Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3655
Gene name
LocationContig_230:9449..10211
Strand+
Gene length (bp)762
Transcript length (bp)636
Coding sequence length (bp)636
Protein length (aa) 212

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11815 DUF3336 Domain of unknown function (DUF3336) 5.1E-37 66 187

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P36165|TGL4_YEAST Lipase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TGL4 PE=1 SV=1 73 210 2.0E-18
sp|Q12043|TGL5_YEAST Lipase 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TGL5 PE=1 SV=1 73 210 1.0E-17
sp|Q9Y827|YEX5_SCHPO Uncharacterized protein C1A6.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1A6.05c PE=4 SV=1 76 178 1.0E-16
sp|Q6BXC8|PLPL_DEBHA Patatin-like phospholipase domain-containing protein DEHA2B04136g OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DEHA2B04136g PE=3 SV=2 69 182 2.0E-13
sp|Q9Y7P3|TLG3_SCHPO Probable triacylglycerol lipase C1450.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1450.16c PE=3 SV=2 78 210 4.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P36165|TGL4_YEAST Lipase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TGL4 PE=1 SV=1 73 210 2.0E-18
sp|Q12043|TGL5_YEAST Lipase 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TGL5 PE=1 SV=1 73 210 1.0E-17
sp|Q9Y827|YEX5_SCHPO Uncharacterized protein C1A6.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1A6.05c PE=4 SV=1 76 178 1.0E-16
sp|Q6BXC8|PLPL_DEBHA Patatin-like phospholipase domain-containing protein DEHA2B04136g OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DEHA2B04136g PE=3 SV=2 69 182 2.0E-13
sp|Q9Y7P3|TLG3_SCHPO Probable triacylglycerol lipase C1450.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1450.16c PE=3 SV=2 78 210 4.0E-13
sp|A5DUA8|PLPL_LODEL Patatin-like phospholipase domain-containing protein LELG_00944 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=LELG_00944 PE=3 SV=1 69 210 4.0E-11
sp|A1CRG6|PLPL_ASPCL Patatin-like phospholipase domain-containing protein ACLA_029670 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_029670 PE=3 SV=1 25 210 4.0E-11
sp|A1D4C8|PLPL_NEOFI Patatin-like phospholipase domain-containing protein NFIA_019760 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_019760 PE=3 SV=1 23 210 3.0E-10
sp|Q5AM72|PLPL_CANAL Patatin-like phospholipase domain-containing protein CaO19.1504 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CaO19.1504 PE=3 SV=1 69 181 4.0E-10
sp|Q4WJS4|PLPL_ASPFU Patatin-like phospholipase domain-containing protein AFUA_1G04970 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_1G04970 PE=3 SV=1 23 210 4.0E-10
sp|Q6C8W4|PLPL_YARLI Patatin-like phospholipase domain-containing protein YALI0D16379g OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0D16379g PE=3 SV=1 69 210 5.0E-10
sp|A5DIR3|PLPL_PICGU Patatin-like phospholipase domain-containing protein PGUG_03164 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PGUG_03164 PE=3 SV=2 69 210 5.0E-10
sp|Q0CUP0|PLPL_ASPTN Patatin-like phospholipase domain-containing protein ATEG_02594 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ATEG_02594 PE=3 SV=1 24 210 1.0E-09
sp|O14115|PLPL_SCHPO Patatin-like phospholipase domain-containing protein SPAC1786.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1786.01c PE=3 SV=2 77 184 3.0E-09
sp|Q9LZA6|SDP1_ARATH Triacylglycerol lipase SDP1 OS=Arabidopsis thaliana GN=SDP1 PE=1 SV=1 69 210 4.0E-09
sp|P0CT18|PLPL_MAGOY Patatin-like phospholipase domain-containing protein OOU_Y34scaffold00095g16.3 OS=Magnaporthe oryzae (strain Y34) GN=OOU_Y34scaffold00095g16.3 PE=3 SV=1 33 210 1.0E-08
sp|A4R8V2|PLPL_MAGO7 Patatin-like phospholipase domain-containing protein MGG_12849 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_12849 PE=3 SV=1 33 210 1.0E-08
sp|A2Q8F7|PLPL_ASPNC Patatin-like phospholipase domain-containing protein An01g04180 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=An01g04180 PE=3 SV=1 34 210 4.0E-08
sp|Q9M1I6|SDP1L_ARATH Triacylglycerol lipase SDP1L OS=Arabidopsis thaliana GN=SDP1L PE=1 SV=1 62 210 7.0E-08
sp|Q5BGC2|PLPL_EMENI Patatin-like phospholipase domain-containing protein AN0408 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN0408 PE=3 SV=1 32 181 9.0E-08
sp|Q2UKE6|PLPL_ASPOR Patatin-like phospholipase domain-containing protein AO090003000839 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090003000839 PE=3 SV=1 28 181 9.0E-08
sp|Q1DXR6|PLPL_COCIM Patatin-like phospholipase domain-containing protein CIMG_04897 OS=Coccidioides immitis (strain RS) GN=CIMG_04897 PE=3 SV=1 61 210 2.0E-06
sp|P0C584|PLPL_NEUCR Patatin-like phospholipase domain-containing protein NCU11180 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU00381 PE=3 SV=1 61 182 2.0E-06
sp|Q2HA54|PLPL_CHAGB Patatin-like phospholipase domain-containing protein CHGG_02900 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_02900 PE=3 SV=1 61 210 4.0E-06
sp|Q0V4Z6|PLPL_PHANO Patatin-like phospholipase domain-containing protein SNOG_00918 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SNOG_00918 PE=3 SV=2 70 210 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006629 lipid metabolic process Yes
GO:0004806 triglyceride lipase activity Yes
GO:0003824 catalytic activity No
GO:0044238 primary metabolic process No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0016298 lipase activity No
GO:0071704 organic substance metabolic process No
GO:0052689 carboxylic ester hydrolase activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup11197
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|3655 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3655
MANLLVTSRSSTSYAKKSQAKNTPYKALSVGNVAYALSRAYTFADTLILCLQDGLSAEQREKAQARQKKRQFLCN
EMKTAQSHKQWQAAAQELDALEGNEKWKQDSDSGDYNPRLIEQRLEALNEARNSGGVRAMMHLIRTQLCRDLGGM
GNVDLYTHSYTGTKKLIERYVDSALSAIDAVVVQSATQSDIDARDLLEGMLLARQSFGRTF*
Coding >OphauB2|3655
ATGGCCAATCTACTAGTCACATCGAGAAGCTCGACATCATACGCAAAAAAATCCCAAGCCAAAAATACGCCATAC
AAGGCTCTTTCGGTCGGCAATGTCGCGTATGCCTTGTCTCGAGCCTACACCTTTGCCGACACCCTAATCTTGTGT
CTTCAAGATGGGCTCAGCGCGGAACAGCGAGAAAAGGCGCAGGCCCGGCAGAAAAAGAGGCAGTTTCTCTGCAAT
GAAATGAAGACGGCCCAGTCGCACAAACAATGGCAAGCAGCAGCGCAAGAGTTGGATGCGCTCGAGGGCAACGAG
AAGTGGAAACAAGACTCCGACTCGGGCGACTATAACCCTCGGCTCATCGAGCAGCGCCTAGAGGCCCTCAACGAG
GCCCGCAACAGTGGAGGCGTGCGCGCCATGATGCATCTCATTCGCACCCAACTCTGCCGAGACCTCGGCGGCATG
GGAAATGTCGATCTCTACACCCACTCGTACACTGGCACCAAGAAACTCATTGAGCGCTATGTCGACTCGGCCTTG
AGTGCCATTGATGCCGTTGTAGTGCAGAGCGCGACTCAATCCGACATTGACGCCAGGGATCTGCTCGAGGGCATG
CTCCTTGCTCGGCAGAGCTTTGGCCGCACTTTTTGA
Transcript >OphauB2|3655
ATGGCCAATCTACTAGTCACATCGAGAAGCTCGACATCATACGCAAAAAAATCCCAAGCCAAAAATACGCCATAC
AAGGCTCTTTCGGTCGGCAATGTCGCGTATGCCTTGTCTCGAGCCTACACCTTTGCCGACACCCTAATCTTGTGT
CTTCAAGATGGGCTCAGCGCGGAACAGCGAGAAAAGGCGCAGGCCCGGCAGAAAAAGAGGCAGTTTCTCTGCAAT
GAAATGAAGACGGCCCAGTCGCACAAACAATGGCAAGCAGCAGCGCAAGAGTTGGATGCGCTCGAGGGCAACGAG
AAGTGGAAACAAGACTCCGACTCGGGCGACTATAACCCTCGGCTCATCGAGCAGCGCCTAGAGGCCCTCAACGAG
GCCCGCAACAGTGGAGGCGTGCGCGCCATGATGCATCTCATTCGCACCCAACTCTGCCGAGACCTCGGCGGCATG
GGAAATGTCGATCTCTACACCCACTCGTACACTGGCACCAAGAAACTCATTGAGCGCTATGTCGACTCGGCCTTG
AGTGCCATTGATGCCGTTGTAGTGCAGAGCGCGACTCAATCCGACATTGACGCCAGGGATCTGCTCGAGGGCATG
CTCCTTGCTCGGCAGAGCTTTGGCCGCACTTTTTGA
Gene >OphauB2|3655
ATGGCCAATCTACTAGTCACATCGAGAAGCTCGACATCATACGCAAAAAAATCCCAAGCCAAAAATACGCCATAC
AAGGCTCTTTCGGTCGGCAATGTCGCGTATGCCTTGTCTCGAGCCTACACCTTTGCCGACACCCTAATCTTGTGT
CTTCAAGATGGGCTCAGCGCGGAACAGCGAGAAAAGGCGCAGGCCCGGCAGAAAAAGAGGCAGTTTCTCTGCAAT
GAAATGAAGACGGTATGCTGCCCCTGGCTTGTGTATCCAATCTCTTCATTTCTCAGTCTTATGCATTTTCTCTCA
GGCCCAGTCGCACAAACAATGGCAAGCAGCAGCGCAAGAGTTGGATGCGCTCGAGGGCAACGAGAAGTGGAAACA
AGACTCCGACTCGGGCGACTATAACCCTCGGCTCATCGAGCAGCGCCTAGAGGCCCTCAACGAGGCCCGCAACAG
TGGAGGCGTGCGCGCCATGATGCATCTCATTCGCACCCAACTCTGCCGAGACCTCGGCGGCATGGGAAATGTCGA
TCTCTACACCCACTCGTACACTGGCACCAAGAAACTCATTGAGCGCTATGTCGACTCGGCCTTGAGTGCCATTGA
TGCCGTTGTAGTGCAGAGCGCGACTCAATCCGACATTGACGCCAGGGATCTGCTCGAGGGCATGCTCCTTGCTCG
GCAGAGCTTTGGCCGTAGTGCCCTGCTTCTCTCTGGCGGAGGCACATTTGGCATGACGCACATTGGCGTGCTCAA
GGCACTTTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail