Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3638
Gene name
LocationContig_23:155055..157078
Strand-
Gene length (bp)2023
Transcript length (bp)1902
Coding sequence length (bp)1902
Protein length (aa) 634

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00854 PTR2 POT family 5.3E-75 155 561

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P380|PTR2_SCHPO Probable peptide transporter ptr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptr2 PE=1 SV=1 20 633 1.0E-114
sp|P32901|PTR2_YEAST Peptide transporter PTR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTR2 PE=1 SV=2 52 606 4.0E-107
sp|P46030|PTR2_CANAX Peptide transporter PTR2 OS=Candida albicans GN=PTR2 PE=3 SV=1 51 590 2.0E-83
sp|O09014|S15A4_RAT Solute carrier family 15 member 4 OS=Rattus norvegicus GN=Slc15a4 PE=1 SV=1 81 566 8.0E-36
sp|Q68F72|S15A4_XENLA Solute carrier family 15 member 4 OS=Xenopus laevis GN=slc15a4 PE=2 SV=1 81 566 1.0E-35
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P380|PTR2_SCHPO Probable peptide transporter ptr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptr2 PE=1 SV=1 20 633 1.0E-114
sp|P32901|PTR2_YEAST Peptide transporter PTR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTR2 PE=1 SV=2 52 606 4.0E-107
sp|P46030|PTR2_CANAX Peptide transporter PTR2 OS=Candida albicans GN=PTR2 PE=3 SV=1 51 590 2.0E-83
sp|O09014|S15A4_RAT Solute carrier family 15 member 4 OS=Rattus norvegicus GN=Slc15a4 PE=1 SV=1 81 566 8.0E-36
sp|Q68F72|S15A4_XENLA Solute carrier family 15 member 4 OS=Xenopus laevis GN=slc15a4 PE=2 SV=1 81 566 1.0E-35
sp|Q9M390|PTR1_ARATH Protein NRT1/ PTR FAMILY 8.1 OS=Arabidopsis thaliana GN=NPF8.1 PE=1 SV=1 81 556 2.0E-33
sp|P46032|PTR2_ARATH Protein NRT1/ PTR FAMILY 8.3 OS=Arabidopsis thaliana GN=NPF8.3 PE=1 SV=1 81 560 4.0E-33
sp|Q91W98|S15A4_MOUSE Solute carrier family 15 member 4 OS=Mus musculus GN=Slc15a4 PE=1 SV=1 81 566 6.0E-33
sp|A6QQL0|S15A4_BOVIN Solute carrier family 15 member 4 OS=Bos taurus GN=SLC15A4 PE=2 SV=2 77 566 9.0E-33
sp|Q9LFB8|PTR5_ARATH Protein NRT1/ PTR FAMILY 8.2 OS=Arabidopsis thaliana GN=NPF8.2 PE=2 SV=1 81 560 1.0E-30
sp|Q8N697|S15A4_HUMAN Solute carrier family 15 member 4 OS=Homo sapiens GN=SLC15A4 PE=2 SV=1 77 566 2.0E-30
sp|Q84WG0|PTR26_ARATH Protein NRT1/ PTR FAMILY 8.4 OS=Arabidopsis thaliana GN=NPF8.4 PE=2 SV=2 81 560 6.0E-29
sp|Q93Z20|PTR17_ARATH Protein NRT1/ PTR FAMILY 8.5 OS=Arabidopsis thaliana GN=NPF8.5 PE=2 SV=1 17 560 9.0E-28
sp|Q9JIP7|S15A1_MOUSE Solute carrier family 15 member 1 OS=Mus musculus GN=Slc15a1 PE=1 SV=2 71 464 1.0E-26
sp|P51574|S15A1_RAT Solute carrier family 15 member 1 OS=Rattus norvegicus GN=Slc15a1 PE=2 SV=1 71 464 1.0E-26
sp|P36836|S15A1_RABIT Solute carrier family 15 member 1 OS=Oryctolagus cuniculus GN=SLC15A1 PE=2 SV=1 71 464 1.0E-26
sp|P46029|S15A2_RABIT Solute carrier family 15 member 2 OS=Oryctolagus cuniculus GN=SLC15A2 PE=2 SV=1 64 449 3.0E-26
sp|Q9ES07|S15A2_MOUSE Solute carrier family 15 member 2 OS=Mus musculus GN=Slc15a2 PE=1 SV=1 71 464 1.0E-25
sp|Q8WMX5|S15A1_CANLF Solute carrier family 15 member 1 OS=Canis lupus familiaris GN=SLC15A1 PE=2 SV=2 71 464 1.0E-25
sp|Q63424|S15A2_RAT Solute carrier family 15 member 2 OS=Rattus norvegicus GN=Slc15a2 PE=1 SV=1 76 464 9.0E-25
sp|P46059|S15A1_HUMAN Solute carrier family 15 member 1 OS=Homo sapiens GN=SLC15A1 PE=2 SV=1 71 464 2.0E-24
sp|Q16348|S15A2_HUMAN Solute carrier family 15 member 2 OS=Homo sapiens GN=SLC15A2 PE=2 SV=2 71 449 2.0E-24
sp|P91679|PEPT1_DROME Peptide transporter family 1 OS=Drosophila melanogaster GN=yin PE=1 SV=2 76 439 1.0E-23
sp|Q21219|PEPT1_CAEEL Peptide transporter family 1 OS=Caenorhabditis elegans GN=pept-1 PE=2 SV=2 71 464 3.0E-23
sp|Q9FNL7|PTR3_ARATH Protein NRT1/ PTR FAMILY 5.2 OS=Arabidopsis thaliana GN=NPF5.2 PE=2 SV=1 81 547 8.0E-23
sp|Q8RX77|PTR21_ARATH Protein NRT1/ PTR FAMILY 2.13 OS=Arabidopsis thaliana GN=NPF2.13 PE=1 SV=1 139 550 9.0E-22
sp|Q9LVE0|PTR33_ARATH Protein NRT1/ PTR FAMILY 6.4 OS=Arabidopsis thaliana GN=NPF6.4 PE=1 SV=1 148 558 2.0E-20
sp|Q9M331|PTR45_ARATH Protein NRT1/ PTR FAMILY 5.7 OS=Arabidopsis thaliana GN=NPF5.7 PE=2 SV=2 74 550 3.0E-20
sp|Q9FNL8|PTR4_ARATH Protein NRT1/ PTR FAMILY 5.3 OS=Arabidopsis thaliana GN=NPF5.3 PE=2 SV=1 81 546 4.0E-20
sp|Q9M1I2|PTR46_ARATH Protein NRT1/ PTR FAMILY 5.4 OS=Arabidopsis thaliana GN=NPF5.4 PE=2 SV=1 77 540 5.0E-20
sp|Q924V4|S15A3_RAT Solute carrier family 15 member 3 OS=Rattus norvegicus GN=Slc15a3 PE=2 SV=1 241 562 2.0E-19
sp|P0CI03|PTR28_ARATH Protein NRT1/ PTR FAMILY 5.6 OS=Arabidopsis thaliana GN=NPF5.6 PE=2 SV=1 74 550 2.0E-19
sp|O01840|PEPT3_CAEEL Peptide transporter 3 OS=Caenorhabditis elegans GN=pept-3 PE=1 SV=1 81 464 5.0E-19
sp|Q8BPX9|S15A3_MOUSE Solute carrier family 15 member 3 OS=Mus musculus GN=Slc15a3 PE=2 SV=1 241 562 7.0E-19
sp|Q0WP01|PTR9_ARATH Protein NRT1/ PTR FAMILY 5.10 OS=Arabidopsis thaliana GN=NPF5.10 PE=2 SV=1 80 547 1.0E-18
sp|Q9C7U1|PTR25_ARATH Protein NRT1/ PTR FAMILY 5.12 OS=Arabidopsis thaliana GN=NPF5.12 PE=2 SV=1 81 551 4.0E-17
sp|Q9M9V7|PTR8_ARATH Protein NRT1/ PTR FAMILY 2.9 OS=Arabidopsis thaliana GN=NPF2.9 PE=1 SV=1 142 560 6.0E-16
sp|Q17758|PEPT2_CAEEL Peptide transporter family 2 OS=Caenorhabditis elegans GN=pept-2 PE=1 SV=2 68 467 1.0E-15
sp|Q8IY34|S15A3_HUMAN Solute carrier family 15 member 3 OS=Homo sapiens GN=SLC15A3 PE=2 SV=2 240 562 2.0E-15
sp|Q0WSZ6|PTR23_ARATH Protein NRT1/ PTR FAMILY 5.13 OS=Arabidopsis thaliana GN=NPF5.13 PE=2 SV=2 80 542 3.0E-15
sp|Q9LQL2|PTR14_ARATH Protein NRT1/ PTR FAMILY 7.3 OS=Arabidopsis thaliana GN=NPF7.3 PE=1 SV=2 138 558 6.0E-15
sp|Q9SK99|PTR11_ARATH Protein NRT1/ PTR FAMILY 5.15 OS=Arabidopsis thaliana GN=NPF5.15 PE=2 SV=1 80 558 6.0E-15
sp|Q9SX20|PTR18_ARATH Protein NRT1/ PTR FAMILY 3.1 OS=Arabidopsis thaliana GN=NPF3.1 PE=2 SV=1 58 558 2.0E-14
sp|Q9M817|PTR6_ARATH Protein NRT1/ PTR FAMILY 1.2 OS=Arabidopsis thaliana GN=NPF1.2 PE=1 SV=1 141 550 3.0E-14
sp|Q8VZE2|PTR22_ARATH Protein NRT1/ PTR FAMILY 5.14 OS=Arabidopsis thaliana GN=NPF5.14 PE=2 SV=2 60 546 5.0E-14
sp|Q9LFR1|PTR50_ARATH Protein NRT1/ PTR FAMILY 5.8 OS=Arabidopsis thaliana GN=NPF5.8 PE=2 SV=1 124 558 5.0E-14
sp|Q8LPL2|PTR32_ARATH Protein NRT1/ PTR FAMILY 1.1 OS=Arabidopsis thaliana GN=NPF1.1 PE=1 SV=2 140 550 2.0E-13
sp|Q9SK96|PTR10_ARATH Protein NRT1/ PTR FAMILY 5.16 OS=Arabidopsis thaliana GN=NPF5.16 PE=2 SV=1 80 556 1.0E-12
sp|Q9LV10|PTR53_ARATH Protein NRT1/ PTR FAMILY 2.11 OS=Arabidopsis thaliana GN=NPF2.11 PE=1 SV=1 145 540 5.0E-12
sp|Q9SRI2|PTR31_ARATH Protein NRT1/ PTR FAMILY 5.9 OS=Arabidopsis thaliana GN=NPF5.9 PE=2 SV=1 124 558 5.0E-12
sp|Q9SZY4|PTR27_ARATH Protein NRT1/ PTR FAMILY 6.2 OS=Arabidopsis thaliana GN=NPF6.2 PE=1 SV=1 80 548 7.0E-12
sp|Q3E9B5|PTR51_ARATH Protein NRT1/ PTR FAMILY 7.1 OS=Arabidopsis thaliana GN=NPF7.1 PE=2 SV=1 138 548 7.0E-12
sp|Q9LFX9|PTR13_ARATH Protein NRT1/ PTR FAMILY 2.12 OS=Arabidopsis thaliana GN=NPF2.12 PE=1 SV=2 129 597 1.0E-10
sp|Q05085|PTR7_ARATH Protein NRT1/ PTR FAMILY 6.3 OS=Arabidopsis thaliana GN=NPF6.3 PE=1 SV=1 77 559 4.0E-10
sp|P94408|YCLF_BACSU Uncharacterized transporter YclF OS=Bacillus subtilis (strain 168) GN=yclF PE=3 SV=2 56 296 4.0E-10
sp|Q8RX67|PTR24_ARATH Protein NRT1/ PTR FAMILY 5.11 OS=Arabidopsis thaliana GN=NPF5.11 PE=2 SV=1 77 586 6.0E-10
sp|Q93VV5|PTR16_ARATH Protein NRT1/ PTR FAMILY 4.3 OS=Arabidopsis thaliana GN=NPF4.3 PE=2 SV=1 138 561 8.0E-10
sp|Q9LSF0|PTR34_ARATH Protein NRT1/ PTR FAMILY 4.1 OS=Arabidopsis thaliana GN=NPF4.1 PE=2 SV=1 124 563 8.0E-10
sp|Q9FM20|PTR54_ARATH Protein NRT1/ PTR FAMILY 4.7 OS=Arabidopsis thaliana GN=NPF4.7 PE=2 SV=2 138 541 1.0E-09
sp|Q8VZR7|PTR30_ARATH Protein NRT1/ PTR FAMILY 5.1 OS=Arabidopsis thaliana GN=NPF5.1 PE=2 SV=2 81 536 2.0E-09
sp|P0C2U2|DTPT_LACLA Di-/tripeptide transporter OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dtpT PE=3 SV=1 71 303 3.0E-09
sp|Q8VYE4|PTR12_ARATH Protein NRT1/ PTR FAMILY 4.5 OS=Arabidopsis thaliana GN=NPF4.5 PE=2 SV=1 149 541 4.0E-09
sp|A2RMA8|DTPT_LACLM Di-/tripeptide transporter OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=dtpT PE=3 SV=1 71 312 5.0E-09
sp|P0C2U3|DTPT_LACLC Di-/tripeptide transporter OS=Lactococcus lactis subsp. cremoris GN=dtpT PE=1 SV=1 71 312 5.0E-09
sp|Q3E8X3|PTR52_ARATH Protein NRT1/ PTR FAMILY 2.8 OS=Arabidopsis thaliana GN=NPF2.8 PE=2 SV=2 139 558 2.0E-08
sp|Q9LYR6|PTR49_ARATH Protein NRT1/ PTR FAMILY 6.1 OS=Arabidopsis thaliana GN=NPF6.1 PE=2 SV=1 81 560 3.0E-08
sp|Q9M1E1|PTR38_ARATH Protein NRT1/ PTR FAMILY 2.6 OS=Arabidopsis thaliana GN=NPF2.6 PE=2 SV=1 121 558 7.0E-08
sp|Q8H157|PTR19_ARATH Protein NRT1/ PTR FAMILY 4.6 OS=Arabidopsis thaliana GN=NPF4.6 PE=1 SV=1 148 541 2.0E-07
sp|Q944G5|PTR44_ARATH Protein NRT1/ PTR FAMILY 2.10 OS=Arabidopsis thaliana GN=NPF2.10 PE=1 SV=3 144 540 2.0E-07
sp|O07380|DTPT_LACHE Di-/tripeptide transporter OS=Lactobacillus helveticus GN=dtpT PE=3 SV=1 117 301 3.0E-07
sp|Q9M1E2|PTR37_ARATH Protein NRT1/ PTR FAMILY 2.7 OS=Arabidopsis thaliana GN=NPF2.7 PE=1 SV=1 139 558 4.0E-07
sp|Q9CAR9|PTR20_ARATH Putative protein NRT1/ PTR FAMILY 2.14 OS=Arabidopsis thaliana GN=NPF2.14 PE=5 SV=1 141 559 3.0E-06
sp|Q9LYD5|PTR48_ARATH Protein NRT1/ PTR FAMILY 1.3 OS=Arabidopsis thaliana GN=NPF1.3 PE=2 SV=1 120 541 4.0E-06
sp|Q9M174|PTR40_ARATH Putative protein NRT1/ PTR FAMILY 2.2 OS=Arabidopsis thaliana GN=NPF2.2 PE=5 SV=1 139 464 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0016020 membrane Yes
GO:0022857 transmembrane transporter activity Yes
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0005575 cellular_component No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 160 182 22
2 192 214 22
3 244 266 22
4 270 292 22
5 369 386 17
6 416 433 17
7 446 468 22
8 500 522 22
9 535 557 22
10 562 584 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3638
MSTGQSLEPMEGTGLGALASNEKSVNTVSAFQGHGNQGSHDGESNVGSMVGLEPPSQDDLATLRRVPNKIPLKLF
TIAFIELCERFSYYGSTVVFTNFIQQQLPPGSTTGASIKQPGALGMGQRASTGITTFNQFWQYLMPLFGAWVADA
KWGRFKTIFSALGVNLTGHIILIISAIPPVIVHQNASLACLIIAIIIIGVGTGGFKPNVSCLIVEQLGDQRMFVQ
TLKSGERVIVDPAVTTERIYNWFYFFINVGALVGQITMVYAEQYVGFYMSFTLPTIMLSLCPLVMLWGRKRYIRR
EPAGSVLVPALRAWFFAQRGRWSMNPVRTWKNMHDGTFWDSIKPSRFTPETRPRWMTFDDAWVDELRRGFSACAV
FCWYPIFWLSYNQINNNLVSQAAVLQRHGVPNDILSNLNPFSLLIFIPLNDFIIYPALRKAGVRLTPIRKITAGF
YVGCAAMVWAAVVQHFIYSRSVCGSHASGTMPSPDGSGATVKCPPVDINVWAQTGSYVLIALAEVFASITALEYA
YSKAPRNMRSMVQAVALFMTSFAAAIGQALVGLASDPLLVWNYAVVAILAFVAGTCFYLQFRNLDVDEDQLNELP
EGNVDRQGSTGDEEVVRVSVSPDEKQLRQSRET*
Coding >OphauB2|3638
ATGTCCACTGGACAGAGCCTGGAGCCCATGGAGGGCACCGGGCTGGGCGCTCTGGCCAGCAACGAGAAGAGCGTC
AATACCGTCTCTGCTTTCCAAGGCCATGGAAACCAAGGGAGCCATGATGGCGAGTCAAATGTTGGATCAATGGTG
GGACTGGAGCCTCCCTCGCAAGACGACTTGGCGACATTGCGTCGCGTGCCCAATAAGATTCCACTCAAGCTCTTT
ACCATTGCTTTCATTGAGCTTTGCGAGCGATTTTCATACTATGGATCAACGGTTGTGTTCACCAACTTTATCCAG
CAGCAGCTGCCGCCCGGGTCAACGACTGGGGCCAGCATCAAGCAGCCTGGAGCGCTGGGCATGGGCCAGCGAGCT
TCGACGGGCATCACCACATTCAACCAGTTTTGGCAGTATCTAATGCCGCTCTTTGGCGCCTGGGTGGCGGATGCT
AAATGGGGCCGCTTTAAAACCATCTTCTCGGCCTTGGGCGTCAACCTCACGGGCCACATTATCCTCATCATTTCT
GCCATTCCACCCGTTATTGTGCACCAGAATGCCTCGTTGGCGTGCCTCATCATTGCCATCATCATCATTGGCGTC
GGCACTGGCGGTTTCAAGCCCAATGTCAGCTGTCTGATTGTCGAGCAGCTGGGCGACCAGCGCATGTTTGTCCAG
ACGCTCAAGTCGGGCGAGCGCGTCATTGTCGACCCGGCCGTGACGACGGAGCGCATCTACAACTGGTTCTACTTT
TTTATCAATGTGGGCGCCCTCGTTGGCCAAATCACCATGGTCTACGCCGAGCAGTATGTCGGCTTCTACATGTCC
TTTACCCTGCCCACCATTATGCTCAGCCTGTGTCCGCTGGTGATGCTCTGGGGCCGCAAGCGATATATCCGTCGC
GAGCCGGCCGGCTCGGTCCTTGTGCCGGCTCTGCGTGCCTGGTTTTTTGCGCAGCGGGGCCGCTGGTCCATGAAT
CCTGTTCGCACGTGGAAGAATATGCACGATGGCACCTTTTGGGACAGCATCAAGCCCTCTCGCTTCACACCCGAG
ACGCGGCCTCGCTGGATGACGTTTGACGACGCCTGGGTTGATGAGCTGCGCCGTGGCTTCTCGGCATGTGCCGTC
TTTTGCTGGTATCCTATTTTTTGGCTCAGCTACAACCAGATCAATAATAATCTCGTCTCTCAGGCTGCCGTGCTG
CAGCGCCATGGCGTGCCCAACGACATCCTCTCCAACCTCAACCCCTTTTCTCTGCTCATCTTTATCCCCCTCAAC
GACTTTATCATTTACCCCGCTCTCCGCAAAGCCGGCGTCCGCCTGACGCCCATTCGCAAAATCACTGCCGGCTTC
TACGTGGGCTGTGCCGCCATGGTTTGGGCTGCCGTGGTGCAGCACTTCATCTACAGCCGCTCGGTATGTGGCAGC
CACGCCTCGGGCACCATGCCCAGCCCCGACGGGTCGGGCGCCACGGTCAAGTGTCCGCCCGTCGACATCAATGTG
TGGGCCCAGACGGGCTCATATGTGCTCATTGCCCTGGCCGAGGTGTTTGCCTCGATTACGGCGCTCGAGTATGCC
TACTCCAAGGCACCACGCAACATGCGCTCCATGGTCCAGGCCGTTGCCCTCTTCATGACGTCGTTTGCCGCTGCC
ATTGGCCAGGCTCTAGTTGGGCTGGCCTCGGATCCCCTGCTGGTGTGGAACTATGCCGTTGTCGCCATTTTGGCC
TTTGTGGCTGGCACCTGCTTTTACCTGCAGTTTCGGAACCTGGATGTCGACGAGGACCAGCTTAATGAGCTGCCC
GAGGGCAACGTGGACCGTCAAGGCAGCACGGGGGACGAGGAAGTGGTGCGTGTTAGTGTATCACCCGATGAAAAG
CAATTGCGCCAGAGCCGAGAGACTTGA
Transcript >OphauB2|3638
ATGTCCACTGGACAGAGCCTGGAGCCCATGGAGGGCACCGGGCTGGGCGCTCTGGCCAGCAACGAGAAGAGCGTC
AATACCGTCTCTGCTTTCCAAGGCCATGGAAACCAAGGGAGCCATGATGGCGAGTCAAATGTTGGATCAATGGTG
GGACTGGAGCCTCCCTCGCAAGACGACTTGGCGACATTGCGTCGCGTGCCCAATAAGATTCCACTCAAGCTCTTT
ACCATTGCTTTCATTGAGCTTTGCGAGCGATTTTCATACTATGGATCAACGGTTGTGTTCACCAACTTTATCCAG
CAGCAGCTGCCGCCCGGGTCAACGACTGGGGCCAGCATCAAGCAGCCTGGAGCGCTGGGCATGGGCCAGCGAGCT
TCGACGGGCATCACCACATTCAACCAGTTTTGGCAGTATCTAATGCCGCTCTTTGGCGCCTGGGTGGCGGATGCT
AAATGGGGCCGCTTTAAAACCATCTTCTCGGCCTTGGGCGTCAACCTCACGGGCCACATTATCCTCATCATTTCT
GCCATTCCACCCGTTATTGTGCACCAGAATGCCTCGTTGGCGTGCCTCATCATTGCCATCATCATCATTGGCGTC
GGCACTGGCGGTTTCAAGCCCAATGTCAGCTGTCTGATTGTCGAGCAGCTGGGCGACCAGCGCATGTTTGTCCAG
ACGCTCAAGTCGGGCGAGCGCGTCATTGTCGACCCGGCCGTGACGACGGAGCGCATCTACAACTGGTTCTACTTT
TTTATCAATGTGGGCGCCCTCGTTGGCCAAATCACCATGGTCTACGCCGAGCAGTATGTCGGCTTCTACATGTCC
TTTACCCTGCCCACCATTATGCTCAGCCTGTGTCCGCTGGTGATGCTCTGGGGCCGCAAGCGATATATCCGTCGC
GAGCCGGCCGGCTCGGTCCTTGTGCCGGCTCTGCGTGCCTGGTTTTTTGCGCAGCGGGGCCGCTGGTCCATGAAT
CCTGTTCGCACGTGGAAGAATATGCACGATGGCACCTTTTGGGACAGCATCAAGCCCTCTCGCTTCACACCCGAG
ACGCGGCCTCGCTGGATGACGTTTGACGACGCCTGGGTTGATGAGCTGCGCCGTGGCTTCTCGGCATGTGCCGTC
TTTTGCTGGTATCCTATTTTTTGGCTCAGCTACAACCAGATCAATAATAATCTCGTCTCTCAGGCTGCCGTGCTG
CAGCGCCATGGCGTGCCCAACGACATCCTCTCCAACCTCAACCCCTTTTCTCTGCTCATCTTTATCCCCCTCAAC
GACTTTATCATTTACCCCGCTCTCCGCAAAGCCGGCGTCCGCCTGACGCCCATTCGCAAAATCACTGCCGGCTTC
TACGTGGGCTGTGCCGCCATGGTTTGGGCTGCCGTGGTGCAGCACTTCATCTACAGCCGCTCGGTATGTGGCAGC
CACGCCTCGGGCACCATGCCCAGCCCCGACGGGTCGGGCGCCACGGTCAAGTGTCCGCCCGTCGACATCAATGTG
TGGGCCCAGACGGGCTCATATGTGCTCATTGCCCTGGCCGAGGTGTTTGCCTCGATTACGGCGCTCGAGTATGCC
TACTCCAAGGCACCACGCAACATGCGCTCCATGGTCCAGGCCGTTGCCCTCTTCATGACGTCGTTTGCCGCTGCC
ATTGGCCAGGCTCTAGTTGGGCTGGCCTCGGATCCCCTGCTGGTGTGGAACTATGCCGTTGTCGCCATTTTGGCC
TTTGTGGCTGGCACCTGCTTTTACCTGCAGTTTCGGAACCTGGATGTCGACGAGGACCAGCTTAATGAGCTGCCC
GAGGGCAACGTGGACCGTCAAGGCAGCACGGGGGACGAGGAAGTGGTGCGTGTTAGTGTATCACCCGATGAAAAG
CAATTGCGCCAGAGCCGAGAGACTTGA
Gene >OphauB2|3638
ATGTCCACTGGACAGAGCCTGGAGCCCATGGAGGGCACCGGGCTGGGCGCTCTGGCCAGCAACGAGAAGAGCGTC
AATACCGTCTCTGCTTTCCAAGGCCATGGAAACCAAGGGAGCCATGATGGCGAGTCAAATGTTGGATCAATGGTG
GGACTGGAGCCTCCCTCGCAAGACGACTTGGCGACATTGCGTCGCGTGCCCAATAAGATTCCACTCAAGCTCTTT
ACCATTGCTTTCATTGAGCTTTGCGAGCGATTTTCATACTATGGATCAACGGTTGTGTGTAAGTGGTGGCGACGA
GTGCATTTCTTGACCAAGCGCTGACAATGACAGTCACCAACTTTATCCAGCAGCAGCTGCCGCCCGGGTCAACGA
CTGGGGCCAGCATCAAGCAGCCTGGAGCGCTGGGCATGGGCCAGCGAGCTTCGACGGGCATCACCACATTCAACC
AGTTTTGGCAGTATCTAATGCCGCTCTTTGGCGCCTGGGTGGCGGATGCTAAATGGGGCCGCTTTAAAACCATCT
TCTCGGCCTTGGGCGTCAACCTCACGGGCCACATTATCCTCATCATTTCTGCCATTCCACCCGTTATTGTGCACC
AGAATGCCTCGTTGGCGTGCCTCATCATTGCCATCATCATCATTGGCGTCGGCACTGGCGGTTTCAAGCCCAATG
TCAGCTGTCTGATTGTCGAGCAGCTGGGCGACCAGCGCATGTTTGTCCAGACGCTCAAGTCGGGCGAGCGCGTCA
TTGTCGACCCGGCCGTGACGACGGAGCGCATCTACAACTGGTTCTACTTTTTTATCAATGTGGGCGCCCTCGTTG
GCCAAATCACCATGGTCTACGCCGAGCAGTATGTCGGCTTCTACATGTCCTTTACCCTGCCCACCATTATGCTCA
GCCTGTGTCCGCTGGTGATGCTCTGGGGCCGCAAGCGATATATCCGTCGCGAGCCGGCCGGCTCGGTCCTTGTGC
CGGCTCTGCGTGCCTGGTTTTTTGCGCAGCGGGGCCGCTGGTCCATGAATCCTGTTCGCACGTGGAAGAATATGC
ACGATGGCACCTTTTGGGACAGCATCAAGCCCTCTCGCTTCACACCCGAGACGCGGCCTCGCTGGATGACGTTTG
ACGACGCCTGGGTTGATGAGCTGCGCCGTGGCTTCTCGGCATGTGCCGTCTTTTGCTGGTATCCTATTTTTTGGC
TCAGCTACAACCAGAGTGAGTATACCCGTTTGTGACGTTTCTTTTTCTCTGGATTCAGCAGCTGACGCCGTCTTT
GTGCTTGGCAGTCAATAATAATCTCGTCTCTCAGGCTGCCGTGCTGCAGCGCCATGGCGTGCCCAACGACATCCT
CTCCAACCTCAACCCCTTTTCTCTGCTCATCTTTATCCCCCTCAACGACTTTATCATTTACCCCGCTCTCCGCAA
AGCCGGCGTCCGCCTGACGCCCATTCGCAAAATCACTGCCGGCTTCTACGTGGGCTGTGCCGCCATGGTTTGGGC
TGCCGTGGTGCAGCACTTCATCTACAGCCGCTCGGTATGTGGCAGCCACGCCTCGGGCACCATGCCCAGCCCCGA
CGGGTCGGGCGCCACGGTCAAGTGTCCGCCCGTCGACATCAATGTGTGGGCCCAGACGGGCTCATATGTGCTCAT
TGCCCTGGCCGAGGTGTTTGCCTCGATTACGGCGCTCGAGTATGCCTACTCCAAGGCACCACGCAACATGCGCTC
CATGGTCCAGGCCGTTGCCCTCTTCATGACGTCGTTTGCCGCTGCCATTGGCCAGGCTCTAGTTGGGCTGGCCTC
GGATCCCCTGCTGGTGTGGAACTATGCCGTTGTCGCCATTTTGGCCTTTGTGGCTGGCACCTGCTTTTACCTGCA
GTTTCGGAACCTGGATGTCGACGAGGACCAGCTTAATGAGCTGCCCGAGGGCAACGTGGACCGTCAAGGCAGCAC
GGGGGACGAGGAAGTGGTGCGTGTTAGTGTATCACCCGATGAAAAGCAATTGCGCCAGAGCCGAGAGACTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail