Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|363
Gene name
LocationContig_103:41142..42143
Strand-
Gene length (bp)1001
Transcript length (bp)936
Coding sequence length (bp)936
Protein length (aa) 312

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04750 Far-17a_AIG1 FAR-17a/AIG1-like protein 6.1E-09 89 260

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0031224 intrinsic component of membrane No
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 56 78 22
2 99 121 22
3 141 163 22
4 202 224 22
5 239 261 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|363
MTEQSAPTRPLIFWSSLLPNESTWKRFKRTFTLTPEPFDVENRFVTSWIFTPFTLAAIRMTIGSYILSSILFIIA
WSCSHPATTGGCVASRRSFSYFTVLAFWGQAFYFIVAAIHTFFHAAWPGNLSLLSRFRRPFGALHSFFYSSVVVF
PLLVSIIYWAMIFKGPWRGSTFDSWRNVSQHALNSVFALIEMILARTSLLPVVHLLWLFCILVAYLGVAFVTNID
QDFFVYAFLDKNKVGGPGLVAAYIACVAMALVVVFIVAQVIIRVRLWAVESPKTVSDEAVATSAQSSPEMELRAV
NPNNNKALENI*
Coding >OphauB2|363
ATGACGGAACAGTCTGCCCCAACTCGGCCATTAATTTTCTGGTCGTCGCTGCTACCAAATGAGTCAACGTGGAAA
CGCTTCAAACGGACTTTTACTCTTACCCCTGAGCCCTTTGATGTCGAGAATCGTTTCGTCACCTCGTGGATCTTT
ACACCCTTTACACTGGCCGCCATCCGCATGACCATCGGCTCATACATCCTTTCAAGCATCCTCTTCATTATAGCC
TGGTCTTGCTCGCACCCAGCAACAACGGGCGGATGCGTCGCCTCGCGCCGCTCATTCTCCTACTTTACCGTACTT
GCATTTTGGGGCCAGGCCTTTTACTTCATCGTTGCCGCAATTCACACCTTCTTCCACGCTGCCTGGCCGGGCAAT
CTGTCTCTTCTCTCTCGCTTCAGGCGCCCATTTGGCGCTCTTCACTCCTTTTTCTACTCGTCCGTCGTCGTCTTT
CCGCTGCTGGTTAGCATTATATACTGGGCCATGATATTCAAGGGTCCATGGCGCGGATCTACCTTTGACTCGTGG
CGCAACGTGTCGCAACATGCCTTGAATTCGGTCTTTGCCCTCATCGAGATGATCTTGGCTCGCACCTCCTTGTTA
CCCGTGGTTCATCTCTTGTGGCTCTTTTGCATTCTTGTCGCCTACCTGGGCGTGGCCTTTGTGACAAATATCGAC
CAGGATTTTTTCGTATACGCCTTTCTCGATAAAAATAAAGTCGGAGGCCCTGGCCTGGTCGCCGCCTATATCGCC
TGCGTCGCCATGGCCTTGGTCGTCGTCTTTATCGTCGCTCAAGTCATCATTCGTGTGCGGCTGTGGGCTGTTGAA
AGTCCAAAGACCGTCTCAGACGAAGCTGTTGCTACTTCTGCTCAATCCTCCCCAGAAATGGAGCTCAGAGCCGTC
AACCCAAACAATAATAAGGCCCTCGAGAATATATAG
Transcript >OphauB2|363
ATGACGGAACAGTCTGCCCCAACTCGGCCATTAATTTTCTGGTCGTCGCTGCTACCAAATGAGTCAACGTGGAAA
CGCTTCAAACGGACTTTTACTCTTACCCCTGAGCCCTTTGATGTCGAGAATCGTTTCGTCACCTCGTGGATCTTT
ACACCCTTTACACTGGCCGCCATCCGCATGACCATCGGCTCATACATCCTTTCAAGCATCCTCTTCATTATAGCC
TGGTCTTGCTCGCACCCAGCAACAACGGGCGGATGCGTCGCCTCGCGCCGCTCATTCTCCTACTTTACCGTACTT
GCATTTTGGGGCCAGGCCTTTTACTTCATCGTTGCCGCAATTCACACCTTCTTCCACGCTGCCTGGCCGGGCAAT
CTGTCTCTTCTCTCTCGCTTCAGGCGCCCATTTGGCGCTCTTCACTCCTTTTTCTACTCGTCCGTCGTCGTCTTT
CCGCTGCTGGTTAGCATTATATACTGGGCCATGATATTCAAGGGTCCATGGCGCGGATCTACCTTTGACTCGTGG
CGCAACGTGTCGCAACATGCCTTGAATTCGGTCTTTGCCCTCATCGAGATGATCTTGGCTCGCACCTCCTTGTTA
CCCGTGGTTCATCTCTTGTGGCTCTTTTGCATTCTTGTCGCCTACCTGGGCGTGGCCTTTGTGACAAATATCGAC
CAGGATTTTTTCGTATACGCCTTTCTCGATAAAAATAAAGTCGGAGGCCCTGGCCTGGTCGCCGCCTATATCGCC
TGCGTCGCCATGGCCTTGGTCGTCGTCTTTATCGTCGCTCAAGTCATCATTCGTGTGCGGCTGTGGGCTGTTGAA
AGTCCAAAGACCGTCTCAGACGAAGCTGTTGCTACTTCTGCTCAATCCTCCCCAGAAATGGAGCTCAGAGCCGTC
AACCCAAACAATAATAAGGCCCTCGAGAATATATAG
Gene >OphauB2|363
ATGACGGAACAGTCTGCCCCAACTCGGCCATTAATTTTCTGGTCGTCGCTGCTACCAAATGAGTCAACGTGGAAA
CGCTTCAAACGGACTTTTACTCTTACCCCTGAGCCCTTTGATGTCGAGAATCGTTTCGTCACCTCGTGGATCTTT
ACACCCTTTACACTGGCCGCCATCCGCATGACCATCGTGAGCTCCTTTGGCCCTCCCCCTGATACAAAGGAAAAA
AAAACAGCTGACAAAAACCACCTTAGGGCTCATACATCCTTTCAAGCATCCTCTTCATTATAGCCTGGTCTTGCT
CGCACCCAGCAACAACGGGCGGATGCGTCGCCTCGCGCCGCTCATTCTCCTACTTTACCGTACTTGCATTTTGGG
GCCAGGCCTTTTACTTCATCGTTGCCGCAATTCACACCTTCTTCCACGCTGCCTGGCCGGGCAATCTGTCTCTTC
TCTCTCGCTTCAGGCGCCCATTTGGCGCTCTTCACTCCTTTTTCTACTCGTCCGTCGTCGTCTTTCCGCTGCTGG
TTAGCATTATATACTGGGCCATGATATTCAAGGGTCCATGGCGCGGATCTACCTTTGACTCGTGGCGCAACGTGT
CGCAACATGCCTTGAATTCGGTCTTTGCCCTCATCGAGATGATCTTGGCTCGCACCTCCTTGTTACCCGTGGTTC
ATCTCTTGTGGCTCTTTTGCATTCTTGTCGCCTACCTGGGCGTGGCCTTTGTGACAAATATCGACCAGGATTTTT
TCGTATACGCCTTTCTCGATAAAAATAAAGTCGGAGGCCCTGGCCTGGTCGCCGCCTATATCGCCTGCGTCGCCA
TGGCCTTGGTCGTCGTCTTTATCGTCGCTCAAGTCATCATTCGTGTGCGGCTGTGGGCTGTTGAAAGTCCAAAGA
CCGTCTCAGACGAAGCTGTTGCTACTTCTGCTCAATCCTCCCCAGAAATGGAGCTCAGAGCCGTCAACCCAAACA
ATAATAAGGCCCTCGAGAATATATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail