Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3612
Gene name
LocationContig_23:94917..96644
Strand+
Gene length (bp)1727
Transcript length (bp)1170
Coding sequence length (bp)1170
Protein length (aa) 390

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00573 Ribosomal_L4 Ribosomal protein L4/L1 family 6.0E-36 61 304
PF14374 Ribos_L4_asso_C 60S ribosomal protein L4 C-terminal domain 1.7E-27 318 385

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P784|RL4B_SCHPO 60S ribosomal protein L4-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl401 PE=3 SV=1 39 380 2.0E-155
sp|P35679|RL4A_SCHPO 60S ribosomal protein L4-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl402 PE=1 SV=2 39 380 1.0E-154
sp|Q9SF40|RL4A_ARATH 60S ribosomal protein L4-1 OS=Arabidopsis thaliana GN=RPL4A PE=2 SV=1 39 377 4.0E-137
sp|P49691|RL4B_ARATH 60S ribosomal protein L4-2 OS=Arabidopsis thaliana GN=RPL4D PE=2 SV=2 39 377 3.0E-135
sp|P49626|RL4B_YEAST 60S ribosomal protein L4-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL4B PE=1 SV=2 40 387 4.0E-131
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P784|RL4B_SCHPO 60S ribosomal protein L4-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl401 PE=3 SV=1 39 380 2.0E-155
sp|P35679|RL4A_SCHPO 60S ribosomal protein L4-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl402 PE=1 SV=2 39 380 1.0E-154
sp|Q9SF40|RL4A_ARATH 60S ribosomal protein L4-1 OS=Arabidopsis thaliana GN=RPL4A PE=2 SV=1 39 377 4.0E-137
sp|P49691|RL4B_ARATH 60S ribosomal protein L4-2 OS=Arabidopsis thaliana GN=RPL4D PE=2 SV=2 39 377 3.0E-135
sp|P49626|RL4B_YEAST 60S ribosomal protein L4-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL4B PE=1 SV=2 40 387 4.0E-131
sp|P10664|RL4A_YEAST 60S ribosomal protein L4-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL4A PE=1 SV=4 40 387 5.0E-131
sp|P49165|RL4_URECA 60S ribosomal protein L4 OS=Urechis caupo GN=RPL4 PE=2 SV=1 38 376 7.0E-127
sp|Q9XF97|RL4_PRUAR 60S ribosomal protein L4 OS=Prunus armeniaca GN=RPL4 PE=2 SV=1 41 377 1.0E-124
sp|P08429|RL4A_XENLA 60S ribosomal protein L4-A OS=Xenopus laevis GN=rpl4-a PE=2 SV=2 39 377 1.0E-121
sp|P02385|RL4B_XENLA 60S ribosomal protein L4-B OS=Xenopus laevis GN=rpl4-b PE=2 SV=2 39 377 3.0E-121
sp|Q58DW0|RL4_BOVIN 60S ribosomal protein L4 OS=Bos taurus GN=RPL4 PE=2 SV=3 39 380 3.0E-118
sp|Q9D8E6|RL4_MOUSE 60S ribosomal protein L4 OS=Mus musculus GN=Rpl4 PE=1 SV=3 39 380 3.0E-118
sp|P50878|RL4_RAT 60S ribosomal protein L4 OS=Rattus norvegicus GN=Rpl4 PE=1 SV=3 39 380 3.0E-118
sp|Q5RCR3|RL4_PONAB 60S ribosomal protein L4 OS=Pongo abelii GN=RPL4 PE=2 SV=1 39 380 5.0E-118
sp|P36578|RL4_HUMAN 60S ribosomal protein L4 OS=Homo sapiens GN=RPL4 PE=1 SV=5 39 380 6.0E-118
sp|Q4R5P9|RL4_MACFA 60S ribosomal protein L4 OS=Macaca fascicularis GN=RPL4 PE=2 SV=1 39 380 9.0E-118
sp|Q28346|RL4_CANLF 60S ribosomal protein L4 OS=Canis lupus familiaris GN=RPL4 PE=1 SV=2 39 380 9.0E-116
sp|Q54Z69|RL4_DICDI 60S ribosomal protein L4 OS=Dictyostelium discoideum GN=rpl4 PE=1 SV=1 38 377 3.0E-110
sp|P49669|RL4_TRYBB 60S ribosomal protein L4 OS=Trypanosoma brucei brucei GN=RPL4 PE=3 SV=1 38 368 4.0E-110
sp|O02056|RL4_CAEEL 60S ribosomal protein L4 OS=Caenorhabditis elegans GN=rpl-4 PE=1 SV=3 38 382 5.0E-110
sp|P09180|RL4_DROME 60S ribosomal protein L4 OS=Drosophila melanogaster GN=RpL4 PE=1 SV=2 40 382 3.0E-109
sp|P0DJ55|RL4_TETTS 60S ribosomal protein L4 OS=Tetrahymena thermophila (strain SB210) GN=RPL4 PE=1 SV=1 38 383 3.0E-100
sp|O15594|RL4_ENTHI 60S ribosomal protein L4 (Fragments) OS=Entamoeba histolytica GN=RPL4 PE=2 SV=2 93 311 3.0E-66
sp|O26111|RL4_METTH 50S ribosomal protein L4 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rpl4 PE=3 SV=1 60 306 4.0E-52
sp|B6YSL4|RL4_THEON 50S ribosomal protein L4 OS=Thermococcus onnurineus (strain NA1) GN=rpl4 PE=3 SV=1 44 307 5.0E-46
sp|Q12ZV0|RL4_METBU 50S ribosomal protein L4 OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=rpl4 PE=3 SV=1 43 306 5.0E-46
sp|C6A160|RL4_THESM 50S ribosomal protein L4 OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=rpl4 PE=3 SV=1 44 307 7.0E-46
sp|Q8ZW51|RL4_PYRAE 50S ribosomal protein L4 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rpl4 PE=3 SV=1 44 306 1.0E-45
sp|A5UL88|RL4_METS3 50S ribosomal protein L4 OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=rpl4 PE=3 SV=1 60 306 9.0E-45
sp|C5A285|RL4_THEGJ 50S ribosomal protein L4 OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=rpl4 PE=3 SV=1 44 307 1.0E-44
sp|Q5JDI0|RL4_THEKO 50S ribosomal protein L4 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rpl4 PE=3 SV=1 44 307 2.0E-44
sp|Q2NFV7|RL4_METST 50S ribosomal protein L4 OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=rpl4 PE=3 SV=1 60 306 3.0E-44
sp|Q8TZZ9|RL4_PYRFU 50S ribosomal protein L4 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rpl4 PE=1 SV=1 44 307 2.0E-42
sp|Q9V1T6|RL4_PYRAB 50S ribosomal protein L4 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rpl4 PE=3 SV=1 44 307 6.0E-42
sp|O59420|RL4_PYRHO 50S ribosomal protein L4 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rpl4 PE=3 SV=1 44 307 2.0E-41
sp|Q2FU92|RL4_METHJ 50S ribosomal protein L4 OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=rpl4 PE=3 SV=1 60 302 5.0E-41
sp|Q9UXA6|RL4_SULSO 50S ribosomal protein L4 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rpl4 PE=3 SV=1 45 304 6.0E-41
sp|Q9YFM1|RL4_AERPE 50S ribosomal protein L4 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rpl4 PE=3 SV=3 60 302 9.0E-41
sp|O28355|RL4_ARCFU 50S ribosomal protein L4 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rpl4 PE=3 SV=1 60 304 1.0E-40
sp|C3NEE4|RL4_SULIY 50S ribosomal protein L4 OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=rpl4 PE=3 SV=1 46 304 1.0E-40
sp|C3NHA8|RL4_SULIN 50S ribosomal protein L4 OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=rpl4 PE=3 SV=1 46 304 1.0E-40
sp|A3CSZ8|RL4_METMJ 50S ribosomal protein L4 OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=rpl4 PE=3 SV=1 60 305 2.0E-40
sp|C3MVH9|RL4_SULIM 50S ribosomal protein L4 OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=rpl4 PE=3 SV=1 46 304 3.0E-40
sp|C4KHF7|RL4_SULIK 50S ribosomal protein L4 OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=rpl4 PE=3 SV=1 46 304 3.0E-40
sp|C3N5S8|RL4_SULIA 50S ribosomal protein L4 OS=Sulfolobus islandicus (strain M.16.27) GN=rpl4 PE=3 SV=1 46 304 3.0E-40
sp|B9LSS6|RL4_HALLT 50S ribosomal protein L4 OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=rpl4 PE=3 SV=1 50 304 2.0E-39
sp|C3MQ60|RL4_SULIL 50S ribosomal protein L4 OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=rpl4 PE=3 SV=1 46 304 2.0E-39
sp|A0B9W9|RL4_METTP 50S ribosomal protein L4 OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=rpl4 PE=3 SV=1 46 304 2.0E-39
sp|Q975I2|RL4_SULTO 50S ribosomal protein L4 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rpl4 PE=3 SV=2 60 302 3.0E-39
sp|Q8PV49|RL4_METMA 50S ribosomal protein L4 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rpl4 PE=3 SV=1 38 306 2.0E-38
sp|Q8TY91|RL4_METKA 50S ribosomal protein L4 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rpl4 PE=3 SV=1 60 308 3.0E-38
sp|Q8TRU6|RL4_METAC 50S ribosomal protein L4 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rpl4 PE=3 SV=1 38 306 3.0E-38
sp|Q4JB41|RL4_SULAC 50S ribosomal protein L4 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rpl4 PE=3 SV=1 60 302 4.0E-38
sp|Q46G96|RL4_METBF 50S ribosomal protein L4 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=rpl4 PE=3 SV=1 38 306 4.0E-38
sp|Q18GF0|RL4_HALWD 50S ribosomal protein L4 OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=rpl4 PE=3 SV=1 57 304 3.0E-37
sp|A7I5P0|RL4_METB6 50S ribosomal protein L4 OS=Methanoregula boonei (strain 6A8) GN=rpl4 PE=3 SV=1 60 303 9.0E-37
sp|A6UV67|RL4_META3 50S ribosomal protein L4 OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=rpl4 PE=3 SV=1 44 303 2.0E-36
sp|Q9HIR0|RL4_THEAC 50S ribosomal protein L4 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rpl4 PE=3 SV=1 60 305 9.0E-35
sp|P54015|RL4_METJA 50S ribosomal protein L4 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rpl4 PE=3 SV=1 60 306 3.0E-34
sp|Q3IMY7|RL4_NATPD 50S ribosomal protein L4 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=rpl4 PE=3 SV=1 50 299 2.0E-33
sp|A4FVY1|RL4_METM5 50S ribosomal protein L4 OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rpl4 PE=3 SV=1 43 303 2.0E-32
sp|B0R657|RL4_HALS3 50S ribosomal protein L4 OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=rpl4 PE=3 SV=1 44 302 5.0E-32
sp|A6UQJ1|RL4_METVS 50S ribosomal protein L4 OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rpl4 PE=3 SV=1 43 306 5.0E-32
sp|Q9HPD3|RL4_HALSA 50S ribosomal protein L4 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rpl4 PE=1 SV=1 44 302 5.0E-32
sp|P60846|RL4_METMP 50S ribosomal protein L4 OS=Methanococcus maripaludis (strain S2 / LL) GN=rpl4 PE=3 SV=1 43 303 1.0E-31
sp|A6VHD3|RL4_METM7 50S ribosomal protein L4 OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rpl4 PE=3 SV=1 43 303 1.0E-31
sp|Q97BX6|RL4_THEVO 50S ribosomal protein L4 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=rpl4 PE=3 SV=1 60 304 1.0E-31
sp|A9A9B7|RL4_METM6 50S ribosomal protein L4 OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=rpl4 PE=3 SV=1 43 303 9.0E-31
sp|P12735|RL4_HALMA 50S ribosomal protein L4 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rpl4 PE=1 SV=4 45 299 9.0E-29
sp|P60847|RL4_NANEQ 50S ribosomal protein L4 OS=Nanoarchaeum equitans (strain Kin4-M) GN=rpl4 PE=3 SV=1 60 304 3.0E-27
sp|P14117|RL4_XENTR 60S ribosomal protein L4 (Fragment) OS=Xenopus tropicalis GN=rpl4 PE=3 SV=1 274 366 2.0E-20
[Show less]

GO

GO Term Description Terminal node
GO:0003735 structural constituent of ribosome Yes
GO:0005840 ribosome Yes
GO:0006412 translation Yes
GO:0043228 non-membrane-bounded organelle No
GO:0110165 cellular anatomical entity No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0043226 organelle No
GO:1901576 organic substance biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0043603 cellular amide metabolic process No
GO:0003674 molecular_function No
GO:0009059 macromolecule biosynthetic process No
GO:0005198 structural molecule activity No
GO:0008150 biological_process No
GO:0005575 cellular_component No
GO:0043170 macromolecule metabolic process No
GO:0006518 peptide metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0043604 amide biosynthetic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044237 cellular metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0044238 primary metabolic process No
GO:0009058 biosynthetic process No
GO:0043043 peptide biosynthetic process No
GO:0019538 protein metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0043229 intracellular organelle No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3612
MPGSIEFYQHKNSSPIRFQSPYTTTPHDDRGSSLSRTMASRPTVSIIGKDGTPTGATHPIPAVFSSPIRPDIVQK
VHTGMAKNKRQPYAVSEKAGHQTSAESWGTGRAVARIPRVSGGGTHRAGQAAFGNMCRSGRMFAPTKIWRKWHIK
INQGQKRYATCSALAASAAVPLLMARGHQVMTIPEVPLVVDSVLFDSGAMGRTAASLSLLRSVGAGADVDKAKNS
KKLRAGKGKMRGRRYRQRRGPLVVYSPDTDGKELVKGFRNIPGVETCPVTALNLLQLAPGGHLGRFIVWTSAAFK
ALDDIYGNTTEPSAHKRDFLLPSNVVSQADLTRLINSSEIQSSLNAPKGEAVTRRSAVQKKNPLRNKQVMLRLNP
YASVFAKEGQKKLS*
Coding >OphauB2|3612
ATGCCTGGTTCAATCGAATTTTACCAACATAAAAATTCGTCCCCGATTCGCTTCCAATCGCCCTATACTACCACG
CCGCACGACGATCGAGGTTCGAGTCTCTCACGCACAATGGCTTCGCGACCTACCGTCTCTATCATCGGCAAAGAT
GGCACTCCCACGGGAGCTACCCATCCTATTCCTGCCGTTTTCAGCAGCCCTATCCGACCGGATATTGTCCAAAAG
GTGCATACTGGCATGGCAAAGAACAAGCGACAGCCGTATGCTGTGAGCGAGAAGGCTGGCCACCAGACATCTGCT
GAATCATGGGGAACTGGTCGCGCTGTCGCTCGTATCCCCCGTGTTTCTGGTGGTGGTACTCACCGTGCCGGTCAG
GCTGCTTTCGGTAACATGTGTCGTTCCGGCCGCATGTTTGCTCCTACCAAAATTTGGCGCAAGTGGCACATCAAG
ATCAACCAGGGCCAGAAGCGCTATGCTACTTGCTCTGCTCTGGCTGCTTCTGCCGCTGTTCCACTATTGATGGCT
CGCGGTCACCAGGTCATGACTATTCCAGAAGTTCCTCTGGTGGTCGACTCTGTACTCTTTGATTCCGGTGCCATG
GGTCGCACTGCCGCTTCTTTGAGCCTCCTCAGGTCTGTTGGCGCCGGCGCCGATGTCGACAAGGCCAAGAATTCC
AAGAAGCTCCGCGCTGGCAAAGGCAAGATGCGTGGACGCCGTTACCGTCAGCGACGTGGACCCCTTGTTGTCTAT
TCTCCCGATACAGACGGCAAGGAGCTCGTCAAGGGCTTCCGCAACATTCCAGGTGTCGAGACCTGCCCTGTGACG
GCTTTGAATCTGCTTCAACTCGCTCCTGGCGGCCATCTTGGCCGCTTCATTGTATGGACCTCGGCCGCCTTCAAG
GCTCTCGACGACATCTATGGCAACACTACTGAGCCATCAGCTCACAAGCGCGACTTCCTGTTGCCTTCGAATGTC
GTCTCGCAAGCCGACCTGACACGCCTGATCAACAGCTCCGAAATCCAGAGCTCTCTCAACGCTCCCAAGGGCGAA
GCCGTTACCAGGAGATCTGCGGTGCAGAAGAAGAACCCGCTTCGCAACAAGCAGGTGATGCTGCGTCTGAATCCT
TATGCTTCCGTTTTCGCCAAGGAGGGACAGAAGAAGCTGTCGTAA
Transcript >OphauB2|3612
ATGCCTGGTTCAATCGAATTTTACCAACATAAAAATTCGTCCCCGATTCGCTTCCAATCGCCCTATACTACCACG
CCGCACGACGATCGAGGTTCGAGTCTCTCACGCACAATGGCTTCGCGACCTACCGTCTCTATCATCGGCAAAGAT
GGCACTCCCACGGGAGCTACCCATCCTATTCCTGCCGTTTTCAGCAGCCCTATCCGACCGGATATTGTCCAAAAG
GTGCATACTGGCATGGCAAAGAACAAGCGACAGCCGTATGCTGTGAGCGAGAAGGCTGGCCACCAGACATCTGCT
GAATCATGGGGAACTGGTCGCGCTGTCGCTCGTATCCCCCGTGTTTCTGGTGGTGGTACTCACCGTGCCGGTCAG
GCTGCTTTCGGTAACATGTGTCGTTCCGGCCGCATGTTTGCTCCTACCAAAATTTGGCGCAAGTGGCACATCAAG
ATCAACCAGGGCCAGAAGCGCTATGCTACTTGCTCTGCTCTGGCTGCTTCTGCCGCTGTTCCACTATTGATGGCT
CGCGGTCACCAGGTCATGACTATTCCAGAAGTTCCTCTGGTGGTCGACTCTGTACTCTTTGATTCCGGTGCCATG
GGTCGCACTGCCGCTTCTTTGAGCCTCCTCAGGTCTGTTGGCGCCGGCGCCGATGTCGACAAGGCCAAGAATTCC
AAGAAGCTCCGCGCTGGCAAAGGCAAGATGCGTGGACGCCGTTACCGTCAGCGACGTGGACCCCTTGTTGTCTAT
TCTCCCGATACAGACGGCAAGGAGCTCGTCAAGGGCTTCCGCAACATTCCAGGTGTCGAGACCTGCCCTGTGACG
GCTTTGAATCTGCTTCAACTCGCTCCTGGCGGCCATCTTGGCCGCTTCATTGTATGGACCTCGGCCGCCTTCAAG
GCTCTCGACGACATCTATGGCAACACTACTGAGCCATCAGCTCACAAGCGCGACTTCCTGTTGCCTTCGAATGTC
GTCTCGCAAGCCGACCTGACACGCCTGATCAACAGCTCCGAAATCCAGAGCTCTCTCAACGCTCCCAAGGGCGAA
GCCGTTACCAGGAGATCTGCGGTGCAGAAGAAGAACCCGCTTCGCAACAAGCAGGTGATGCTGCGTCTGAATCCT
TATGCTTCCGTTTTCGCCAAGGAGGGACAGAAGAAGCTGTCGTAA
Gene >OphauB2|3612
ATGCCTGGTTCAATGTACAAAATCGCGCAAATCTCGCCTACACACTCACTCACACACAAGAACAAGGCCAACTTC
TCATAGAATTTTTTTCCATGAGACTGTACCAATAGTTTCTTCTTCACTCAATCAATCCAATACTATTAGTACTAG
TATCTGAGAAACAGTCTCCTTTACAGCTTGGCCTGTCGAGTTTCTGGAGTGGTGATAGACCCACTCATGGAGGGC
TTTGCTGCCTAATTGTCCAATCGCGAGTCGGCTGACCGAACACAGCGCTTAAAGTCCGGCAACTGAGTTGGTTAG
GGTCTTGGCCCACAACAATTCGCAGCGAATTTTACCAACATAAAAATTCGTCCCCGATTCGCTTCCAATCGCCCT
ATACTACCACGCCGCACGACGATCGAGGTAATTCTCCCTGACGCATCTACTTTGAACGGACTACTAAATCAGTTC
TTTCGTACAGGTTCGAGTCTCTCACGCACAATGGCTTCGCGACCTACCGTCTCTATCATCGGCAAAGATGGCACT
CCCACGGGAGCTACCCATCCTATTCCTGCCGTTTTCAGCAGCCCTATCCGACCGGATATTGTCCAAAAGGTGCAT
ACTGGCATGGCAAAGAACAAGCGACAGCCGTATGCTGTGAGCGAGAAGGCTGGCCACCAGACATCTGCTGAATCA
TGGGGAACTGGTAAGTCAAATTGAAACCAAGTCAGGCAGTGGGACAGCGCAGAATTTGCTGTGTCATACCTACTG
CACTCTGCCTATGTGCTATACAACTATCTAGCTGCCATTGCCAAAGACTCACAGAAATCACATAGGTCGCGCTGT
CGCTCGTATCCCCCGTGTTTCTGGTGGTGGTACTCACCGTGCCGGTCAGGCTGCTTTCGGTAACATGTGTCGTTC
CGGCCGCATGTTTGCTCCTACCAAAATTTGGCGCAAGTGGCACATCAAGATCAACCAGGGCCAGAAGTAGGTGTC
TTTGATGCGTTCGCGTAAAAAGAATACTTGATGCTAACCAAGGCTTAAGGCGCTATGCTACTTGCTCTGCTCTGG
CTGCTTCTGCCGCTGTTCCACTATTGATGGCTCGCGGTCACCAGGTCATGACTATTCCAGAAGTTCCTCTGGTGG
TCGACTCTGTACTCTTTGATTCCGGTGCCATGGGTCGCACTGCCGCTTCTTTGAGCCTCCTCAGGTCTGTTGGCG
CCGGCGCCGATGTCGACAAGGCCAAGAATTCCAAGAAGCTCCGCGCTGGCAAAGGCAAGATGCGTGGACGCCGTT
ACCGTCAGCGACGTGGACCCCTTGTTGTCTATTCTCCCGATACAGACGGCAAGGAGCTCGTCAAGGGCTTCCGCA
ACATTCCAGGTGTCGAGACCTGCCCTGTGACGGCTTTGAATCTGCTTCAACTCGCTCCTGGCGGCCATCTTGGCC
GCTTCATTGTATGGACCTCGGCCGCCTTCAAGGCTCTCGACGACATCTATGGCAACACTACTGAGCCATCAGCTC
ACAAGCGCGACTTCCTGTTGCCTTCGAATGTCGTCTCGCAAGCCGACCTGACACGCCTGATCAACAGCTCCGAAA
TCCAGAGCTCTCTCAACGCTCCCAAGGGCGAAGCCGTTACCAGGAGATCTGCGGTGCAGAAGAAGAACCCGCTTC
GCAACAAGCAGGTGATGCTGCGTCTGAATCCTTATGCTTCCGTTTTCGCCAAGGAGGGACAGAAGAAGCTGTCGT
AA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail