCCTTTCTCACAACGGAGCAGCGATCATGGATGGAGTTGCGCAAA
CTGCTACGGCATATTTCTCCCTCCAAGAGCTCATACAAGGAGACACAGAAGGCGTGGAAAAAGTGGTGTCACAGG
AGAGCCATTGAGAAACGAGGAAAATGGTACCGGGCCATTACGGCCTTTCTCGTCTTGCACCTGCTTCTCCTGGTG
ACAGAATTTCGAGCAGAGCCAGGGTGGTGGATCATTACGCGGGTCATGATATTTTTGATACTGATACTCATTTAT
CTGGCCAACATTATGATACGAATCATTGGTTTGGGTTGGGCGCGCTTTCGACGAAGCTCATGGGACCTGTACGCG
CTGGTGACGGTGTCAGGAGCCTTTATTGCGACTGTGGCTCTACTGAGCGCGAATCCAAACGGCGACACATATGTG
CAGCTTCACAAAATCTTTCTCGTGGCCATACTGCTGCTGTTGATTCCTCGCAATGATGCATTGGATCAACTGTTC
AAGACGGCCGCAGCGAGTTTGACAGTCATTGGAAACCTGCTTGCTACTTGGCTGGTATTCTTCCTCGTCTTTGCC
ATCGCCATGACACAGGCATTCAGTTTGACACGCTTTGGTGGTGAGGAAACCAACAATCTCAATTTCCGCAGTGTG
CCCAAGGCGCTCATCTTGCTCTTTCGAATGAGTCTGGGCGAGGGCTGGAACCAAATCATGGAAGACTTTGCCAAC
ATTGAGCCGCCCCTCTGCGTGGAGCAGGACAGGTTTTTCGATAGTGACTGCGGCAGCAAGGTCTGGGCGCGGTTT
CTCTTTGTTTCCTGGAACATTGTCAGCATGTACATTTTTGTCAACCTTTTTGTTTCGCTCATGTACGAGAGTTTT
AGTTATGTCTACCAGCGCTCAAGCAACGTGGCTGTTGTGGATCGGGACGAGATACGGCGCTTCAAAGAGGCATGG
CGAAGCGTGGACCCTGCCGGGACGGGCTTTATCAGCAGGGAGGCGTTTCCGCGTCTGCTCGGAGAGCTGTCGGGA
GTCTTTCAGATGCGCATCTATCAGCCCGAGGACTCGGTCCGACAGATTCTCGACCATGTGCGAAGCGACGAGCCA
ACACGGCGGCACATGTCCATGGCCTCGGCAAGCGCCTTGGGCGACATTGACATTGCCAAGCTCAACCGGCGGCTA
GCTCTGCTCGACGTGGCAAAGATTCGCCAACGGCGGCGGCGCTTCAAGGTTTTTTATGGCGAAGTCTTGGTGACT
GCAGACCCAGTCAAGGGCATCGCCTTTTCCGACGTGCTCATGATTCTGGCGCATTACAACATCATCAATGACAGC
AAGAGTCTCAAGCTGGATGAGTTTCTCAGACGACGCAGACGACTGCAGCGGGTAGACGATGAGATTCGACGCAAC
GTGGTGCAGGGCTTCTTTCATACCCTGTATTGGTCCAGGAAGTTCCAGAGGCACATGGAGCTAAAGCGGGCGTCG
CGAATGTCGGCAGTGCCCCAGATGTCGGTGCCTGAAATCTTTGTCAATGACGATGACGAGGCCCAGGACGAGGGC
GGCAACCCATTCAAAGCCGAGGATGGGTCGTTGACACGATGGACGCAATTAAGTGCAAATGAAGCATGTGAGCCG
AGGGGGCGCGATTTGGCCAAGCAGCAGCACCCATTGAGCCAGCCGCGGTCATGCTTGATGCGACAGGATACTGCA
ACGTCGGGCTTCAGCTTCGAGTTGGACGAAGCAGACGAGTCGGAGCAAGTGGGCCCAGAGGCAGAGCTAGAGCAA
GAGCCAGATCTAGAGCCAGAGCCAGTGACTGAAGGGCCGAGCATGGGCGGCTCTGCATCGCAAGCGCGGCACATG
CTGGACGATTCGGCATGGATGGAGAGCATACGACGCAGCGCGACGCTACACAGGACAGGACAGGGAGACGCGCAT
CGTTATGGCTAA
Gene >OphauB2|3661
ATGTCGTCCACCAGCCCGCAGCAGGCTCTGGGCGGCAGCCACGCCCGGCGCCGGCAGTCGATTCCTCTGCAGGAT
CTGCTGGCCCCTGCGGCGAGCAATGAGCCAGGGCAATCACGGCGCCACGACGCGGGCAGCAGCAACGCCCCTGGC
ATCTCGTGGAACTCGCCCTTTTCGTCGTCGGTCGACGGCGCCGCTCCCGGCTCTCCAATTGATCCCACCGCCCTG
CAATCAGCCCTCCCTCCCGATCTCTGGCAGCCGCCCGCCCGCCACAGCTTGCCATCCGCCTCGGCCTCGCTTGAC
TTTGCCTCGCCCGACTTTGCCTCGCCCCACGGCGACGACTCGCCCATCCACGACTTTTCCGACTCGGATCGCGTC
CCCCTCACTTCTGGAGCCCAGCCCATTTCTGGCGCCCTCGCGGCTGATTGCAATGGCTCTCGGCCCCCCATGTCG
CGCTCAGCGTCCGACATGGGCAATAGCAGCAGCCCACGCAACACCAAGCGCCTTGAGCCGGCCTTTGGCTTTGCC
CGTCGCCGAAGCTTTGGCATGACTCTGAATCCCCATGAATATCATCATGCTCTCTCGCGCTCTTCCTCCACGTCG
GGCGCCCTGCATCGTGCTGGCTCCATTGTCCGGGCCATGTCCCAGCGTGTCGTCAATATTAGCGGAGAGAGCGAA
GCAACAGAACAGCGCACTTCTCATGATGCATCCATGTCTCATTCCCGCCCAGCCTCTGGCCATGACCATGATCGG
AGCCCTGCTGTCTCGATGCTTATTGACACTACGTATCAACCCCAAAAGTTCGCCTCGACGGAGAAGACGCCTGAT
GTAGACCAAGTTCACTTGCATCCGCCTCAATTCCCTCCTGCTGGCGGTCTGCCCTCGAATCCTTTCAGAGGACAC
ACGCTTGGCTTCTTTTCTCCAAACAGTCGCATTCGCCTGAAGCTCTGCGATCTTTTGGTGCACCCTTACACTGAA
CCTATTCTTCTCTTGCTCATTGTCCTGCAAGCAATCTTGCTCGCCATTGAATCTGGGCCAAGCGTCTTCAGCAAA
GGCCATGAGCGCCCCGAGAGATGGGGACAGCGGCCTATTGACTGGGCAATGCTGGGCCTCTTCATCGTCTTTACG
CTCGAGCTTTTTGCGCGCACCGTTGTGTCTGGCTTCTTTCTCAATGCCGCTGAATATAGCACTATTGACCGCAAG
AAGGGCGTACGTACCGTCATTACTGAGCAGTATAGAGCCCTGTTCCAGCCCGAGCAGCACAAGTGGGTTGGCGGA
CATCAACAGTCTGCTCCCTCGTCTCAACAGCAGTCGGCCTTTACTCGCTCCTTCACAACCATCATGCAGGGTCAG
CAGGCACTGCCCAAGACTGTTGATGAGCAGCAGAGATATCAACTGGCTCGCCGTGCCCTTTTGCGTCACTCGTTT
AATCGTCTCGACTTTATAGCAGTTGTCTCGTACTGGATTGACTTTGCACTTGGCGTCACGGGAATCGAACACCGC
TTCCATCTTTATGTCTTCAAGATGCTGAGCTGTTTGCGAATCTTGCGGTTGTTGGCTCTGACAAACGGCACCGCT
GTGAGTTTTGCTGCCAAGCCACCCCTATGCCCTGCACTGGCTGACGTTTGAGGCACAGATTATCCTCCGAAGCCT
GAAAAAGGCGGCTCCCCTGCTTGTTCGCGTTGCCTTTCTCATCAGCTTCTTCTGGTTGCTCTTTGCCATCATTGG
AGTCCAAAGTTTCAAATCCAGCCTCAGTCGCCAGTGCGTCTGGTTGGATCCTCAGGACCCGGGCAATTTCACGGC
AGCTTACACCAATGAGATGGAGTTTTGCGGAGGCTACTTGGACAACGATACTGGCAAAGTCAAGCCGTGGGTCAA
GTCTGAAGAGCCAGAATCTCTCGACAAGCTAATGGACGGAACGGGCAATGGCAAAGGCTTCATATGCCCCCGAGG
CTCCATCTGTCTGCAGCAAAGCAGCCCATTTAATGGAACGGTCAGCTTTGACAACATCTTCCACTCCCTCGAGCT
CGTCTTTGTTGTCATGAGTGGCAACACCTTTTCAGACCTCATGTATTATACCATGGGGTCTGACTACTTGCAAGC
AGCCCTATTTTTTGGTGGCGGCATCATGATTATGACGCTCTGGTTGACCAATTTGCTAATTGCCGTCATTACCTC
TTCTTTTCAAGTGATACGCGACGAGAGTAAGTCAAGCGCCTTTACGGCAGATGCTGAGACGTCGGCTCAAGTCAC
ACCGGGCCAACGTTCGCAACGACCGTTGAAGCTACAGCGAATCTACAATAAGACGGTGCCGCTGTGGGTTCTCGT
CATCACCTTTGGTCTTCTTTGCCAATCCTTTCGCAGCTCCGTCATGTCAGAGTCTCGCGAACACTTCATCAATGC
GGCAGAAGTCGTTGTAACTCTTTTGCTTGATATTGAGATTCTGTTCAGGCTTGCTGCCAATCCACGCAGGTTTCA
CCGCAGCTGGCGCAACGCCTTTGATTTGGGCTTGGCTGTGGTTACGACAATTATTTTGATTCCACAGATACGACA
GACGCGAGCTTATTCCTGGCTTACTGCCTTTCAAATTGTTCGTGTATACCGCATTGTCATGGCTGTTCCATTGAC
GCGGAAACTCATCCTGCTGGTTCTGGGAAATTCTTCTGGCATTGCAAATCTGATGCTCTTTGTCTTTCTCATGAC
GTTTTTGGTGGCAATCCTGGCGTCTCAGTTGTTTCGAGGAGAGCTCGAGATGGAGGACAACGGAGAGTTCAGGCG
CATCTCATTCTTCTCGATTTTCAACTCCTTTCTCGGCATGTACCAGATTCTTTCAAGTGAGAACTGGACAGAGAT
TCTCTACTCAGTCACAGCCAAGACAAAACATTATCACACGGCTTGGATTGGCGCAGTCTTCCTCATTGGCTGGTT
CATCTTGTCCTTTTTCATTCTCGTCAACATGTTCGTGGCTGTTATTCAGGAGAACTTTGATGTCTCGGAGGATGA
GAAGCGTTTGGAACAGGTTCGTGCTTTTCTTCAGCGCAAAGAACTCGGCCACCCACAGAGCAACCTGTCGCTGTC
GACCATTTTCAGTCTAGGCAGATCCCGTCGTCGCAAGGACCCGCTTGACCATGGTCCGGCCATGGCCGAGATGCT
TCTCAAGGACGCCGTGGTTCGTGACTTTCTAGATGACGATGCGGCCATTACGCCGCAAATCTCGGGCCGAGTGGT
TCCGCAGAGAAGTGCCACGACTCTGTTTGGCCCTGATGTCAAGCCTGGCTTCTTGTCGACAATCTGGGGCAAGAT
TGTACATCGCATCAGCAATCGCGAGCCAAATCCCTTTTACTCAAATATCCGCTTCGAGACCAATGACACCTTTGA
TCCTCGGCAGATGGCGCGGCAGGCGGTATTGGCAACTTCGACTCGGCGCAAGGCCCAACGCGAGTATCTTGCCCG
TCACCCGCGATATAACGACGCCCTCTACATTTTTCGACCCAAACATCCTCTGCGACGTTTTTGCCAACGGCTGGT
TGGTCCGGCCAGGGGATTCGAGCGATTTGACGGTGTCGAGCCCAACAAGATTGCTTGGTACGCCTTGTCGGTCCT
CATATACGCCGTCGTGGTCGTCATGGTGGTTCTGGCATGTGTCACGACGCCGCTCTACCAAAAGGAGTATCGTGA
GAAGCATCCTGAAAGCATGTGGAACTGGTATGTGTGGACCGACACAGCCTTTGCAGCCATCTTCACTGTCGAGGC
CATGGTCAAGGTAATTGCAGACGGTCTCATCTGGACCCCCAATGCATACCTACGTAGCTCGTGGGGAATCATTGA
CGCCGTGGTGCTTGTGACTCTCTGGATCAATGTGGTGACGCTTCTCATCAATGACGGCGCAATATCACGTGCGGT
TGGGGCTTTCAAGGCTCTACGGGCTCTTCGTCTACTCAATGTCAGCGACAGTGCACGAGACACGTTTCATTCACT
CATTATTGATGGGTGGTGGAAGTTGCTGGGTGTAAGTCCATGTTTTCCTGCCTGCCCTCTTCATTAGCCGACTTG
GGCCCGTACTAATGCAGCATGTATTCTGCAGGCTGCCTTTGTCTCTCTTTCTCTCTTGATTCCCTTTGCCATTTA
TGGCCTCAACTTATTCAACGGGCTCCTGTTGACATGCAATGACTCGGATGGCATATCTGCTCTAAGTAGCTGCTT
TGGCGAGTACGACAGCAGCCCGTTCAAGGACGATTGGAAGCTTTTGGCCCCCCGAGTGGTTTCAAACCCTTACTT
TAATTTTGACAATTTTGGCTCCTCTCTCTTTACTCTCTTCCAAATTACCAGCCAAGAAGGATGGACCGACGTGTC
CTTTGCCGTTCAGTCTATAGTGGGGCGAGATGAGCAACCCGAAGACTTGGCGGCACAGGGCAATGCGCTCTTCTT
TGTCGTCTTCAACCTCATGGCTACAGTCTTCATTCTGACTCTTTTTATTTCCGTCTTTATGCGAAACTACACGGA
GCTGACTGGAGTGGCCTTTCTCACAACGGAGCAGCGATCATGGATGGAGTTGCGCAAACTGCTACGGCATATTTC
TCCCTCCAAGAGCTCATACAAGGAGACACAGAAGGCGTGGAAAAAGTGGTGTCACAGGAGAGCCATTGAGAAACG
AGGAAAATGGTACCGGGCCATTACGGCCTTTCTCGTCTTGCACCTGCTTCTCCTGGTGACAGAATTTCGAGCAGA
GCCAGGGTGGTGGATCATTACGCGGGTCATGATATTTTTGATACTGATACTCATTTATCTGGCCAACATTATGAT
ACGAATCATTGGTTTGGGTTGGGCGCGCTTTCGACGAAGCTCATGGGACCTGTACGCGCTGGTGACGGTGTCAGG
AGCCTTTATTGCGACTGTGGCTCTACTGAGCGCGAATCCAAACGGCGACACATATGTGCAGCTTCACAAAATCTT
TCTCGTGGCCATACTGCTGCTGTTGATTCCTCGCAATGATGCATTGGATCAACTGTTCAAGACGGCCGCAGCGAG
TTTGACAGTCATTGGAAACCTGCTTGCTACTTGGCTGGTATTCTTCCTCGTCTTTGCCATCGCCATGACACAGGC
ATTCAGTTTGACACGCTTTGGTGGTGAGGAAACCAACAATCTCAATTTCCGCAGTGTGCCCAAGGCGCTCATCTT
GCTCTTTCGAATGAGTCTGGGCGAGGGCTGGAACCAAATCATGGAAGACTTTGCCAACATTGAGCCGCCCCTCTG
CGTGGAGCAGGACAGGTTTTTCGATAGTGACTGCGGCAGCAAGGTCTGGGCGCGGTTTCTCTTTGTTTCCTGGAA
CATTGTCAGCATGTACATTTTTGTCAACCTTTTTGTTTCGCTCATGTACGAGAGTTTTAGTTATGTCTACCAGCG
CTCAAGCAACGTGGCTGTTGTGGATCGGGACGAGATACGGCGCTTCAAAGAGGCATGGCGAAGCGTGGACCCTGC
CGGGACGGGCTTTATCAGCAGGGAGGCGTTTCCGCGTCTGCTCGGAGAGCTGTCGGGAGTCTTTCAGATGCGCAT
CTATCAGCCCGAGGACTCGGTCCGACAGATTCTCGACCATGTGCGAAGCGACGAGCCAACACGGCGGCACATGTC
CATGGCCTCGGCAAGCGCCTTGGGCGACATTGACATTGCCAAGCTCAACCGGCGGCTAGCTCTGCTCGACGTGGC
AAAGATTCGCCAACGGCGGCGGCGCTTCAAGGTTTTTTATGGCGAAGTCTTGGTGACTGCAGACCCAGTCAAGGG
CATCGCCTTTTCCGACGTGCTCATGATTCTGGCGCATTACAACATCATCAATGACAGCAAGAGTCTCAAGTAGGC
AGCTCCTCCTGGTTTGCTTCTCTCGAGGCGCTGGTACTGACAAGTTGAGACAAGGCTGGATGAGTTTCTCAGACG
ACGCAGACGACTGCAGCGGGTAGACGATGAGATTCGACGCAACGTGGTGCAGGGCTTCTTTCATACCCTGTAAGT
CTAGACTGAGAGAGGGGTTGACGACGTGGCGACTGACGCGCAAGGACGGTGCAGGTATTGGTCCAGGAAGTTCCA
GAGGCACATGGAGCTAAAGCGGGCGTCGCGAATGTCGGCAGTGCCCCAGATGTCGGTGCCTGAAATCTTTGTCAA
TGACGATGACGAGGCCCAGGACGAGGGCGGCAACCCATTCAAAGCCGAGGATGGGTCGTTGACACGATGGACGCA
ATTAAGTGCAAATGAAGCATGTGAGCCGAGGGGGCGCGATTTGGCCAAGCAGCAGCACCCATTGAGCCAGCCGCG
GTCATGCTTGATGCGACAGGATACTGCAACGTCGGGCTTCAGCTTCGAGTTGGACGAAGCAGACGAGTCGGAGCA
AGTGGGCCCAGAGGCAGAGCTAGAGCAAGAGCCAGATCTAGAGCCAGAGCCAGTGACTGAAGGGCCGAGCATGGG
CGGCTCTGCATCGCAAGCGCGGCACATGCTGGACGATTCGGCATGGATGGAGAGCATACGACGCAGCGCGACGCT
ACACAGGACAGGACAGGGAGACGCGCATCGTTATGGCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail