Protein ID | OphauB2|3608 |
Gene name | |
Location | Contig_23:87958..89412 |
Strand | - |
Gene length (bp) | 1454 |
Transcript length (bp) | 1341 |
Coding sequence length (bp) | 1341 |
Protein length (aa) | 447 |
PFAM Domain ID | Short name | Long name | E-value | Start | End |
---|---|---|---|---|---|
PF00009 | GTP_EFTU | Elongation factor Tu GTP binding domain | 4.5E-55 | 53 | 246 |
PF03143 | GTP_EFTU_D3 | Elongation factor Tu C-terminal domain | 3.7E-31 | 344 | 444 |
PF03144 | GTP_EFTU_D2 | Elongation factor Tu domain 2 | 2.8E-15 | 270 | 340 |
PF01926 | MMR_HSR1 | 50S ribosome-binding GTPase | 4.8E-05 | 58 | 166 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|P02992|EFTU_YEAST | Elongation factor Tu, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUF1 PE=1 SV=1 | 47 | 446 | 0.0E+00 |
sp|A5DN78|EFTU_PICGU | Elongation factor Tu, mitochondrial OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=TUF1 PE=3 SV=1 | 30 | 446 | 0.0E+00 |
sp|Q9Y700|EFTU_SCHPO | Elongation factor Tu, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tuf1 PE=3 SV=1 | 36 | 445 | 0.0E+00 |
sp|B9MQH1|EFTU_CALBD | Elongation factor Tu OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=tuf PE=3 SV=1 | 47 | 446 | 0.0E+00 |
sp|A4XI37|EFTU_CALS8 | Elongation factor Tu OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=tuf PE=3 SV=1 | 47 | 446 | 0.0E+00 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|P02992|EFTU_YEAST | Elongation factor Tu, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUF1 PE=1 SV=1 | 47 | 446 | 0.0E+00 |
sp|A5DN78|EFTU_PICGU | Elongation factor Tu, mitochondrial OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=TUF1 PE=3 SV=1 | 30 | 446 | 0.0E+00 |
sp|Q9Y700|EFTU_SCHPO | Elongation factor Tu, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tuf1 PE=3 SV=1 | 36 | 445 | 0.0E+00 |
sp|B9MQH1|EFTU_CALBD | Elongation factor Tu OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=tuf PE=3 SV=1 | 47 | 446 | 0.0E+00 |
sp|A4XI37|EFTU_CALS8 | Elongation factor Tu OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=tuf PE=3 SV=1 | 47 | 446 | 0.0E+00 |
sp|A7HWP7|EFTU_PARL1 | Elongation factor Tu OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=tuf1 PE=3 SV=1 | 49 | 446 | 0.0E+00 |
sp|A5V604|EFTU_SPHWW | Elongation factor Tu OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=tuf PE=3 SV=1 | 47 | 446 | 0.0E+00 |
sp|Q07KJ2|EFTU_RHOP5 | Elongation factor Tu OS=Rhodopseudomonas palustris (strain BisA53) GN=tuf1 PE=3 SV=1 | 47 | 446 | 2.0E-180 |
sp|Q211E6|EFTU_RHOPB | Elongation factor Tu OS=Rhodopseudomonas palustris (strain BisB18) GN=tuf PE=3 SV=1 | 47 | 446 | 3.0E-180 |
sp|Q2W2H3|EFTU_MAGSA | Elongation factor Tu OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=tuf1 PE=3 SV=1 | 47 | 446 | 8.0E-180 |
sp|Q0BUQ2|EFTU_GRABC | Elongation factor Tu OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=tuf PE=3 SV=1 | 47 | 444 | 8.0E-180 |
sp|Q2IXR2|EFTU_RHOP2 | Elongation factor Tu OS=Rhodopseudomonas palustris (strain HaA2) GN=tuf1 PE=3 SV=1 | 47 | 446 | 9.0E-180 |
sp|Q134R0|EFTU2_RHOPS | Elongation factor Tu 2 OS=Rhodopseudomonas palustris (strain BisB5) GN=tuf2 PE=3 SV=1 | 47 | 446 | 1.0E-179 |
sp|Q1QN32|EFTU_NITHX | Elongation factor Tu OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=tuf PE=3 SV=1 | 47 | 446 | 1.0E-179 |
sp|P42480|EFTU_HYMOC | Elongation factor Tu OS=Hymenobacter ocellatus GN=tuf PE=3 SV=1 | 49 | 445 | 1.0E-179 |
sp|Q134S7|EFTU1_RHOPS | Elongation factor Tu 1 OS=Rhodopseudomonas palustris (strain BisB5) GN=tuf1 PE=3 SV=1 | 47 | 446 | 1.0E-179 |
sp|Q6N4Q4|EFTU_RHOPA | Elongation factor Tu OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=tuf1 PE=3 SV=1 | 47 | 446 | 3.0E-179 |
sp|Q5NQ65|EFTU_ZYMMO | Elongation factor Tu OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=tuf PE=3 SV=1 | 47 | 446 | 4.0E-179 |
sp|Q5GWR8|EFTU_XANOR | Elongation factor Tu OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=tuf1 PE=3 SV=1 | 47 | 446 | 5.0E-179 |
sp|Q2NZX1|EFTU_XANOM | Elongation factor Tu OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=tuf1 PE=3 SV=1 | 47 | 446 | 5.0E-179 |
sp|Q3SSW8|EFTU_NITWN | Elongation factor Tu OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=tuf PE=3 SV=1 | 47 | 446 | 1.0E-178 |
sp|P33165|EFTU_BACFR | Elongation factor Tu OS=Bacteroides fragilis (strain YCH46) GN=tuf PE=3 SV=1 | 49 | 445 | 3.0E-178 |
sp|Q5L890|EFTU_BACFN | Elongation factor Tu OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=tuf PE=3 SV=1 | 49 | 445 | 3.0E-178 |
sp|A6Q1L5|EFTU_NITSB | Elongation factor Tu OS=Nitratiruptor sp. (strain SB155-2) GN=tuf PE=3 SV=1 | 49 | 446 | 2.0E-177 |
sp|A9H3R7|EFTU_GLUDA | Elongation factor Tu OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=tuf PE=3 SV=1 | 47 | 444 | 2.0E-177 |
sp|Q3BWY6|EFTU_XANC5 | Elongation factor Tu OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=tuf1 PE=3 SV=1 | 47 | 446 | 3.0E-177 |
sp|Q8NL22|EFTU_XANAC | Elongation factor Tu OS=Xanthomonas axonopodis pv. citri (strain 306) GN=tufA PE=3 SV=1 | 47 | 446 | 3.0E-177 |
sp|Q5FTY1|EFTU_GLUOX | Elongation factor Tu OS=Gluconobacter oxydans (strain 621H) GN=tuf PE=3 SV=1 | 47 | 444 | 3.0E-177 |
sp|A7HBL7|EFTU_ANADF | Elongation factor Tu OS=Anaeromyxobacter sp. (strain Fw109-5) GN=tuf1 PE=3 SV=1 | 49 | 446 | 6.0E-177 |
sp|Q11Q98|EFTU_CYTH3 | Elongation factor Tu OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=tuf PE=3 SV=1 | 49 | 446 | 4.0E-176 |
sp|B2UQY9|EFTU_AKKM8 | Elongation factor Tu OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=tuf PE=3 SV=1 | 49 | 445 | 6.0E-176 |
sp|Q1D7V1|EFTU1_MYXXD | Elongation factor Tu 1 OS=Myxococcus xanthus (strain DK 1622) GN=tuf1 PE=3 SV=1 | 49 | 446 | 3.0E-175 |
sp|Q1D776|EFTU2_MYXXD | Elongation factor Tu 2 OS=Myxococcus xanthus (strain DK 1622) GN=tuf2 PE=3 SV=1 | 49 | 446 | 3.0E-175 |
sp|Q605B0|EFTU_METCA | Elongation factor Tu OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=tuf1 PE=3 SV=1 | 49 | 446 | 5.0E-175 |
sp|B2RL52|EFTU_PORG3 | Elongation factor Tu OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=tuf PE=3 SV=1 | 49 | 445 | 6.0E-175 |
sp|A6LPP6|EFTU_CLOB8 | Elongation factor Tu OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=tuf1 PE=3 SV=1 | 47 | 446 | 9.0E-175 |
sp|P50068|EFTU_UREPA | Elongation factor Tu OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=tuf PE=3 SV=1 | 47 | 443 | 1.0E-174 |
sp|B1AJG3|EFTU_UREP2 | Elongation factor Tu OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=tuf PE=3 SV=1 | 47 | 443 | 1.0E-174 |
sp|B5ZC31|EFTU_UREU1 | Elongation factor Tu OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=tuf PE=3 SV=1 | 47 | 443 | 1.0E-174 |
sp|A4WVL0|EFTU_RHOS5 | Elongation factor Tu OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=tuf1 PE=3 SV=1 | 47 | 445 | 1.0E-174 |
sp|B3QY22|EFTU_CHLT3 | Elongation factor Tu OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=tuf PE=3 SV=1 | 49 | 446 | 2.0E-174 |
sp|A5FZW7|EFTU_ACICJ | Elongation factor Tu OS=Acidiphilium cryptum (strain JF-5) GN=tuf PE=3 SV=1 | 47 | 446 | 2.0E-174 |
sp|P42482|EFTU_WOLSU | Elongation factor Tu OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=tuf PE=3 SV=2 | 49 | 446 | 2.0E-174 |
sp|B5Z8K3|EFTU_HELPG | Elongation factor Tu OS=Helicobacter pylori (strain G27) GN=tuf PE=3 SV=1 | 49 | 446 | 3.0E-174 |
sp|B6JN44|EFTU_HELP2 | Elongation factor Tu OS=Helicobacter pylori (strain P12) GN=tuf PE=3 SV=1 | 49 | 446 | 3.0E-174 |
sp|B2UUW8|EFTU_HELPS | Elongation factor Tu OS=Helicobacter pylori (strain Shi470) GN=tuf PE=3 SV=1 | 49 | 446 | 5.0E-174 |
sp|Q2RFP5|EFTU_MOOTA | Elongation factor Tu OS=Moorella thermoacetica (strain ATCC 39073) GN=tuf PE=3 SV=1 | 49 | 446 | 6.0E-174 |
sp|A5N4N1|EFTU_CLOK5 | Elongation factor Tu OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=tuf1 PE=3 SV=1 | 49 | 444 | 1.0E-173 |
sp|B1KSM7|EFTU_CLOBM | Elongation factor Tu OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=tuf1 PE=3 SV=1 | 47 | 444 | 1.0E-173 |
sp|Q6AP73|EFTU2_DESPS | Elongation factor Tu 2 OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=tuf2 PE=3 SV=1 | 49 | 446 | 1.0E-173 |
sp|Q3J5S4|EFTU_RHOS4 | Elongation factor Tu OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=tuf1 PE=3 SV=1 | 47 | 445 | 1.0E-173 |
sp|A3PGI1|EFTU_RHOS1 | Elongation factor Tu OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=tuf1 PE=3 SV=1 | 47 | 445 | 1.0E-173 |
sp|Q2YAZ9|EFTU_NITMU | Elongation factor Tu OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=tuf1 PE=3 SV=1 | 49 | 446 | 2.0E-173 |
sp|A9ISD9|EFTU_BART1 | Elongation factor Tu OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=tuf1 PE=3 SV=1 | 49 | 446 | 2.0E-173 |
sp|A7GJ76|EFTU_CLOBL | Elongation factor Tu OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=tuf1 PE=3 SV=1 | 47 | 444 | 2.0E-173 |
sp|B1IGF6|EFTU_CLOBK | Elongation factor Tu OS=Clostridium botulinum (strain Okra / Type B1) GN=tuf1 PE=3 SV=1 | 47 | 444 | 2.0E-173 |
sp|A5I7K8|EFTU_CLOBH | Elongation factor Tu OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=tuf1 PE=3 SV=1 | 47 | 444 | 2.0E-173 |
sp|A7FZ71|EFTU_CLOB1 | Elongation factor Tu OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=tuf1 PE=3 SV=1 | 47 | 444 | 2.0E-173 |
sp|P56003|EFTU_HELPY | Elongation factor Tu OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=tuf PE=3 SV=1 | 49 | 446 | 3.0E-173 |
sp|Q2II78|EFTU_ANADE | Elongation factor Tu OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=tuf1 PE=3 SV=1 | 49 | 446 | 3.0E-173 |
sp|A1SNN5|EFTU_NOCSJ | Elongation factor Tu OS=Nocardioides sp. (strain BAA-499 / JS614) GN=tuf PE=3 SV=1 | 47 | 446 | 3.0E-173 |
sp|A7GZK6|EFTU_CAMC5 | Elongation factor Tu OS=Campylobacter curvus (strain 525.92) GN=tuf PE=3 SV=1 | 49 | 445 | 5.0E-173 |
sp|B0RU96|EFTU2_XANCB | Elongation factor Tu 2 OS=Xanthomonas campestris pv. campestris (strain B100) GN=tuf2 PE=3 SV=1 | 47 | 446 | 7.0E-173 |
sp|Q4URC5|EFTU2_XANC8 | Elongation factor Tu 2 OS=Xanthomonas campestris pv. campestris (strain 8004) GN=tuf2 PE=3 SV=1 | 47 | 446 | 7.0E-173 |
sp|Q8PC59|EFTU1_XANCP | Elongation factor Tu-A OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=tufA PE=3 SV=1 | 47 | 446 | 7.0E-173 |
sp|A1B002|EFTU_PARDP | Elongation factor Tu OS=Paracoccus denitrificans (strain Pd 1222) GN=tuf1 PE=3 SV=1 | 47 | 446 | 8.0E-173 |
sp|A0RQJ3|EFTU_CAMFF | Elongation factor Tu OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=tuf PE=3 SV=1 | 49 | 445 | 8.0E-173 |
sp|P42481|EFTU_THIDL | Elongation factor Tu OS=Thiomonas delicata GN=tuf PE=3 SV=1 | 49 | 446 | 8.0E-173 |
sp|Q1AU14|EFTU_RUBXD | Elongation factor Tu OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=tuf1 PE=3 SV=1 | 47 | 446 | 1.0E-172 |
sp|Q8PC51|EFTU2_XANCP | Elongation factor Tu-B OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=tufB PE=3 SV=1 | 47 | 446 | 1.0E-172 |
sp|Q4URD7|EFTU1_XANC8 | Elongation factor Tu 1 OS=Xanthomonas campestris pv. campestris (strain 8004) GN=tuf1 PE=3 SV=1 | 47 | 446 | 1.0E-172 |
sp|Q123F6|EFTU_POLSJ | Elongation factor Tu OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=tuf1 PE=3 SV=1 | 49 | 445 | 1.0E-172 |
sp|A5EX84|EFTU_DICNV | Elongation factor Tu OS=Dichelobacter nodosus (strain VCS1703A) GN=tuf PE=3 SV=1 | 49 | 446 | 1.0E-172 |
sp|A7ZCN0|EFTU_CAMC1 | Elongation factor Tu OS=Campylobacter concisus (strain 13826) GN=tuf PE=3 SV=1 | 49 | 445 | 2.0E-172 |
sp|Q6AP86|EFTU1_DESPS | Elongation factor Tu 1 OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=tuf1 PE=3 SV=1 | 49 | 445 | 2.0E-172 |
sp|C4Z2R9|EFTU_EUBE2 | Elongation factor Tu OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=tuf PE=3 SV=1 | 47 | 446 | 2.0E-172 |
sp|Q3J8Q0|EFTU_NITOC | Elongation factor Tu OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=tuf1 PE=3 SV=1 | 49 | 446 | 3.0E-172 |
sp|Q2G8Y2|EFTU_NOVAD | Elongation factor Tu OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=tuf PE=3 SV=1 | 47 | 446 | 3.0E-172 |
sp|Q21RV6|EFTU2_RHOFT | Elongation factor Tu 2 OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=tuf2 PE=3 SV=1 | 49 | 445 | 3.0E-172 |
sp|A8GT71|EFTU_RICRS | Elongation factor Tu OS=Rickettsia rickettsii (strain Sheila Smith) GN=tuf PE=3 SV=1 | 47 | 444 | 4.0E-172 |
sp|B0BUR2|EFTU_RICRO | Elongation factor Tu OS=Rickettsia rickettsii (strain Iowa) GN=tuf PE=3 SV=1 | 47 | 444 | 4.0E-172 |
sp|C4K2I2|EFTU_RICPU | Elongation factor Tu OS=Rickettsia peacockii (strain Rustic) GN=tuf PE=3 SV=1 | 47 | 444 | 4.0E-172 |
sp|C3PPA9|EFTU_RICAE | Elongation factor Tu OS=Rickettsia africae (strain ESF-5) GN=tuf PE=3 SV=1 | 47 | 444 | 4.0E-172 |
sp|A8EZL8|EFTU_RICCK | Elongation factor Tu OS=Rickettsia canadensis (strain McKiel) GN=tuf PE=3 SV=1 | 47 | 444 | 4.0E-172 |
sp|B0RU84|EFTU1_XANCB | Elongation factor Tu 1 OS=Xanthomonas campestris pv. campestris (strain B100) GN=tuf1 PE=3 SV=1 | 47 | 446 | 4.0E-172 |
sp|Q6MU81|EFTU_MYCMS | Elongation factor Tu OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=tuf PE=3 SV=1 | 49 | 446 | 5.0E-172 |
sp|Q2SSW8|EFTU_MYCCT | Elongation factor Tu OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=tuf PE=3 SV=1 | 49 | 446 | 5.0E-172 |
sp|Q21SF0|EFTU1_RHOFT | Elongation factor Tu 1 OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=tuf1 PE=3 SV=1 | 49 | 445 | 5.0E-172 |
sp|Q2L2G6|EFTU_BORA1 | Elongation factor Tu OS=Bordetella avium (strain 197N) GN=tuf1 PE=3 SV=1 | 49 | 446 | 6.0E-172 |
sp|Q4K519|EFTU_PSEF5 | Elongation factor Tu OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=tuf1 PE=3 SV=1 | 49 | 446 | 6.0E-172 |
sp|Q92GW4|EFTU_RICCN | Elongation factor Tu OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=tuf PE=3 SV=1 | 47 | 444 | 7.0E-172 |
sp|Q7VJ74|EFTU_HELHP | Elongation factor Tu OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=tuf PE=3 SV=1 | 49 | 446 | 7.0E-172 |
sp|A8F2E9|EFTU_RICM5 | Elongation factor Tu OS=Rickettsia massiliae (strain Mtu5) GN=tuf PE=3 SV=2 | 47 | 444 | 8.0E-172 |
sp|Q01698|EFTU_THEAQ | Elongation factor Tu OS=Thermus aquaticus GN=tuf PE=1 SV=2 | 49 | 446 | 8.0E-172 |
sp|Q1LI13|EFTU_CUPMC | Elongation factor Tu OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=tuf1 PE=3 SV=1 | 49 | 445 | 9.0E-172 |
sp|Q3A9P8|EFTU2_CARHZ | Elongation factor Tu 2 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=tuf2 PE=3 SV=1 | 47 | 444 | 9.0E-172 |
sp|A8YUS2|EFTU_LACH4 | Elongation factor Tu OS=Lactobacillus helveticus (strain DPC 4571) GN=tuf PE=3 SV=1 | 49 | 445 | 1.0E-171 |
sp|Q8R7T8|EFTU2_CALS4 | Elongation factor Tu-B OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=tufB PE=3 SV=1 | 49 | 446 | 1.0E-171 |
sp|Q8KT99|EFTU_RICHE | Elongation factor Tu OS=Rickettsia helvetica GN=tuf PE=3 SV=1 | 47 | 444 | 1.0E-171 |
sp|B9KFF9|EFTU_CAMLR | Elongation factor Tu OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=tuf PE=3 SV=1 | 49 | 446 | 1.0E-171 |
sp|B0TC54|EFTU_HELMI | Elongation factor Tu OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=tuf PE=3 SV=1 | 47 | 446 | 1.0E-171 |
sp|Q0K5Z9|EFTU_CUPNH | Elongation factor Tu OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=tuf1 PE=3 SV=1 | 49 | 445 | 1.0E-171 |
sp|Q46WC7|EFTU_CUPPJ | Elongation factor Tu OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=tuf1 PE=3 SV=1 | 49 | 445 | 1.0E-171 |
sp|P48865|EFTU_RICPR | Elongation factor Tu OS=Rickettsia prowazekii (strain Madrid E) GN=tuf PE=3 SV=2 | 47 | 444 | 2.0E-171 |
sp|A0LRL8|EFTU_ACIC1 | Elongation factor Tu OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=tuf PE=3 SV=1 | 47 | 446 | 2.0E-171 |
sp|P0A3B0|EFTU_RICSI | Elongation factor Tu OS=Rickettsia sibirica GN=tuf PE=3 SV=1 | 47 | 444 | 2.0E-171 |
sp|P0A3A9|EFTU_RICRI | Elongation factor Tu OS=Rickettsia rickettsii GN=tuf PE=3 SV=1 | 47 | 444 | 2.0E-171 |
sp|Q3A9R3|EFTU1_CARHZ | Elongation factor Tu 1 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=tuf1 PE=3 SV=1 | 47 | 444 | 2.0E-171 |
sp|Q6F0J5|EFTU_MESFL | Elongation factor Tu OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=tuf PE=3 SV=1 | 49 | 444 | 3.0E-171 |
sp|Q5FKR8|EFTU_LACAC | Elongation factor Tu OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=tuf PE=3 SV=1 | 49 | 445 | 3.0E-171 |
sp|Q7TT91|EFTU_BORPE | Elongation factor Tu OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=tuf1 PE=3 SV=1 | 49 | 446 | 3.0E-171 |
sp|Q79GC6|EFTU_BORPA | Elongation factor Tu OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=tuf1 PE=3 SV=1 | 49 | 446 | 3.0E-171 |
sp|Q79G84|EFTU_BORBR | Elongation factor Tu OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=tuf1 PE=3 SV=1 | 49 | 446 | 3.0E-171 |
sp|A1WVD6|EFTU2_HALHL | Elongation factor Tu 2 OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=tuf2 PE=3 SV=1 | 49 | 445 | 3.0E-171 |
sp|Q47LJ1|EFTU_THEFY | Elongation factor Tu OS=Thermobifida fusca (strain YX) GN=tuf PE=3 SV=1 | 47 | 446 | 4.0E-171 |
sp|Q04B37|EFTU_LACDB | Elongation factor Tu OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=tuf PE=3 SV=1 | 49 | 444 | 4.0E-171 |
sp|Q1GAQ0|EFTU_LACDA | Elongation factor Tu OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=tuf PE=3 SV=1 | 49 | 444 | 4.0E-171 |
sp|Q72GW4|EFTU_THET2 | Elongation factor Tu OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=tuf1 PE=3 SV=1 | 49 | 446 | 4.0E-171 |
sp|A9BCK0|EFTU_PROM4 | Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9211) GN=tuf PE=3 SV=1 | 49 | 446 | 5.0E-171 |
sp|P18906|EFTU_MYCGA | Elongation factor Tu OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=tuf PE=3 SV=1 | 49 | 446 | 5.0E-171 |
sp|A4VHM8|EFTU2_PSEU5 | Elongation factor Tu 2 OS=Pseudomonas stutzeri (strain A1501) GN=tuf2 PE=3 SV=1 | 49 | 446 | 5.0E-171 |
sp|Q8KT95|EFTU_RICTY | Elongation factor Tu OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=tuf PE=3 SV=2 | 47 | 444 | 5.0E-171 |
sp|Q8R7V2|EFTU1_CALS4 | Elongation factor Tu-A OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=tufA PE=3 SV=1 | 49 | 446 | 5.0E-171 |
sp|Q8XGZ0|EFTU_RALSO | Elongation factor Tu OS=Ralstonia solanacearum (strain GMI1000) GN=tufA PE=3 SV=1 | 49 | 446 | 5.0E-171 |
sp|A1WVC4|EFTU1_HALHL | Elongation factor Tu 1 OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=tuf1 PE=3 SV=1 | 49 | 446 | 6.0E-171 |
sp|A4XZ92|EFTU_PSEMY | Elongation factor Tu OS=Pseudomonas mendocina (strain ymp) GN=tuf PE=3 SV=1 | 49 | 446 | 7.0E-171 |
sp|P60339|EFTU2_THET8 | Elongation factor Tu-B OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=tufB PE=1 SV=2 | 49 | 446 | 7.0E-171 |
sp|Q13TF5|EFTU_BURXL | Elongation factor Tu OS=Burkholderia xenovorans (strain LB400) GN=tuf1 PE=3 SV=1 | 49 | 446 | 7.0E-171 |
sp|Q38WR7|EFTU_LACSS | Elongation factor Tu OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=tuf PE=3 SV=1 | 47 | 445 | 7.0E-171 |
sp|Q74JU6|EFTU_LACJO | Elongation factor Tu OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=tuf PE=3 SV=1 | 49 | 445 | 8.0E-171 |
sp|B3ETZ7|EFTU_AMOA5 | Elongation factor Tu OS=Amoebophilus asiaticus (strain 5a2) GN=tuf PE=3 SV=1 | 49 | 445 | 9.0E-171 |
sp|O21245|EFTU_RECAM | Elongation factor Tu, mitochondrial OS=Reclinomonas americana GN=TUFA PE=3 SV=1 | 49 | 446 | 1.0E-170 |
sp|Q8KT97|EFTU_RICFE | Elongation factor Tu OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=tuf PE=3 SV=1 | 47 | 444 | 1.0E-170 |
sp|P60338|EFTU1_THETH | Elongation factor Tu-A OS=Thermus thermophilus GN=tufA PE=1 SV=2 | 49 | 446 | 1.0E-170 |
sp|Q5SHN6|EFTU1_THET8 | Elongation factor Tu-A OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=tufA PE=1 SV=3 | 49 | 446 | 1.0E-170 |
sp|Q042T5|EFTU_LACGA | Elongation factor Tu OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=tuf PE=3 SV=2 | 49 | 445 | 1.0E-170 |
sp|B3WE38|EFTU_LACCB | Elongation factor Tu OS=Lactobacillus casei (strain BL23) GN=tuf PE=3 SV=1 | 49 | 445 | 2.0E-170 |
sp|Q039K9|EFTU_LACC3 | Elongation factor Tu OS=Lactobacillus casei (strain ATCC 334) GN=tuf PE=3 SV=1 | 49 | 445 | 2.0E-170 |
sp|P42479|EFTU_STIAU | Elongation factor Tu OS=Stigmatella aurantiaca GN=tuf PE=3 SV=2 | 49 | 445 | 2.0E-170 |
sp|Q9ZK19|EFTU_HELPJ | Elongation factor Tu OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=tuf PE=3 SV=1 | 49 | 446 | 2.0E-170 |
sp|Q0AUG3|EFTU2_SYNWW | Elongation factor Tu 2 OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=tuf2 PE=3 SV=1 | 47 | 442 | 2.0E-170 |
sp|P49410|EFTU_BOVIN | Elongation factor Tu, mitochondrial OS=Bos taurus GN=TUFM PE=1 SV=1 | 7 | 442 | 2.0E-170 |
sp|A4FPM7|EFTU_SACEN | Elongation factor Tu OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=tuf PE=3 SV=1 | 47 | 446 | 2.0E-170 |
sp|Q8KTA1|EFTU_RICMO | Elongation factor Tu OS=Rickettsia montanensis GN=tuf PE=3 SV=1 | 47 | 444 | 2.0E-170 |
sp|C4K4F8|EFTU_HAMD5 | Elongation factor Tu OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=tuf PE=3 SV=1 | 49 | 446 | 2.0E-170 |
sp|Q1H4N9|EFTU2_METFK | Elongation factor Tu 2 OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=tuf2 PE=3 SV=1 | 49 | 446 | 3.0E-170 |
sp|Q2SU25|EFTU_BURTA | Elongation factor Tu OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=tuf1 PE=3 SV=1 | 49 | 446 | 3.0E-170 |
sp|Q63PZ6|EFTU_BURPS | Elongation factor Tu OS=Burkholderia pseudomallei (strain K96243) GN=tuf1 PE=3 SV=1 | 49 | 446 | 3.0E-170 |
sp|A3NEI1|EFTU_BURP6 | Elongation factor Tu OS=Burkholderia pseudomallei (strain 668) GN=tuf1 PE=3 SV=1 | 49 | 446 | 3.0E-170 |
sp|Q3JMP6|EFTU_BURP1 | Elongation factor Tu OS=Burkholderia pseudomallei (strain 1710b) GN=tuf1 PE=3 SV=1 | 49 | 446 | 3.0E-170 |
sp|A3P0B5|EFTU_BURP0 | Elongation factor Tu OS=Burkholderia pseudomallei (strain 1106a) GN=tuf1 PE=3 SV=1 | 49 | 446 | 3.0E-170 |
sp|A1V8A5|EFTU_BURMS | Elongation factor Tu OS=Burkholderia mallei (strain SAVP1) GN=tuf1 PE=3 SV=1 | 49 | 446 | 3.0E-170 |
sp|Q62GK3|EFTU_BURMA | Elongation factor Tu OS=Burkholderia mallei (strain ATCC 23344) GN=tuf1 PE=3 SV=1 | 49 | 446 | 3.0E-170 |
sp|A2S7F9|EFTU_BURM9 | Elongation factor Tu OS=Burkholderia mallei (strain NCTC 10229) GN=tuf1 PE=3 SV=1 | 49 | 446 | 3.0E-170 |
sp|A3MRT8|EFTU_BURM7 | Elongation factor Tu OS=Burkholderia mallei (strain NCTC 10247) GN=tuf1 PE=3 SV=1 | 49 | 446 | 3.0E-170 |
sp|B6YQ04|EFTU_AZOPC | Elongation factor Tu OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=tuf PE=3 SV=1 | 49 | 446 | 3.0E-170 |
sp|P13537|EFTU_THEMA | Elongation factor Tu OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=tuf PE=3 SV=2 | 49 | 446 | 3.0E-170 |
sp|P22679|EFTU_MYCHP | Elongation factor Tu OS=Mycoplasma hominis (strain ATCC 23114 / NBRC 14850 / NCTC 10111 / PG21) GN=tuf PE=1 SV=1 | 49 | 446 | 3.0E-170 |
sp|A4VHL6|EFTU1_PSEU5 | Elongation factor Tu 1 OS=Pseudomonas stutzeri (strain A1501) GN=tuf1 PE=3 SV=1 | 49 | 446 | 4.0E-170 |
sp|Q8KTA6|EFTU_RICPA | Elongation factor Tu OS=Rickettsia parkeri GN=tuf PE=3 SV=1 | 47 | 444 | 4.0E-170 |
sp|B1LBP2|EFTU_THESQ | Elongation factor Tu OS=Thermotoga sp. (strain RQ2) GN=tuf PE=3 SV=1 | 49 | 446 | 4.0E-170 |
sp|A5IM81|EFTU_THEP1 | Elongation factor Tu OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=tuf PE=3 SV=1 | 49 | 446 | 4.0E-170 |
sp|A6X0A2|EFTU_OCHA4 | Elongation factor Tu OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=tuf1 PE=3 SV=1 | 49 | 446 | 5.0E-170 |
sp|Q0AUH8|EFTU1_SYNWW | Elongation factor Tu 1 OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=tuf1 PE=3 SV=1 | 47 | 444 | 5.0E-170 |
sp|Q98QG1|EFTU_MYCPU | Elongation factor Tu OS=Mycoplasma pulmonis (strain UAB CTIP) GN=tuf PE=3 SV=1 | 49 | 446 | 8.0E-170 |
sp|Q1H4Q1|EFTU1_METFK | Elongation factor Tu 1 OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=tuf1 PE=3 SV=1 | 49 | 446 | 9.0E-170 |
sp|A8HTW6|EFTU_AZOC5 | Elongation factor Tu OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=tuf1 PE=3 SV=1 | 47 | 446 | 9.0E-170 |
sp|Q8EX18|EFTU_MYCPE | Elongation factor Tu OS=Mycoplasma penetrans (strain HF-2) GN=tuf PE=3 SV=1 | 49 | 446 | 1.0E-169 |
sp|Q9P9Q9|EFTU_XYLFA | Elongation factor Tu OS=Xylella fastidiosa (strain 9a5c) GN=tufA PE=1 SV=3 | 49 | 445 | 2.0E-169 |
sp|P33167|EFTU_BURCE | Elongation factor Tu OS=Burkholderia cepacia GN=tuf PE=3 SV=1 | 49 | 445 | 3.0E-169 |
sp|P09591|EFTU_PSEAE | Elongation factor Tu OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=tufA PE=1 SV=2 | 49 | 446 | 3.0E-169 |
sp|Q02T82|EFTU_PSEAB | Elongation factor Tu OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=tuf1 PE=1 SV=1 | 49 | 446 | 3.0E-169 |
sp|A6UZH4|EFTU_PSEA7 | Elongation factor Tu OS=Pseudomonas aeruginosa (strain PA7) GN=tuf1 PE=3 SV=2 | 49 | 446 | 3.0E-169 |
sp|B9K884|EFTU_THENN | Elongation factor Tu OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=tuf PE=3 SV=1 | 49 | 446 | 3.0E-169 |
sp|A1VIP8|EFTU_POLNA | Elongation factor Tu OS=Polaromonas naphthalenivorans (strain CJ2) GN=tuf1 PE=3 SV=1 | 49 | 445 | 4.0E-169 |
sp|Q2S1P8|EFTU_SALRD | Elongation factor Tu OS=Salinibacter ruber (strain DSM 13855 / M31) GN=tuf1 PE=3 SV=1 | 49 | 445 | 5.0E-169 |
sp|A9KRZ4|EFTU_CLOPH | Elongation factor Tu OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=tuf PE=3 SV=1 | 47 | 445 | 6.0E-169 |
sp|Q877P8|EFTU_XYLFT | Elongation factor Tu OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=tufA PE=3 SV=2 | 49 | 445 | 6.0E-169 |
sp|Q8A463|EFTU_BACTN | Elongation factor Tu OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=tuf PE=3 SV=1 | 49 | 445 | 7.0E-169 |
sp|A8LLG2|EFTU_DINSH | Elongation factor Tu OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=tuf1 PE=3 SV=1 | 49 | 446 | 8.0E-169 |
sp|P64025|EFTU_BRUSU | Elongation factor Tu OS=Brucella suis biovar 1 (strain 1330) GN=tufA PE=3 SV=1 | 49 | 446 | 1.0E-168 |
sp|A5VR08|EFTU_BRUO2 | Elongation factor Tu OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=tuf1 PE=3 SV=1 | 49 | 446 | 1.0E-168 |
sp|P64024|EFTU_BRUME | Elongation factor Tu OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=tufA PE=3 SV=1 | 49 | 446 | 1.0E-168 |
sp|A9M5Q2|EFTU_BRUC2 | Elongation factor Tu OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=tuf1 PE=3 SV=1 | 49 | 446 | 1.0E-168 |
sp|Q2YM08|EFTU_BRUA2 | Elongation factor Tu OS=Brucella abortus (strain 2308) GN=tuf1 PE=3 SV=1 | 49 | 446 | 1.0E-168 |
sp|Q39KI2|EFTU_BURL3 | Elongation factor Tu OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=tuf1 PE=3 SV=1 | 49 | 446 | 1.0E-168 |
sp|Q0BJ48|EFTU_BURCM | Elongation factor Tu OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=tuf1 PE=3 SV=1 | 49 | 446 | 1.0E-168 |
sp|A0K3L0|EFTU_BURCH | Elongation factor Tu OS=Burkholderia cenocepacia (strain HI2424) GN=tuf1 PE=3 SV=1 | 49 | 446 | 1.0E-168 |
sp|Q1BRT3|EFTU_BURCA | Elongation factor Tu OS=Burkholderia cenocepacia (strain AU 1054) GN=tuf1 PE=3 SV=1 | 49 | 446 | 1.0E-168 |
sp|A2SLF9|EFTU_METPP | Elongation factor Tu OS=Methylibium petroleiphilum (strain PM1) GN=tuf1 PE=3 SV=1 | 49 | 446 | 1.0E-168 |
sp|A4JAM5|EFTU_BURVG | Elongation factor Tu OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=tuf1 PE=3 SV=1 | 49 | 446 | 2.0E-168 |
sp|Q5HVZ7|EFTU_CAMJR | Elongation factor Tu OS=Campylobacter jejuni (strain RM1221) GN=tuf PE=3 SV=1 | 49 | 446 | 2.0E-168 |
sp|A1VYI6|EFTU_CAMJJ | Elongation factor Tu OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=tuf PE=3 SV=1 | 49 | 446 | 2.0E-168 |
sp|O69303|EFTU_CAMJE | Elongation factor Tu OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=tuf PE=3 SV=1 | 49 | 446 | 2.0E-168 |
sp|A7H4R3|EFTU_CAMJD | Elongation factor Tu OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=tuf PE=3 SV=1 | 49 | 446 | 2.0E-168 |
sp|A8FKQ5|EFTU_CAMJ8 | Elongation factor Tu OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=tuf PE=3 SV=1 | 49 | 446 | 2.0E-168 |
sp|Q1IHG6|EFTU_KORVE | Elongation factor Tu OS=Koribacter versatilis (strain Ellin345) GN=tuf1 PE=3 SV=1 | 49 | 445 | 2.0E-168 |
sp|Q7M7F1|EFTU_CHRVO | Elongation factor Tu OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=tuf1 PE=3 SV=1 | 49 | 445 | 2.0E-168 |
sp|B0CH34|EFTU_BRUSI | Elongation factor Tu OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=tuf1 PE=3 SV=1 | 49 | 446 | 3.0E-168 |
sp|B3PMU1|EFTU_MYCA5 | Elongation factor Tu OS=Mycoplasma arthritidis (strain 158L3-1) GN=tuf PE=3 SV=1 | 49 | 446 | 3.0E-168 |
sp|Q3AMT6|EFTU_SYNSC | Elongation factor Tu OS=Synechococcus sp. (strain CC9605) GN=tuf PE=3 SV=1 | 49 | 446 | 3.0E-168 |
sp|B6JET1|EFTU_OLICO | Elongation factor Tu OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=tuf PE=3 SV=1 | 49 | 446 | 3.0E-168 |
sp|A4YSJ0|EFTU_BRASO | Elongation factor Tu OS=Bradyrhizobium sp. (strain ORS278) GN=tuf PE=3 SV=1 | 47 | 446 | 3.0E-168 |
sp|A5ELM9|EFTU_BRASB | Elongation factor Tu OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=tuf PE=3 SV=1 | 47 | 446 | 3.0E-168 |
sp|Q9ZT91|EFTM_ARATH | Elongation factor Tu, mitochondrial OS=Arabidopsis thaliana GN=TUFA PE=1 SV=1 | 43 | 445 | 3.0E-168 |
sp|Q83ES6|EFTU_COXBU | Elongation factor Tu OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=tufA PE=1 SV=1 | 49 | 446 | 3.0E-168 |
sp|A9NAK7|EFTU_COXBR | Elongation factor Tu OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=tuf1 PE=3 SV=1 | 49 | 446 | 3.0E-168 |
sp|A9KD33|EFTU_COXBN | Elongation factor Tu OS=Coxiella burnetii (strain Dugway 5J108-111) GN=tuf1 PE=3 SV=1 | 49 | 446 | 3.0E-168 |
sp|Q8KTA3|EFTU_RICRH | Elongation factor Tu OS=Rickettsia rhipicephali GN=tuf PE=3 SV=1 | 47 | 444 | 4.0E-168 |
sp|A5D5I8|EFTU2_PELTS | Elongation factor Tu 2 OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=tuf2 PE=3 SV=1 | 49 | 444 | 4.0E-168 |
sp|Q7V500|EFTU_PROMM | Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9313) GN=tuf PE=3 SV=1 | 49 | 446 | 5.0E-168 |
sp|A5D5K0|EFTU1_PELTS | Elongation factor Tu 1 OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=tuf1 PE=3 SV=1 | 49 | 444 | 5.0E-168 |
sp|P95724|EFTU_STRCJ | Elongation factor Tu OS=Streptomyces cinnamoneus GN=tuf PE=3 SV=2 | 47 | 446 | 5.0E-168 |
sp|A6KYK9|EFTU_BACV8 | Elongation factor Tu OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=tuf PE=3 SV=1 | 49 | 445 | 6.0E-168 |
sp|A3PEZ7|EFTU_PROM0 | Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9301) GN=tuf PE=3 SV=1 | 49 | 446 | 7.0E-168 |
sp|A2CC87|EFTU_PROM3 | Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9303) GN=tuf PE=3 SV=1 | 49 | 446 | 8.0E-168 |
sp|A5FIJ9|EFTU_FLAJ1 | Elongation factor Tu OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=tuf PE=3 SV=1 | 49 | 446 | 8.0E-168 |
sp|A6LE88|EFTU_PARD8 | Elongation factor Tu OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=tuf PE=3 SV=1 | 49 | 444 | 9.0E-168 |
sp|Q0I0B9|EFTU1_SHESR | Elongation factor Tu 1 OS=Shewanella sp. (strain MR-7) GN=tuf1 PE=3 SV=1 | 47 | 445 | 9.0E-168 |
sp|Q0HNV1|EFTU1_SHESM | Elongation factor Tu 1 OS=Shewanella sp. (strain MR-4) GN=tuf1 PE=3 SV=1 | 47 | 445 | 9.0E-168 |
sp|Q46IW4|EFTU_PROMT | Elongation factor Tu OS=Prochlorococcus marinus (strain NATL2A) GN=tuf PE=3 SV=1 | 49 | 446 | 1.0E-167 |
sp|Q1GP97|EFTU_SPHAL | Elongation factor Tu OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=tuf PE=3 SV=1 | 47 | 446 | 1.0E-167 |
sp|A2BT83|EFTU_PROMS | Elongation factor Tu OS=Prochlorococcus marinus (strain AS9601) GN=tuf PE=3 SV=1 | 49 | 446 | 1.0E-167 |
sp|A0KRL0|EFTU_SHESA | Elongation factor Tu OS=Shewanella sp. (strain ANA-3) GN=tuf1 PE=3 SV=1 | 47 | 445 | 1.0E-167 |
sp|A8G708|EFTU_PROM2 | Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9215) GN=tuf PE=3 SV=1 | 49 | 446 | 2.0E-167 |
sp|Q1GDV0|EFTU_RUEST | Elongation factor Tu OS=Ruegeria sp. (strain TM1040) GN=tuf1 PE=3 SV=1 | 49 | 445 | 2.0E-167 |
sp|A8GPF2|EFTU_RICAH | Elongation factor Tu OS=Rickettsia akari (strain Hartford) GN=tuf PE=3 SV=1 | 47 | 444 | 2.0E-167 |
sp|P29542|EFTU1_STRRA | Elongation factor Tu-1 OS=Streptomyces ramocissimus GN=tuf1 PE=3 SV=1 | 47 | 446 | 3.0E-167 |
sp|Q04FQ4|EFTU_OENOB | Elongation factor Tu OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=tuf PE=3 SV=1 | 49 | 444 | 3.0E-167 |
sp|Q89J82|EFTU_BRADU | Elongation factor Tu OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=tuf PE=3 SV=1 | 47 | 446 | 3.0E-167 |
sp|Q318N5|EFTU_PROM9 | Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9312) GN=tuf PE=3 SV=1 | 49 | 446 | 5.0E-167 |
sp|Q3SLQ1|EFTU_THIDA | Elongation factor Tu OS=Thiobacillus denitrificans (strain ATCC 25259) GN=tuf1 PE=3 SV=1 | 49 | 444 | 5.0E-167 |
sp|A8F4Q9|EFTU_PSELT | Elongation factor Tu OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=tuf PE=3 SV=1 | 49 | 446 | 5.0E-167 |
sp|Q5WZL4|EFTU_LEGPL | Elongation factor Tu OS=Legionella pneumophila (strain Lens) GN=tuf1 PE=3 SV=1 | 49 | 446 | 5.0E-167 |
sp|Q877L9|EFTU_CLOTE | Elongation factor Tu OS=Clostridium tetani (strain Massachusetts / E88) GN=tufA PE=3 SV=1 | 49 | 444 | 5.0E-167 |
sp|Q4A597|EFTU_MYCS5 | Elongation factor Tu OS=Mycoplasma synoviae (strain 53) GN=tuf PE=3 SV=1 | 49 | 446 | 6.0E-167 |
sp|A4SUU7|EFTU_POLSQ | Elongation factor Tu OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=tuf1 PE=3 SV=1 | 49 | 445 | 6.0E-167 |
sp|A4IJI7|EFTU_GEOTN | Elongation factor Tu OS=Geobacillus thermodenitrificans (strain NG80-2) GN=tuf PE=3 SV=1 | 47 | 446 | 6.0E-167 |
sp|A9NEN4|EFTU_ACHLI | Elongation factor Tu OS=Acholeplasma laidlawii (strain PG-8A) GN=tuf PE=3 SV=1 | 49 | 445 | 7.0E-167 |
sp|A5GIP0|EFTU_SYNPW | Elongation factor Tu OS=Synechococcus sp. (strain WH7803) GN=tuf PE=3 SV=1 | 49 | 446 | 7.0E-167 |
sp|Q8BFR5|EFTU_MOUSE | Elongation factor Tu, mitochondrial OS=Mus musculus GN=Tufm PE=1 SV=1 | 7 | 444 | 7.0E-167 |
sp|A2C4U5|EFTU_PROM1 | Elongation factor Tu OS=Prochlorococcus marinus (strain NATL1A) GN=tuf PE=3 SV=1 | 49 | 446 | 8.0E-167 |
sp|Q5ZYP5|EFTU_LEGPH | Elongation factor Tu OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=tuf1 PE=3 SV=1 | 49 | 446 | 8.0E-167 |
sp|A5IHR6|EFTU_LEGPC | Elongation factor Tu OS=Legionella pneumophila (strain Corby) GN=tuf1 PE=3 SV=1 | 49 | 446 | 8.0E-167 |
sp|Q5X873|EFTU_LEGPA | Elongation factor Tu OS=Legionella pneumophila (strain Paris) GN=tuf1 PE=3 SV=1 | 49 | 446 | 8.0E-167 |
sp|Q18CE4|EFTU_PEPD6 | Elongation factor Tu OS=Peptoclostridium difficile (strain 630) GN=tuf1 PE=3 SV=1 | 47 | 446 | 1.0E-166 |
sp|B9L7I8|EFTU_NAUPA | Elongation factor Tu OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=tuf PE=3 SV=1 | 49 | 446 | 1.0E-166 |
sp|Q748X8|EFTU_GEOSL | Elongation factor Tu OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=tuf1 PE=3 SV=1 | 47 | 446 | 1.0E-166 |
sp|A0LIH6|EFTU_SYNFM | Elongation factor Tu OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=tuf1 PE=3 SV=1 | 49 | 446 | 1.0E-166 |
sp|B7GJ65|EFTU_ANOFW | Elongation factor Tu OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=tuf PE=3 SV=1 | 47 | 446 | 1.0E-166 |
sp|Q28UW7|EFTU_JANSC | Elongation factor Tu OS=Jannaschia sp. (strain CCS1) GN=tuf1 PE=3 SV=1 | 49 | 446 | 1.0E-166 |
sp|A4J0Z5|EFTU_DESRM | Elongation factor Tu OS=Desulfotomaculum reducens (strain MI-1) GN=tuf PE=3 SV=1 | 47 | 444 | 2.0E-166 |
sp|Q7VA05|EFTU_PROMA | Elongation factor Tu OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=tuf PE=3 SV=1 | 49 | 446 | 2.0E-166 |
sp|Q889X3|EFTU_PSESM | Elongation factor Tu OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=tuf PE=3 SV=1 | 49 | 445 | 3.0E-166 |
sp|O50306|EFTU_GEOSE | Elongation factor Tu OS=Geobacillus stearothermophilus GN=tuf PE=3 SV=2 | 47 | 446 | 3.0E-166 |
sp|P42477|EFTU_HERAU | Elongation factor Tu OS=Herpetosiphon aurantiacus GN=tuf PE=3 SV=1 | 49 | 445 | 3.0E-166 |
sp|P85834|EFTU_RAT | Elongation factor Tu, mitochondrial OS=Rattus norvegicus GN=Tufm PE=1 SV=1 | 7 | 444 | 3.0E-166 |
sp|Q11HA6|EFTU_CHESB | Elongation factor Tu OS=Chelativorans sp. (strain BNC1) GN=tuf1 PE=3 SV=1 | 49 | 444 | 3.0E-166 |
sp|A2BYN4|EFTU_PROM5 | Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9515) GN=tuf PE=3 SV=1 | 49 | 446 | 4.0E-166 |
sp|Q6A6L7|EFTU_PROAC | Elongation factor Tu OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=tuf PE=3 SV=1 | 47 | 446 | 4.0E-166 |
sp|Q2RQV8|EFTU1_RHORT | Elongation factor Tu 1 OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=tuf1 PE=3 SV=1 | 49 | 446 | 4.0E-166 |
sp|A5GW14|EFTU_SYNR3 | Elongation factor Tu OS=Synechococcus sp. (strain RCC307) GN=tuf PE=3 SV=1 | 49 | 446 | 4.0E-166 |
sp|A0PXT1|EFTU_CLONN | Elongation factor Tu OS=Clostridium novyi (strain NT) GN=tuf1 PE=3 SV=1 | 49 | 446 | 5.0E-166 |
sp|A6LLL1|EFTU_THEM4 | Elongation factor Tu OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=tuf PE=3 SV=1 | 49 | 446 | 5.0E-166 |
sp|Q6YQV8|EFTU_ONYPE | Elongation factor Tu OS=Onion yellows phytoplasma (strain OY-M) GN=tuf PE=3 SV=1 | 49 | 445 | 5.0E-166 |
sp|C5D3R5|EFTU_GEOSW | Elongation factor Tu OS=Geobacillus sp. (strain WCH70) GN=tuf PE=3 SV=1 | 49 | 446 | 7.0E-166 |
sp|A3DJ00|EFTU_CLOTH | Elongation factor Tu OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=tuf PE=3 SV=1 | 47 | 446 | 8.0E-166 |
sp|Q5L3Z9|EFTU_GEOKA | Elongation factor Tu OS=Geobacillus kaustophilus (strain HTA426) GN=tuf PE=3 SV=1 | 47 | 446 | 8.0E-166 |
sp|A8Z5T8|EFTU_SULMW | Elongation factor Tu OS=Sulcia muelleri (strain GWSS) GN=tuf PE=3 SV=1 | 48 | 446 | 9.0E-166 |
sp|Q160Y4|EFTU_ROSDO | Elongation factor Tu OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=tuf1 PE=3 SV=1 | 47 | 444 | 9.0E-166 |
sp|Q250N4|EFTU_DESHY | Elongation factor Tu OS=Desulfitobacterium hafniense (strain Y51) GN=tuf PE=3 SV=1 | 49 | 446 | 1.0E-165 |
sp|B8G1W4|EFTU_DESHD | Elongation factor Tu OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=tuf PE=3 SV=1 | 49 | 446 | 1.0E-165 |
sp|C3K2X8|EFTU_PSEFS | Elongation factor Tu OS=Pseudomonas fluorescens (strain SBW25) GN=tuf PE=3 SV=1 | 49 | 446 | 1.0E-165 |
sp|Q01SX2|EFTU_SOLUE | Elongation factor Tu OS=Solibacter usitatus (strain Ellin6076) GN=tuf1 PE=3 SV=1 | 49 | 446 | 2.0E-165 |
sp|C0ZIH6|EFTU_BREBN | Elongation factor Tu OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=tuf PE=3 SV=1 | 47 | 444 | 2.0E-165 |
sp|Q5YPG4|EFTU_NOCFA | Elongation factor Tu OS=Nocardia farcinica (strain IFM 10152) GN=tuf PE=3 SV=2 | 47 | 446 | 2.0E-165 |
sp|Q8EK70|EFTU2_SHEON | Elongation factor Tu 2 OS=Shewanella oneidensis (strain MR-1) GN=tuf2 PE=3 SV=1 | 47 | 445 | 2.0E-165 |
sp|Q0I0A7|EFTU2_SHESR | Elongation factor Tu 2 OS=Shewanella sp. (strain MR-7) GN=tuf2 PE=3 SV=1 | 47 | 445 | 2.0E-165 |
sp|A5IYA9|EFTU_MYCAP | Elongation factor Tu OS=Mycoplasma agalactiae (strain PG2) GN=tuf PE=3 SV=1 | 49 | 446 | 2.0E-165 |
sp|B8ELG5|EFTU_METSB | Elongation factor Tu OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=tuf PE=3 SV=1 | 49 | 444 | 3.0E-165 |
sp|Q0HNT9|EFTU2_SHESM | Elongation factor Tu 2 OS=Shewanella sp. (strain MR-4) GN=tuf2 PE=3 SV=1 | 47 | 445 | 3.0E-165 |
sp|P23568|EFTU_MYCPN | Elongation factor Tu OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=tuf PE=3 SV=2 | 49 | 446 | 3.0E-165 |
sp|Q4A7K0|EFTU_MYCH7 | Elongation factor Tu OS=Mycoplasma hyopneumoniae (strain 7448) GN=tuf PE=3 SV=1 | 49 | 446 | 3.0E-165 |
sp|Q600B6|EFTU_MYCH2 | Elongation factor Tu OS=Mycoplasma hyopneumoniae (strain 232) GN=tuf PE=3 SV=1 | 49 | 446 | 3.0E-165 |
sp|C0Q9Y7|EFTU_DESAH | Elongation factor Tu OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=tuf PE=3 SV=1 | 49 | 446 | 4.0E-165 |
sp|Q48D34|EFTU_PSE14 | Elongation factor Tu OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=tuf PE=3 SV=1 | 49 | 445 | 5.0E-165 |
sp|Q2RQU6|EFTU2_RHORT | Elongation factor Tu 2 OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=tuf2 PE=3 SV=1 | 49 | 446 | 6.0E-165 |
sp|Q2JFH8|EFTU_FRASC | Elongation factor Tu OS=Frankia sp. (strain CcI3) GN=tuf PE=3 SV=1 | 49 | 446 | 7.0E-165 |
sp|Q8R603|EFTU_FUSNN | Elongation factor Tu OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=tuf PE=3 SV=1 | 49 | 446 | 8.0E-165 |
sp|Q4A9G1|EFTU_MYCHJ | Elongation factor Tu OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110) GN=tuf PE=3 SV=1 | 49 | 446 | 8.0E-165 |
sp|A9BHA7|EFTU_PETMO | Elongation factor Tu OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=tuf PE=3 SV=1 | 49 | 446 | 1.0E-164 |
sp|Q8EK81|EFTU1_SHEON | Elongation factor Tu 1 OS=Shewanella oneidensis (strain MR-1) GN=tuf1 PE=3 SV=1 | 47 | 445 | 1.0E-164 |
sp|B8I5N8|EFTU_CLOCE | Elongation factor Tu OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=tuf PE=3 SV=1 | 47 | 446 | 1.0E-164 |
sp|P13927|EFTU_MYCGE | Elongation factor Tu OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=tuf PE=3 SV=1 | 49 | 446 | 1.0E-164 |
sp|Q67JU1|EFTU_SYMTH | Elongation factor Tu OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=tuf PE=3 SV=1 | 49 | 444 | 2.0E-164 |
sp|Q7U4D1|EFTU_SYNPX | Elongation factor Tu OS=Synechococcus sp. (strain WH8102) GN=tuf PE=3 SV=1 | 49 | 446 | 2.0E-164 |
sp|Q4FLK5|EFTU_PELUB | Elongation factor Tu OS=Pelagibacter ubique (strain HTCC1062) GN=tuf PE=3 SV=1 | 49 | 446 | 2.0E-164 |
sp|Q99QM0|EFTU_CAUCR | Elongation factor Tu OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=tufA PE=3 SV=1 | 49 | 446 | 2.0E-164 |
sp|P49411|EFTU_HUMAN | Elongation factor Tu, mitochondrial OS=Homo sapiens GN=TUFM PE=1 SV=2 | 7 | 445 | 2.0E-164 |
sp|Q81ZS3|EFTU_NITEU | Elongation factor Tu OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=tuf1 PE=3 SV=1 | 49 | 446 | 3.0E-164 |
sp|C5BQ44|EFTU_TERTT | Elongation factor Tu OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=tuf PE=3 SV=1 | 49 | 446 | 3.0E-164 |
sp|Q1RHL9|EFTU_RICBR | Elongation factor Tu OS=Rickettsia bellii (strain RML369-C) GN=tuf PE=3 SV=1 | 47 | 445 | 3.0E-164 |
sp|A8GVB2|EFTU_RICB8 | Elongation factor Tu OS=Rickettsia bellii (strain OSU 85-389) GN=tuf PE=3 SV=1 | 47 | 445 | 3.0E-164 |
sp|A7HM54|EFTU_FERNB | Elongation factor Tu OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=tuf PE=3 SV=1 | 49 | 446 | 3.0E-164 |
sp|Q0ANN1|EFTU_MARMM | Elongation factor Tu OS=Maricaulis maris (strain MCS10) GN=tuf1 PE=3 SV=1 | 49 | 446 | 4.0E-164 |
sp|A5GAW4|EFTU_GEOUR | Elongation factor Tu OS=Geobacter uraniireducens (strain Rf4) GN=tuf1 PE=3 SV=1 | 47 | 446 | 5.0E-164 |
sp|Q7UZY7|EFTU_PROMP | Elongation factor Tu OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=tuf PE=3 SV=1 | 49 | 446 | 6.0E-164 |
sp|Q97EH5|EFTU_CLOAB | Elongation factor Tu OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=tuf PE=3 SV=1 | 49 | 446 | 6.0E-164 |
sp|A6T3K6|EFTU_JANMA | Elongation factor Tu OS=Janthinobacterium sp. (strain Marseille) GN=tuf1 PE=3 SV=1 | 49 | 446 | 6.0E-164 |
sp|Q1LSY4|EFTU_BAUCH | Elongation factor Tu OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=tuf PE=3 SV=1 | 49 | 446 | 8.0E-164 |
sp|Q3K5X4|EFTU_PSEPF | Elongation factor Tu OS=Pseudomonas fluorescens (strain Pf0-1) GN=tuf1 PE=3 SV=1 | 49 | 446 | 1.0E-163 |
sp|Q2NJ20|EFTU_AYWBP | Elongation factor Tu OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=tuf PE=3 SV=1 | 49 | 445 | 1.0E-163 |
sp|Q05FI3|EFTU_CARRP | Elongation factor Tu OS=Carsonella ruddii (strain PV) GN=tuf PE=3 SV=1 | 49 | 445 | 1.0E-163 |
sp|A7I3U7|EFTU_CAMHC | Elongation factor Tu OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=tuf PE=3 SV=1 | 49 | 445 | 1.0E-163 |
sp|A1ALS6|EFTU_PELPD | Elongation factor Tu OS=Pelobacter propionicus (strain DSM 2379) GN=tuf1 PE=3 SV=1 | 47 | 446 | 1.0E-163 |
sp|A0L5V8|EFTU_MAGMM | Elongation factor Tu OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=tuf1 PE=3 SV=1 | 49 | 445 | 1.0E-163 |
sp|A0JZ88|EFTU_ARTS2 | Elongation factor Tu OS=Arthrobacter sp. (strain FB24) GN=tuf PE=3 SV=1 | 47 | 446 | 2.0E-163 |
sp|A1T4L6|EFTU_MYCVP | Elongation factor Tu OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=tuf PE=3 SV=1 | 47 | 446 | 2.0E-163 |
sp|Q5LMR5|EFTU_RUEPO | Elongation factor Tu OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=tuf1 PE=3 SV=1 | 49 | 446 | 2.0E-163 |
sp|B2GIL2|EFTU_KOCRD | Elongation factor Tu OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=tuf PE=3 SV=1 | 47 | 446 | 2.0E-163 |
sp|B7IHU4|EFTU_THEAB | Elongation factor Tu OS=Thermosipho africanus (strain TCF52B) GN=tuf PE=3 SV=1 | 49 | 446 | 2.0E-163 |
sp|Q82DQ0|EFTU1_STRAW | Elongation factor Tu 1 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=tuf1 PE=3 SV=1 | 47 | 446 | 2.0E-163 |
sp|Q4ZMP2|EFTU_PSEU2 | Elongation factor Tu OS=Pseudomonas syringae pv. syringae (strain B728a) GN=tuf PE=3 SV=1 | 49 | 445 | 3.0E-163 |
sp|C5CGR6|EFTU_KOSOT | Elongation factor Tu OS=Kosmotoga olearia (strain TBF 19.5.1) GN=tuf PE=3 SV=1 | 49 | 446 | 3.0E-163 |
sp|B8HD11|EFTU_ARTCA | Elongation factor Tu OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=tuf PE=3 SV=1 | 47 | 446 | 4.0E-163 |
sp|A0QS98|EFTU_MYCS2 | Elongation factor Tu OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=tuf PE=1 SV=1 | 47 | 446 | 4.0E-163 |
sp|Q1WU83|EFTU_LACS1 | Elongation factor Tu OS=Lactobacillus salivarius (strain UCC118) GN=tuf PE=3 SV=1 | 49 | 444 | 5.0E-163 |
sp|A6W394|EFTU_MARMS | Elongation factor Tu OS=Marinomonas sp. (strain MWYL1) GN=tuf PE=3 SV=1 | 49 | 446 | 5.0E-163 |
sp|B8DAY7|EFTU_LISMH | Elongation factor Tu OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=tuf PE=3 SV=1 | 49 | 446 | 6.0E-163 |
sp|Q927I6|EFTU_LISIN | Elongation factor Tu OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=tuf PE=3 SV=1 | 49 | 446 | 6.0E-163 |
sp|Q0AIJ7|EFTU1_NITEC | Elongation factor Tu 1 OS=Nitrosomonas eutropha (strain C91) GN=tuf1 PE=3 SV=1 | 49 | 446 | 6.0E-163 |
sp|Q0AF46|EFTU2_NITEC | Elongation factor Tu 2 OS=Nitrosomonas eutropha (strain C91) GN=tuf2 PE=3 SV=1 | 49 | 446 | 7.0E-163 |
sp|Q2K9N2|EFTU1_RHIEC | Elongation factor Tu 1 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=tuf1 PE=3 SV=1 | 49 | 446 | 7.0E-163 |
sp|Q8UE16|EFTU_AGRFC | Elongation factor Tu OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=tufA PE=3 SV=1 | 49 | 446 | 8.0E-163 |
sp|P75022|EFTU_RHIRD | Elongation factor Tu OS=Rhizobium radiobacter GN=tufA PE=3 SV=1 | 49 | 446 | 1.0E-162 |
sp|Q6KI66|EFTU_MYCMO | Elongation factor Tu OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=tuf PE=3 SV=1 | 49 | 446 | 1.0E-162 |
sp|Q0RRS3|EFTU_FRAAA | Elongation factor Tu OS=Frankia alni (strain ACN14a) GN=tuf PE=3 SV=1 | 49 | 446 | 1.0E-162 |
sp|Q21M86|EFTU_SACD2 | Elongation factor Tu OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=tuf1 PE=3 SV=1 | 49 | 445 | 2.0E-162 |
sp|B1JDW6|EFTU_PSEPW | Elongation factor Tu OS=Pseudomonas putida (strain W619) GN=tuf1 PE=3 SV=1 | 49 | 446 | 2.0E-162 |
sp|B0KK53|EFTU_PSEPG | Elongation factor Tu OS=Pseudomonas putida (strain GB-1) GN=tuf1 PE=3 SV=1 | 49 | 446 | 2.0E-162 |
sp|A5VXN3|EFTU_PSEP1 | Elongation factor Tu OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=tuf PE=3 SV=1 | 49 | 446 | 2.0E-162 |
sp|Q88QP8|EFTU1_PSEPK | Elongation factor Tu-A OS=Pseudomonas putida (strain KT2440) GN=tufA PE=1 SV=1 | 49 | 446 | 2.0E-162 |
sp|Q17VM8|EFTU_HELAH | Elongation factor Tu OS=Helicobacter acinonychis (strain Sheeba) GN=tuf PE=3 SV=1 | 49 | 446 | 2.0E-162 |
sp|Q1IFW8|EFTU_PSEE4 | Elongation factor Tu OS=Pseudomonas entomophila (strain L48) GN=tuf1 PE=3 SV=1 | 49 | 446 | 2.0E-162 |
sp|Q88QN7|EFTU2_PSEPK | Elongation factor Tu-B OS=Pseudomonas putida (strain KT2440) GN=tufB PE=3 SV=1 | 49 | 446 | 2.0E-162 |
sp|Q3AW53|EFTU_SYNS9 | Elongation factor Tu OS=Synechococcus sp. (strain CC9902) GN=tuf PE=3 SV=1 | 49 | 446 | 2.0E-162 |
sp|A9ETD1|EFTU_SORC5 | Elongation factor Tu OS=Sorangium cellulosum (strain So ce56) GN=tuf1 PE=3 SV=1 | 49 | 445 | 3.0E-162 |
sp|Q2K9L8|EFTU2_RHIEC | Elongation factor Tu 2 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=tuf2 PE=3 SV=1 | 49 | 441 | 3.0E-162 |
sp|C5C0J3|EFTU_BEUC1 | Elongation factor Tu OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=tuf PE=3 SV=1 | 47 | 445 | 3.0E-162 |
sp|A6U842|EFTU_SINMW | Elongation factor Tu OS=Sinorhizobium medicae (strain WSM419) GN=tuf1 PE=3 SV=1 | 49 | 446 | 3.0E-162 |
sp|Q925Y6|EFTU_RHIME | Elongation factor Tu OS=Rhizobium meliloti (strain 1021) GN=tufA PE=3 SV=1 | 49 | 446 | 3.0E-162 |
sp|A1R8U9|EFTU_ARTAT | Elongation factor Tu OS=Arthrobacter aurescens (strain TC1) GN=tuf PE=3 SV=1 | 47 | 446 | 4.0E-162 |
sp|B3E156|EFTU_METI4 | Elongation factor Tu OS=Methylacidiphilum infernorum (isolate V4) GN=tuf PE=3 SV=1 | 49 | 446 | 4.0E-162 |
sp|Q47JA5|EFTU_DECAR | Elongation factor Tu OS=Dechloromonas aromatica (strain RCB) GN=tuf1 PE=3 SV=1 | 49 | 446 | 5.0E-162 |
sp|Q1ACI3|EFTU_CHAVU | Elongation factor Tu, chloroplastic OS=Chara vulgaris GN=tufA PE=3 SV=1 | 48 | 445 | 5.0E-162 |
sp|Q0ABH7|EFTU_ALKEH | Elongation factor Tu OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=tuf1 PE=3 SV=1 | 49 | 446 | 6.0E-162 |
sp|C4ZB99|EFTU_EUBR3 | Elongation factor Tu OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=tuf PE=3 SV=1 | 47 | 446 | 6.0E-162 |
sp|Q9TJQ8|EFTU_PROWI | Elongation factor Tu, plastid OS=Prototheca wickerhamii GN=tufA PE=3 SV=1 | 47 | 446 | 6.0E-162 |
sp|A0ALY8|EFTU_LISW6 | Elongation factor Tu OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=tuf PE=3 SV=1 | 49 | 446 | 6.0E-162 |
sp|Q8Y422|EFTU_LISMO | Elongation factor Tu OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=tuf PE=1 SV=1 | 49 | 446 | 6.0E-162 |
sp|Q71WB9|EFTU_LISMF | Elongation factor Tu OS=Listeria monocytogenes serotype 4b (strain F2365) GN=tuf PE=3 SV=1 | 49 | 446 | 6.0E-162 |
sp|C1KZK6|EFTU_LISMC | Elongation factor Tu OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=tuf PE=3 SV=1 | 49 | 446 | 6.0E-162 |
sp|Q8KHX9|EFTU_BARHE | Elongation factor Tu OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=tuf1 PE=3 SV=1 | 49 | 446 | 7.0E-162 |
sp|B4SBU5|EFTU_PELPB | Elongation factor Tu OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=tuf PE=3 SV=1 | 49 | 446 | 8.0E-162 |
sp|Q1MIE3|EFTU_RHIL3 | Elongation factor Tu OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=tuf1 PE=3 SV=1 | 49 | 446 | 1.0E-161 |
sp|P42473|EFTU_CHLP8 | Elongation factor Tu OS=Chlorobaculum parvum (strain NCIB 8327) GN=tuf PE=3 SV=1 | 49 | 446 | 1.0E-161 |
sp|B0TX03|EFTU_FRAP2 | Elongation factor Tu OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=tuf PE=3 SV=1 | 49 | 446 | 1.0E-161 |
sp|A4IW92|EFTU_FRATW | Elongation factor Tu OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=tuf PE=3 SV=1 | 49 | 446 | 1.0E-161 |
sp|Q0BKB8|EFTU_FRATO | Elongation factor Tu OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=tuf PE=3 SV=1 | 49 | 446 | 1.0E-161 |
sp|A0Q874|EFTU_FRATN | Elongation factor Tu OS=Francisella tularensis subsp. novicida (strain U112) GN=tuf PE=3 SV=1 | 49 | 446 | 1.0E-161 |
sp|B2SFC9|EFTU_FRATM | Elongation factor Tu OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=tuf PE=3 SV=1 | 49 | 446 | 1.0E-161 |
sp|Q2A1M0|EFTU_FRATH | Elongation factor Tu OS=Francisella tularensis subsp. holarctica (strain LVS) GN=tuf PE=3 SV=1 | 49 | 446 | 1.0E-161 |
sp|A7NEC7|EFTU_FRATF | Elongation factor Tu OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=tuf PE=3 SV=1 | 49 | 446 | 1.0E-161 |
sp|P40174|EFTU1_STRCO | Elongation factor Tu-1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=tuf1 PE=3 SV=1 | 47 | 446 | 1.0E-161 |
sp|P26184|EFTU_FLESI | Elongation factor Tu OS=Flexistipes sinusarabici GN=tuf PE=3 SV=1 | 49 | 446 | 1.0E-161 |
sp|Q3B6G3|EFTU_CHLL7 | Elongation factor Tu OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=tuf PE=3 SV=1 | 49 | 444 | 2.0E-161 |
sp|A1TJ05|EFTU_ACIAC | Elongation factor Tu OS=Acidovorax citrulli (strain AAC00-1) GN=tuf1 PE=3 SV=1 | 49 | 445 | 2.0E-161 |
sp|Q5NID9|EFTU_FRATT | Elongation factor Tu OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=tuf PE=3 SV=1 | 49 | 446 | 2.0E-161 |
sp|Q14JU2|EFTU_FRAT1 | Elongation factor Tu OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=tuf PE=3 SV=1 | 49 | 446 | 2.0E-161 |
sp|Q53871|EFTU1_STRCU | Elongation factor Tu-1 OS=Streptomyces collinus GN=tuf1 PE=3 SV=1 | 47 | 446 | 3.0E-161 |
sp|A8EW02|EFTU_ARCB4 | Elongation factor Tu OS=Arcobacter butzleri (strain RM4018) GN=tuf PE=3 SV=1 | 49 | 445 | 3.0E-161 |
sp|Q2N9A8|EFTU_ERYLH | Elongation factor Tu OS=Erythrobacter litoralis (strain HTCC2594) GN=tuf PE=3 SV=1 | 49 | 444 | 3.0E-161 |
sp|Q6FZL2|EFTU2_BARQU | Elongation factor Tu 2 OS=Bartonella quintana (strain Toulouse) GN=tuf2 PE=3 SV=1 | 49 | 446 | 4.0E-161 |
sp|A1KRF9|EFTU_NEIMF | Elongation factor Tu OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=tuf1 PE=3 SV=1 | 49 | 445 | 4.0E-161 |
sp|P64027|EFTU_NEIMB | Elongation factor Tu OS=Neisseria meningitidis serogroup B (strain MC58) GN=tufA PE=1 SV=1 | 49 | 445 | 4.0E-161 |
sp|P64026|EFTU_NEIMA | Elongation factor Tu OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=tufA PE=3 SV=1 | 49 | 445 | 4.0E-161 |
sp|C4KZP9|EFTU_EXISA | Elongation factor Tu OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=tuf PE=3 SV=1 | 49 | 446 | 4.0E-161 |
sp|A1AVJ8|EFTU1_RUTMC | Elongation factor Tu 1 OS=Ruthia magnifica subsp. Calyptogena magnifica GN=tuf1 PE=3 SV=1 | 49 | 444 | 4.0E-161 |
sp|B3EH93|EFTU_CHLL2 | Elongation factor Tu OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=tuf PE=3 SV=1 | 49 | 446 | 5.0E-161 |
sp|Q3A6P9|EFTU2_PELCD | Elongation factor Tu 2 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=tuf2 PE=3 SV=1 | 47 | 446 | 5.0E-161 |
sp|A9WFP3|EFTU_CHLAA | Elongation factor Tu OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=tuf1 PE=3 SV=1 | 49 | 445 | 5.0E-161 |
sp|Q6FZC0|EFTU1_BARQU | Elongation factor Tu 1 OS=Bartonella quintana (strain Toulouse) GN=tuf1 PE=3 SV=1 | 49 | 446 | 5.0E-161 |
sp|O33594|EFTU_STRAU | Elongation factor Tu OS=Streptomyces aureofaciens GN=tuf1 PE=3 SV=1 | 47 | 446 | 5.0E-161 |
sp|A9WSW5|EFTU_RENSM | Elongation factor Tu OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=tuf PE=3 SV=1 | 47 | 446 | 6.0E-161 |
sp|B0SUQ7|EFTU1_CAUSK | Elongation factor Tu 1 OS=Caulobacter sp. (strain K31) GN=tuf1 PE=3 SV=1 | 49 | 446 | 7.0E-161 |
sp|P42475|EFTU_FIBSS | Elongation factor Tu OS=Fibrobacter succinogenes (strain ATCC 19169 / S85) GN=tuf1 PE=3 SV=2 | 49 | 446 | 7.0E-161 |
sp|P50371|EFTU_CHACO | Elongation factor Tu, chloroplastic OS=Chara connivens GN=tufA PE=3 SV=1 | 48 | 443 | 7.0E-161 |
sp|Q30TQ5|EFTU_SULDN | Elongation factor Tu OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=tuf PE=3 SV=1 | 49 | 445 | 8.0E-161 |
sp|A5CW32|EFTU_VESOH | Elongation factor Tu OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=tuf1 PE=3 SV=1 | 49 | 444 | 8.0E-161 |
sp|Q3A6R2|EFTU1_PELCD | Elongation factor Tu 1 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=tuf1 PE=3 SV=1 | 47 | 446 | 9.0E-161 |
sp|A1VAK4|EFTU_DESVV | Elongation factor Tu OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=tuf PE=3 SV=1 | 49 | 446 | 1.0E-160 |
sp|Q727D5|EFTU_DESVH | Elongation factor Tu OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=tuf PE=3 SV=1 | 49 | 446 | 1.0E-160 |
sp|A1USL2|EFTU2_BARBK | Elongation factor Tu 2 OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=tuf2 PE=3 SV=1 | 49 | 446 | 1.0E-160 |
sp|Q5P334|EFTU_AROAE | Elongation factor Tu OS=Aromatoleum aromaticum (strain EbN1) GN=tuf1 PE=3 SV=1 | 49 | 446 | 1.0E-160 |
sp|B1WQY4|EFTU_CYAA5 | Elongation factor Tu OS=Cyanothece sp. (strain ATCC 51142) GN=tuf PE=3 SV=1 | 47 | 446 | 2.0E-160 |
sp|B0JSE0|EFTU_MICAN | Elongation factor Tu OS=Microcystis aeruginosa (strain NIES-843) GN=tuf PE=3 SV=1 | 47 | 446 | 2.0E-160 |
sp|Q5F5Q8|EFTU_NEIG1 | Elongation factor Tu OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=tuf1 PE=3 SV=1 | 49 | 445 | 2.0E-160 |
sp|P42474|EFTU_CELLY | Elongation factor Tu OS=Cellulophaga lytica GN=tuf PE=3 SV=1 | 49 | 446 | 3.0E-160 |
sp|Q0BYB2|EFTU2_HYPNA | Elongation factor Tu 2 OS=Hyphomonas neptunium (strain ATCC 15444) GN=tuf2 PE=3 SV=1 | 47 | 446 | 3.0E-160 |
sp|A7GK18|EFTU_BACCN | Elongation factor Tu OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=tuf PE=3 SV=1 | 49 | 446 | 3.0E-160 |
sp|Q02WY9|EFTU_LACLS | Elongation factor Tu OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=tuf PE=3 SV=1 | 48 | 444 | 3.0E-160 |
sp|A2RMT1|EFTU_LACLM | Elongation factor Tu OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=tuf PE=3 SV=1 | 48 | 444 | 3.0E-160 |
sp|Q9CEI0|EFTU_LACLA | Elongation factor Tu OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=tuf PE=3 SV=1 | 48 | 444 | 3.0E-160 |
sp|A4T1R2|EFTU_MYCGI | Elongation factor Tu OS=Mycobacterium gilvum (strain PYR-GCK) GN=tuf PE=3 SV=1 | 47 | 446 | 3.0E-160 |
sp|A9VP75|EFTU_BACWK | Elongation factor Tu OS=Bacillus weihenstephanensis (strain KBAB4) GN=tuf PE=3 SV=1 | 47 | 445 | 4.0E-160 |
sp|P50064|EFTU_GLOVI | Elongation factor Tu OS=Gloeobacter violaceus (strain PCC 7421) GN=tufA PE=3 SV=2 | 47 | 446 | 4.0E-160 |
sp|B7IT17|EFTU_BACC2 | Elongation factor Tu OS=Bacillus cereus (strain G9842) GN=tuf PE=3 SV=1 | 47 | 446 | 4.0E-160 |
sp|A4SCQ7|EFTU_CHLPM | Elongation factor Tu OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=tuf PE=3 SV=1 | 49 | 444 | 5.0E-160 |
sp|Q73H85|EFTU2_WOLPM | Elongation factor Tu 2 OS=Wolbachia pipientis wMel GN=tuf2 PE=3 SV=1 | 53 | 446 | 5.0E-160 |
sp|Q2LQA3|EFTU_SYNAS | Elongation factor Tu OS=Syntrophus aciditrophicus (strain SB) GN=tuf PE=3 SV=1 | 49 | 446 | 5.0E-160 |
sp|Q3APH1|EFTU_CHLCH | Elongation factor Tu OS=Chlorobium chlorochromatii (strain CaD3) GN=tuf PE=3 SV=1 | 49 | 444 | 5.0E-160 |
sp|Q73IX6|EFTU1_WOLPM | Elongation factor Tu 1 OS=Wolbachia pipientis wMel GN=tuf1 PE=3 SV=1 | 53 | 446 | 5.0E-160 |
sp|A8LC58|EFTU_FRASN | Elongation factor Tu OS=Frankia sp. (strain EAN1pec) GN=tuf PE=3 SV=1 | 49 | 446 | 5.0E-160 |
sp|Q39Y08|EFTU_GEOMG | Elongation factor Tu OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=tuf1 PE=3 SV=1 | 47 | 446 | 6.0E-160 |
sp|A2CI56|EFTU_CHLAT | Elongation factor Tu, chloroplastic OS=Chlorokybus atmophyticus GN=tufA PE=3 SV=1 | 49 | 446 | 7.0E-160 |
sp|Q6HPR0|EFTU_BACHK | Elongation factor Tu OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=tuf PE=3 SV=1 | 47 | 446 | 7.0E-160 |
sp|Q63H92|EFTU_BACCZ | Elongation factor Tu OS=Bacillus cereus (strain ZK / E33L) GN=tuf PE=3 SV=1 | 47 | 446 | 7.0E-160 |
sp|Q814C4|EFTU_BACCR | Elongation factor Tu OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=tuf PE=3 SV=1 | 47 | 446 | 7.0E-160 |
sp|B7HJ46|EFTU_BACC4 | Elongation factor Tu OS=Bacillus cereus (strain B4264) GN=tuf PE=3 SV=1 | 47 | 446 | 7.0E-160 |
sp|C1ET37|EFTU_BACC3 | Elongation factor Tu OS=Bacillus cereus (strain 03BB102) GN=tuf PE=3 SV=1 | 47 | 446 | 7.0E-160 |
sp|B7JKB7|EFTU_BACC0 | Elongation factor Tu OS=Bacillus cereus (strain AH820) GN=tuf PE=3 SV=1 | 47 | 446 | 7.0E-160 |
sp|Q81VT2|EFTU_BACAN | Elongation factor Tu OS=Bacillus anthracis GN=tuf PE=3 SV=1 | 47 | 446 | 7.0E-160 |
sp|A0R8H8|EFTU_BACAH | Elongation factor Tu OS=Bacillus thuringiensis (strain Al Hakam) GN=tuf PE=3 SV=1 | 47 | 446 | 7.0E-160 |
sp|C3LJ80|EFTU_BACAC | Elongation factor Tu OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=tuf PE=3 SV=1 | 47 | 446 | 7.0E-160 |
sp|C3P9Q3|EFTU_BACAA | Elongation factor Tu OS=Bacillus anthracis (strain A0248) GN=tuf PE=3 SV=1 | 47 | 446 | 7.0E-160 |
sp|Q0C1F4|EFTU1_HYPNA | Elongation factor Tu 1 OS=Hyphomonas neptunium (strain ATCC 15444) GN=tuf1 PE=3 SV=1 | 47 | 446 | 8.0E-160 |
sp|C1AYS3|EFTU_RHOOB | Elongation factor Tu OS=Rhodococcus opacus (strain B4) GN=tuf PE=3 SV=1 | 47 | 446 | 8.0E-160 |
sp|Q0SFF4|EFTU_RHOJR | Elongation factor Tu OS=Rhodococcus jostii (strain RHA1) GN=tuf PE=3 SV=1 | 47 | 446 | 8.0E-160 |
sp|B0T2B5|EFTU2_CAUSK | Elongation factor Tu 2 OS=Caulobacter sp. (strain K31) GN=tuf2 PE=3 SV=1 | 49 | 446 | 1.0E-159 |
sp|Q1BDD3|EFTU_MYCSS | Elongation factor Tu OS=Mycobacterium sp. (strain MCS) GN=tuf PE=3 SV=1 | 47 | 446 | 1.0E-159 |
sp|A1UBL1|EFTU_MYCSK | Elongation factor Tu OS=Mycobacterium sp. (strain KMS) GN=tuf PE=3 SV=1 | 47 | 446 | 1.0E-159 |
sp|A3PV96|EFTU_MYCSJ | Elongation factor Tu OS=Mycobacterium sp. (strain JLS) GN=tuf PE=3 SV=1 | 47 | 446 | 1.0E-159 |
sp|B9IZJ2|EFTU_BACCQ | Elongation factor Tu OS=Bacillus cereus (strain Q1) GN=tuf PE=3 SV=1 | 47 | 446 | 1.0E-159 |
sp|B7HQU2|EFTU_BACC7 | Elongation factor Tu OS=Bacillus cereus (strain AH187) GN=tuf PE=3 SV=1 | 47 | 446 | 1.0E-159 |
sp|Q73F98|EFTU_BACC1 | Elongation factor Tu OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=tuf PE=3 SV=1 | 47 | 446 | 1.0E-159 |
sp|P29543|EFTU2_STRRA | Elongation factor Tu-2 OS=Streptomyces ramocissimus GN=tuf2 PE=3 SV=1 | 47 | 446 | 1.0E-159 |
sp|A1WHC3|EFTU_VEREI | Elongation factor Tu OS=Verminephrobacter eiseniae (strain EF01-2) GN=tuf1 PE=3 SV=1 | 49 | 445 | 1.0E-159 |
sp|Q8KAH0|EFTU_CHLTE | Elongation factor Tu OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=tuf PE=3 SV=1 | 49 | 446 | 1.0E-159 |
sp|Q5GRY3|EFTU2_WOLTR | Elongation factor Tu 2 OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=tuf2 PE=3 SV=1 | 53 | 446 | 2.0E-159 |
sp|Q5GSU2|EFTU1_WOLTR | Elongation factor Tu 1 OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=tuf1 PE=3 SV=1 | 53 | 446 | 2.0E-159 |
sp|A1BJ36|EFTU_CHLPD | Elongation factor Tu OS=Chlorobium phaeobacteroides (strain DSM 266) GN=tuf PE=3 SV=1 | 49 | 446 | 2.0E-159 |
sp|A7NR65|EFTU1_ROSCS | Elongation factor Tu 1 OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=tuf1 PE=3 SV=1 | 49 | 445 | 2.0E-159 |
sp|Q0SQC8|EFTU_CLOPS | Elongation factor Tu OS=Clostridium perfringens (strain SM101 / Type A) GN=tuf1 PE=3 SV=1 | 47 | 446 | 2.0E-159 |
sp|Q8XFP8|EFTU_CLOPE | Elongation factor Tu OS=Clostridium perfringens (strain 13 / Type A) GN=tufA PE=3 SV=1 | 47 | 446 | 2.0E-159 |
sp|Q0TMN0|EFTU_CLOP1 | Elongation factor Tu OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=tuf1 PE=3 SV=1 | 47 | 446 | 2.0E-159 |
sp|Q8ETY4|EFTU_OCEIH | Elongation factor Tu OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=tuf PE=3 SV=1 | 49 | 446 | 2.0E-159 |
sp|O50340|EFTU_FERIS | Elongation factor Tu OS=Fervidobacterium islandicum GN=tuf PE=3 SV=1 | 49 | 446 | 3.0E-159 |
sp|B9E8Q0|EFTU_MACCJ | Elongation factor Tu OS=Macrococcus caseolyticus (strain JCSC5402) GN=tuf PE=3 SV=1 | 49 | 446 | 3.0E-159 |
sp|A1USC1|EFTU1_BARBK | Elongation factor Tu 1 OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=tuf1 PE=3 SV=1 | 49 | 446 | 3.0E-159 |
sp|B7JUP5|EFTU_CYAP8 | Elongation factor Tu OS=Cyanothece sp. (strain PCC 8801) GN=tuf PE=3 SV=1 | 47 | 446 | 3.0E-159 |
sp|A6GYU7|EFTU_FLAPJ | Elongation factor Tu OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=tuf PE=3 SV=1 | 49 | 444 | 3.0E-159 |
sp|Q7TTF9|EFTU_HAEDU | Elongation factor Tu OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=tufA PE=3 SV=3 | 49 | 446 | 4.0E-159 |
sp|Q0P3M7|EFTU_OSTTA | Elongation factor Tu, chloroplastic OS=Ostreococcus tauri GN=tufA PE=3 SV=1 | 49 | 446 | 5.0E-159 |
sp|Q1R0H7|EFTU_CHRSD | Elongation factor Tu OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=tuf PE=3 SV=1 | 49 | 446 | 5.0E-159 |
sp|Q88VE0|EFTU_LACPL | Elongation factor Tu OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=tuf PE=3 SV=1 | 49 | 444 | 6.0E-159 |
sp|A1AX82|EFTU2_RUTMC | Elongation factor Tu 2 OS=Ruthia magnifica subsp. Calyptogena magnifica GN=tuf2 PE=3 SV=1 | 49 | 444 | 1.0E-158 |
sp|A4G9U0|EFTU_HERAR | Elongation factor Tu OS=Herminiimonas arsenicoxydans GN=tuf1 PE=3 SV=1 | 49 | 446 | 1.0E-158 |
sp|B2GBC2|EFTU_LACF3 | Elongation factor Tu OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=tuf PE=3 SV=1 | 49 | 445 | 2.0E-158 |
sp|Q839G8|EFTU_ENTFA | Elongation factor Tu OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=tuf PE=3 SV=1 | 49 | 446 | 2.0E-158 |
sp|Q981F7|EFTU_RHILO | Elongation factor Tu OS=Rhizobium loti (strain MAFF303099) GN=tufA PE=3 SV=1 | 49 | 444 | 2.0E-158 |
sp|A1W2Q5|EFTU1_ACISJ | Elongation factor Tu 1 OS=Acidovorax sp. (strain JS42) GN=tuf1 PE=3 SV=1 | 49 | 445 | 2.0E-158 |
sp|P33169|EFTU_SHEPU | Elongation factor Tu OS=Shewanella putrefaciens GN=tuf PE=3 SV=1 | 47 | 445 | 2.0E-158 |
sp|A4YBY5|EFTU_SHEPC | Elongation factor Tu OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=tuf1 PE=3 SV=1 | 47 | 445 | 2.0E-158 |
sp|A6Q6H4|EFTU_SULNB | Elongation factor Tu OS=Sulfurovum sp. (strain NBC37-1) GN=tuf PE=3 SV=1 | 49 | 445 | 2.0E-158 |
sp|B3EP63|EFTU_CHLPB | Elongation factor Tu OS=Chlorobium phaeobacteroides (strain BS1) GN=tuf PE=3 SV=1 | 49 | 446 | 2.0E-158 |
sp|B4S5M9|EFTU_PROA2 | Elongation factor Tu OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=tuf PE=3 SV=1 | 49 | 446 | 3.0E-158 |
sp|Q2NQL7|EFTU_SODGM | Elongation factor Tu OS=Sodalis glossinidius (strain morsitans) GN=tuf1 PE=3 SV=1 | 49 | 445 | 3.0E-158 |
sp|B1MY04|EFTU_LEUCK | Elongation factor Tu OS=Leuconostoc citreum (strain KM20) GN=tuf PE=3 SV=1 | 49 | 444 | 4.0E-158 |
sp|A1KB29|EFTU_AZOSB | Elongation factor Tu OS=Azoarcus sp. (strain BH72) GN=tuf1 PE=3 SV=1 | 49 | 446 | 4.0E-158 |
sp|Q2JUX4|EFTU_SYNJA | Elongation factor Tu OS=Synechococcus sp. (strain JA-3-3Ab) GN=tuf PE=3 SV=1 | 47 | 446 | 5.0E-158 |
sp|A1S204|EFTU_SHEAM | Elongation factor Tu OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=tuf1 PE=3 SV=1 | 47 | 444 | 5.0E-158 |
sp|A5USJ1|EFTU1_ROSS1 | Elongation factor Tu 1 OS=Roseiflexus sp. (strain RS-1) GN=tuf1 PE=3 SV=1 | 49 | 445 | 5.0E-158 |
sp|A1WCN6|EFTU2_ACISJ | Elongation factor Tu 2 OS=Acidovorax sp. (strain JS42) GN=tuf2 PE=3 SV=1 | 49 | 445 | 5.0E-158 |
sp|A4XBP8|EFTU_SALTO | Elongation factor Tu OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=tuf PE=3 SV=1 | 47 | 446 | 5.0E-158 |
sp|B0BQZ3|EFTU_ACTPJ | Elongation factor Tu OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=tuf1 PE=3 SV=1 | 49 | 446 | 6.0E-158 |
sp|A3N246|EFTU_ACTP2 | Elongation factor Tu OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=tuf1 PE=3 SV=1 | 49 | 446 | 6.0E-158 |
sp|Q9MUP0|EFTU_MESVI | Elongation factor Tu, chloroplastic OS=Mesostigma viride GN=tufA PE=3 SV=1 | 49 | 446 | 7.0E-158 |
sp|A6W5T5|EFTU_KINRD | Elongation factor Tu OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=tuf PE=3 SV=1 | 47 | 446 | 7.0E-158 |
sp|P72231|EFTU_PLARO | Elongation factor Tu OS=Planobispora rosea GN=tuf PE=3 SV=2 | 47 | 446 | 7.0E-158 |
sp|A5WGK9|EFTU1_PSYWF | Elongation factor Tu 1 OS=Psychrobacter sp. (strain PRwf-1) GN=tuf1 PE=3 SV=1 | 47 | 444 | 8.0E-158 |
sp|P17245|EFTU_CYAPA | Elongation factor Tu, cyanelle OS=Cyanophora paradoxa GN=tufA PE=3 SV=2 | 49 | 446 | 9.0E-158 |
sp|Q65PA9|EFTU_BACLD | Elongation factor Tu OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=tuf PE=3 SV=1 | 49 | 446 | 9.0E-158 |
sp|Q85FT7|EFTU_CYAME | Elongation factor Tu, chloroplastic OS=Cyanidioschyzon merolae GN=tufA PE=3 SV=1 | 49 | 446 | 1.0E-157 |
sp|Q6MDN0|EFTU_PARUW | Elongation factor Tu OS=Protochlamydia amoebophila (strain UWE25) GN=tuf PE=3 SV=1 | 49 | 446 | 1.0E-157 |
sp|Q03QN5|EFTU_LACBA | Elongation factor Tu OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=tuf PE=3 SV=1 | 49 | 444 | 1.0E-157 |
sp|B1YGU8|EFTU_EXIS2 | Elongation factor Tu OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=tuf PE=3 SV=1 | 49 | 446 | 1.0E-157 |
sp|A5WH42|EFTU2_PSYWF | Elongation factor Tu 2 OS=Psychrobacter sp. (strain PRwf-1) GN=tuf2 PE=3 SV=1 | 47 | 444 | 1.0E-157 |
sp|A8M531|EFTU_SALAI | Elongation factor Tu OS=Salinispora arenicola (strain CNS-205) GN=tuf PE=3 SV=1 | 47 | 446 | 1.0E-157 |
sp|P09953|EFTU_MICLU | Elongation factor Tu OS=Micrococcus luteus GN=tuf PE=3 SV=1 | 47 | 446 | 1.0E-157 |
sp|Q0VSL7|EFTU_ALCBS | Elongation factor Tu OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=tuf1 PE=3 SV=1 | 49 | 444 | 1.0E-157 |
GO Term | Description | Terminal node |
---|---|---|
GO:0005525 | GTP binding | Yes |
GO:0003924 | GTPase activity | Yes |
GO:0017111 | nucleoside-triphosphatase activity | No |
GO:0005488 | binding | No |
GO:0016787 | hydrolase activity | No |
GO:0003674 | molecular_function | No |
GO:0035639 | purine ribonucleoside triphosphate binding | No |
GO:0000166 | nucleotide binding | No |
GO:0043167 | ion binding | No |
GO:0019001 | guanyl nucleotide binding | No |
GO:0032553 | ribonucleotide binding | No |
GO:0097367 | carbohydrate derivative binding | No |
GO:0016817 | hydrolase activity, acting on acid anhydrides | No |
GO:0043168 | anion binding | No |
GO:0003824 | catalytic activity | No |
GO:0017076 | purine nucleotide binding | No |
GO:0097159 | organic cyclic compound binding | No |
GO:1901265 | nucleoside phosphate binding | No |
GO:0032555 | purine ribonucleotide binding | No |
GO:0016818 | hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides | No |
GO:1901363 | heterocyclic compound binding | No |
GO:0036094 | small molecule binding | No |
GO:0016462 | pyrophosphatase activity | No |
GO:0032561 | guanyl ribonucleotide binding | No |
SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
---|---|---|
No | 1 - 13 | 0.45 |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >OphauB2|3608 MSAAFRSVAPFLRASRHGLGAGQANPLQLAVKRHNASAVLNLYRTYAVYERTKPHVNIGTIGHVDHGKTTLSAAI TKRQAEKKLASFLDYGSIDKAPEERKRGITISTAHIEYSTENRHYSHVDCPGHADYIKNMITGAANMDGAIIVVA ASDGQMPQTREHLLLARQVGVQRIVVFVNKVDALDDPEMLELVEMEMRELLTSYGFEGDETPVILGSALMALNNL KPEIGQQKIDELLKAVDEWIPTPQRNLDKPFLMSIEDVFSIPGRGTVVSGRVERGVLKRDEDVEIVGKGTAILKT KVTDIETFKKSCDQSQAGDNSGLLIRGIRREDVRRGMVICKPGTVKPHTQFLASLYVLTKEEGGRHTGFHEHYRP QLYLRTADESVELTFPEGSEDSTNEKIVMPGDNIEMVATLNSANAIEVGQRFNIREGGKTVATGLVTRVLK* |
Coding | >OphauB2|3608 ATGTCGGCCGCATTCAGATCCGTCGCACCCTTTTTACGGGCGTCGCGACATGGCCTCGGAGCTGGACAAGCCAAT CCTCTCCAATTAGCCGTCAAAAGACACAATGCCTCAGCTGTACTCAATCTTTACCGCACATATGCAGTGTACGAG CGGACAAAACCCCACGTCAACATCGGCACGATTGGACATGTCGATCATGGAAAGACTACTTTATCCGCTGCTATT ACCAAGAGGCAAGCCGAGAAGAAGCTGGCTAGCTTTCTCGACTATGGTTCCATCGACAAAGCCCCTGAGGAGCGA AAGCGAGGCATCACAATTTCCACCGCCCACATCGAGTATTCGACTGAAAACCGCCATTATTCTCACGTTGACTGT CCTGGCCACGCTGACTACATCAAAAACATGATTACTGGTGCTGCCAATATGGATGGCGCCATCATTGTTGTTGCC GCTTCGGATGGACAGATGCCCCAGACCCGAGAGCATTTGCTCCTCGCACGACAGGTTGGCGTCCAAAGAATTGTC GTCTTCGTCAACAAGGTGGACGCTCTTGATGACCCTGAAATGTTGGAACTTGTCGAAATGGAAATGCGCGAGCTT CTCACCTCATACGGGTTCGAGGGCGACGAGACCCCCGTCATCTTGGGCTCTGCCTTAATGGCTCTCAACAATCTA AAGCCAGAGATTGGCCAGCAAAAGATCGATGAACTACTCAAGGCAGTAGACGAGTGGATCCCTACCCCTCAACGC AATCTCGACAAGCCGTTTCTTATGTCTATTGAGGACGTCTTCTCCATCCCTGGTCGCGGCACCGTTGTATCTGGG CGAGTCGAGCGTGGCGTGCTGAAACGTGACGAGGATGTCGAGATTGTCGGCAAGGGTACAGCCATTCTCAAGACA AAGGTGACGGACATTGAGACCTTCAAGAAGTCTTGCGACCAATCACAAGCTGGTGATAACTCTGGCCTTCTTATT CGTGGCATTCGCCGCGAGGATGTTCGTCGCGGAATGGTCATCTGCAAGCCAGGCACAGTCAAACCACATACTCAG TTTCTCGCTTCGCTATATGTCCTGACTAAGGAAGAGGGTGGCCGTCACACCGGCTTTCATGAGCACTACCGACCA CAGCTATATCTACGAACTGCTGACGAATCTGTCGAATTGACTTTTCCTGAAGGGAGCGAAGATTCCACCAACGAA AAGATCGTCATGCCTGGGGACAATATCGAGATGGTCGCTACACTTAACTCTGCTAATGCCATCGAGGTTGGGCAG CGTTTCAACATACGCGAAGGTGGCAAAACCGTGGCCACAGGCCTCGTGACTCGCGTTCTCAAATAA |
Transcript | >OphauB2|3608 ATGTCGGCCGCATTCAGATCCGTCGCACCCTTTTTACGGGCGTCGCGACATGGCCTCGGAGCTGGACAAGCCAAT CCTCTCCAATTAGCCGTCAAAAGACACAATGCCTCAGCTGTACTCAATCTTTACCGCACATATGCAGTGTACGAG CGGACAAAACCCCACGTCAACATCGGCACGATTGGACATGTCGATCATGGAAAGACTACTTTATCCGCTGCTATT ACCAAGAGGCAAGCCGAGAAGAAGCTGGCTAGCTTTCTCGACTATGGTTCCATCGACAAAGCCCCTGAGGAGCGA AAGCGAGGCATCACAATTTCCACCGCCCACATCGAGTATTCGACTGAAAACCGCCATTATTCTCACGTTGACTGT CCTGGCCACGCTGACTACATCAAAAACATGATTACTGGTGCTGCCAATATGGATGGCGCCATCATTGTTGTTGCC GCTTCGGATGGACAGATGCCCCAGACCCGAGAGCATTTGCTCCTCGCACGACAGGTTGGCGTCCAAAGAATTGTC GTCTTCGTCAACAAGGTGGACGCTCTTGATGACCCTGAAATGTTGGAACTTGTCGAAATGGAAATGCGCGAGCTT CTCACCTCATACGGGTTCGAGGGCGACGAGACCCCCGTCATCTTGGGCTCTGCCTTAATGGCTCTCAACAATCTA AAGCCAGAGATTGGCCAGCAAAAGATCGATGAACTACTCAAGGCAGTAGACGAGTGGATCCCTACCCCTCAACGC AATCTCGACAAGCCGTTTCTTATGTCTATTGAGGACGTCTTCTCCATCCCTGGTCGCGGCACCGTTGTATCTGGG CGAGTCGAGCGTGGCGTGCTGAAACGTGACGAGGATGTCGAGATTGTCGGCAAGGGTACAGCCATTCTCAAGACA AAGGTGACGGACATTGAGACCTTCAAGAAGTCTTGCGACCAATCACAAGCTGGTGATAACTCTGGCCTTCTTATT CGTGGCATTCGCCGCGAGGATGTTCGTCGCGGAATGGTCATCTGCAAGCCAGGCACAGTCAAACCACATACTCAG TTTCTCGCTTCGCTATATGTCCTGACTAAGGAAGAGGGTGGCCGTCACACCGGCTTTCATGAGCACTACCGACCA CAGCTATATCTACGAACTGCTGACGAATCTGTCGAATTGACTTTTCCTGAAGGGAGCGAAGATTCCACCAACGAA AAGATCGTCATGCCTGGGGACAATATCGAGATGGTCGCTACACTTAACTCTGCTAATGCCATCGAGGTTGGGCAG CGTTTCAACATACGCGAAGGTGGCAAAACCGTGGCCACAGGCCTCGTGACTCGCGTTCTCAAATAA |
Gene | >OphauB2|3608 ATGTCGGCCGCATTCAGATCCGTCGCACCCTTTTTACGGGCGTCGCGACATGGCCTCGGAGCTGGACAAGCCAAT CCTCTCCAATTAGCCGTCAAAAGACACAATGCCTCAGCTGTACTCAATCTTTACCGCACATATGCAGTGTACGAG CGGACAAAACCCCACGTCAACATCGGTATGAGGTTCAATGCCATTTGGGCACTCGGTTAATGCTTACAATCTCCA AACAGGCACGATTGGACATGTCGATCATGGAAAGGTAAACTGTTGTCCCAACACCATGTGCCGTCTAGTGGACTG ACATTTGGTCTTGTTAGACTACTTTATCCGCTGCTATTACCAAGAGGCAAGCCGAGAAGAAGCTGGCTAGCTTTC TCGACTATGGTTCCATCGACAAAGCCCCTGAGGAGCGAAAGCGAGGCATCACAATTTCCACCGCCCACATCGAGT ATTCGACTGAAAACCGCCATTATTCTCACGTTGACTGTCCTGGCCACGCTGACTACATCAAAAACATGATTACTG GTGCTGCCAATATGGATGGCGCCATCATTGTTGTTGCCGCTTCGGATGGACAGATGCCCCAGACCCGAGAGCATT TGCTCCTCGCACGACAGGTTGGCGTCCAAAGAATTGTCGTCTTCGTCAACAAGGTGGACGCTCTTGATGACCCTG AAATGTTGGAACTTGTCGAAATGGAAATGCGCGAGCTTCTCACCTCATACGGGTTCGAGGGCGACGAGACCCCCG TCATCTTGGGCTCTGCCTTAATGGCTCTCAACAATCTAAAGCCAGAGATTGGCCAGCAAAAGATCGATGAACTAC TCAAGGCAGTAGACGAGTGGATCCCTACCCCTCAACGCAATCTCGACAAGCCGTTTCTTATGTCTATTGAGGACG TCTTCTCCATCCCTGGTCGCGGCACCGTTGTATCTGGGCGAGTCGAGCGTGGCGTGCTGAAACGTGACGAGGATG TCGAGATTGTCGGCAAGGGTACAGCCATTCTCAAGACAAAGGTGACGGACATTGAGACCTTCAAGAAGTCTTGCG ACCAATCACAAGCTGGTGATAACTCTGGCCTTCTTATTCGTGGCATTCGCCGCGAGGATGTTCGTCGCGGAATGG TCATCTGCAAGCCAGGCACAGTCAAACCACATACTCAGTTTCTCGCTTCGCTATATGTCCTGACTAAGGAAGAGG GTGGCCGTCACACCGGCTTTCATGAGCACTACCGACCACAGCTATATCTACGAACTGCTGACGAATCTGTCGAAT TGACTTTTCCTGAAGGGAGCGAAGATTCCACCAACGAAAAGATCGTCATGCCTGGGGACAATATCGAGATGGTCG CTACACTTAACTCTGCTAATGCCATCGAGGTTGGGCAGCGTTTCAACATACGCGAAGGTGGCAAAACCGTGGCCA CAGGCCTCGTGACTCGCGTTCTCAAATAA |