Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|359
Gene name
LocationContig_103:30014..32396
Strand-
Gene length (bp)2382
Transcript length (bp)2382
Coding sequence length (bp)2382
Protein length (aa) 794

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06985 HET Heterokaryon incompatibility protein (HET) 1.5E-26 60 228

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9UV10|HET6_NEUCR Heterokaryon incompatibility protein 6, OR allele OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=het-6 PE=4 SV=1 59 249 2.0E-14

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 598 620 22
2 627 645 18
3 660 682 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|359
MQAYRYQPLQPGEIRLLRLDALSRPDQPLSGTILHHKLTNPTFCHGTAGQLDTLQHAQSYEAISYHWGSDFSTPY
QLAIHSPYNDSIPSVIPITASLEYVLRRLALPNRPRVLWADAICINQVNSRANQEKGQQIQLMPDIYRTAACVQI
CLGRADANDNVPAALALLRTIADYSQYLDDTEHPAGEIGTRLAAERGFVLPKPNDPCWAALRSFWRRPWFRRVWI
IQEFVYAADVNMFCGDHLVDWRLLWLASKAYCDNRQLIFAGFRPDWYGRRRFDEYREAHEGSAGTLHVTDLRMRA
WGYMSKIYMAMSLDADEMSDQYSGLTIRKTLDSITEFEHVTRSRLLQDRALGTTFSYGRPDIMELLTRTSNFHAT
QPVDRIYALLGLAEDTYGIEPVYSHRDTVARVTTRLAVALINGGRLSEVLALAGVRADTSMNGAPSWVPDWTKQL
YAQDKTVGFTRMSNMGQTSELRQYVGPAKDPASADKVDAEAEKPKPEDIIYNAALDTNPEFHLDEANGTLAVKVT
VVDRVVNVLPGQLLLGLPMYSGMAQKLGPTYPTGESIEEALWRTLIGNLTFHGEKPSEEYATQYANLKSRELTLL
VRATIMLFLGFMFTLPLVIFALRRLHLLVLVGCVVVLIMLRRVAPVQGVMLLVLLPVFRWLWTMCLVPALMALAW
YGTVHVYPMQTLEFYKYLGVSAVAIRGTVPPDCTAYLMRFAIISNRYNLCFTGYNLMGLLPIATRAGDLVVIVHG
CNVPFVVRPTEREGYFGLVGECYVHGVMNGECLVGQPQSLTLV*
Coding >OphauB2|359
ATGCAAGCCTATCGCTATCAGCCTCTTCAGCCAGGCGAGATCCGTCTCCTCCGCCTCGACGCCCTCAGCCGGCCC
GACCAACCGCTCAGTGGAACTATTCTTCACCACAAGTTGACGAATCCCACATTTTGTCACGGCACAGCTGGCCAG
CTCGATACCCTCCAACATGCTCAGAGCTACGAGGCCATCTCGTATCATTGGGGCTCTGATTTCTCAACGCCCTAT
CAGCTTGCCATCCACTCTCCATACAATGACAGCATTCCTTCCGTCATACCAATTACGGCCTCTCTAGAGTACGTC
CTGCGCCGCCTGGCCTTGCCCAATCGCCCTCGGGTGCTCTGGGCCGACGCCATTTGCATCAACCAGGTCAACTCT
CGCGCCAATCAGGAAAAGGGCCAACAGATCCAGCTCATGCCCGACATATACCGCACTGCAGCCTGTGTGCAAATT
TGTCTTGGCCGTGCCGATGCCAACGACAATGTCCCTGCTGCTCTTGCCCTGCTGCGCACCATTGCCGACTACTCA
CAGTACCTCGACGACACTGAGCACCCGGCCGGCGAGATTGGCACCAGGCTGGCCGCTGAGCGAGGCTTCGTGCTC
CCCAAGCCCAATGACCCTTGCTGGGCTGCGCTTCGGTCCTTTTGGCGCCGTCCTTGGTTCCGTCGGGTCTGGATC
ATTCAGGAATTCGTCTACGCTGCCGATGTCAACATGTTTTGCGGTGACCATTTAGTTGATTGGCGTCTTTTATGG
CTCGCATCCAAAGCCTACTGCGACAATCGTCAACTCATTTTTGCTGGTTTTCGCCCCGATTGGTATGGGCGACGC
CGCTTTGATGAGTATCGCGAAGCCCATGAGGGCTCTGCAGGCACCCTTCATGTCACCGACTTGCGCATGCGTGCC
TGGGGCTACATGTCCAAGATCTACATGGCCATGAGTTTAGACGCAGATGAAATGTCAGATCAATACTCAGGCCTG
ACAATCCGCAAAACGCTCGACTCCATTACAGAATTCGAACACGTCACACGCAGTAGATTGCTCCAGGATCGCGCG
CTTGGTACCACCTTCTCCTATGGTCGACCTGACATTATGGAGCTGTTGACCCGTACATCCAACTTTCACGCCACT
CAGCCTGTCGACCGAATATATGCCTTGCTTGGCCTAGCAGAAGACACATATGGAATCGAGCCTGTATACTCTCAT
CGAGATACTGTTGCTCGAGTAACGACGCGCCTTGCTGTTGCCTTAATCAACGGCGGCCGCCTTTCTGAAGTGCTC
GCCCTTGCCGGAGTCAGAGCAGACACATCAATGAATGGTGCGCCGTCATGGGTTCCAGACTGGACCAAGCAACTG
TATGCACAAGACAAGACTGTAGGTTTCACACGAATGTCCAACATGGGGCAGACAAGCGAGCTTCGCCAATACGTT
GGTCCTGCCAAAGACCCTGCAAGCGCGGACAAAGTAGATGCCGAGGCCGAAAAGCCAAAGCCCGAGGACATTATA
TACAATGCCGCACTGGACACAAACCCCGAGTTTCATCTCGACGAGGCTAATGGTACCCTGGCTGTCAAAGTCACC
GTTGTTGACAGAGTAGTCAATGTGCTGCCCGGACAGCTGCTCCTTGGCCTCCCCATGTACTCGGGCATGGCACAG
AAGCTAGGCCCGACGTATCCCACGGGCGAGTCTATTGAGGAAGCACTGTGGAGGACCTTGATTGGGAATCTCACC
TTTCACGGCGAGAAGCCATCGGAAGAATATGCAACTCAGTATGCCAACCTCAAAAGCCGCGAGCTGACACTTCTC
GTCCGAGCCACCATTATGCTTTTCTTGGGATTCATGTTTACTCTGCCTCTTGTCATATTTGCATTGAGGCGTCTT
CACCTCCTTGTGCTGGTGGGGTGCGTCGTCGTGTTGATCATGCTGAGGAGAGTGGCCCCTGTCCAAGGCGTCATG
TTACTCGTGCTGCTACCTGTGTTTCGCTGGCTGTGGACCATGTGCCTCGTACCCGCCTTGATGGCGCTGGCATGG
TATGGCACAGTCCACGTGTACCCAATGCAGACTCTGGAATTCTACAAATATCTGGGCGTGTCGGCCGTGGCAATA
AGGGGCACTGTACCGCCCGACTGTACAGCCTACCTAATGCGCTTCGCCATTATAAGCAACCGGTACAACCTGTGC
TTCACCGGGTACAATCTCATGGGACTGCTGCCTATTGCGACGCGTGCGGGAGACTTGGTGGTGATAGTACACGGG
TGTAACGTGCCGTTTGTCGTGCGGCCGACAGAGCGGGAGGGCTATTTTGGTCTGGTGGGCGAATGCTATGTGCAT
GGTGTCATGAATGGGGAGTGTTTGGTTGGACAGCCACAGAGCCTGACCCTAGTATAG
Transcript >OphauB2|359
ATGCAAGCCTATCGCTATCAGCCTCTTCAGCCAGGCGAGATCCGTCTCCTCCGCCTCGACGCCCTCAGCCGGCCC
GACCAACCGCTCAGTGGAACTATTCTTCACCACAAGTTGACGAATCCCACATTTTGTCACGGCACAGCTGGCCAG
CTCGATACCCTCCAACATGCTCAGAGCTACGAGGCCATCTCGTATCATTGGGGCTCTGATTTCTCAACGCCCTAT
CAGCTTGCCATCCACTCTCCATACAATGACAGCATTCCTTCCGTCATACCAATTACGGCCTCTCTAGAGTACGTC
CTGCGCCGCCTGGCCTTGCCCAATCGCCCTCGGGTGCTCTGGGCCGACGCCATTTGCATCAACCAGGTCAACTCT
CGCGCCAATCAGGAAAAGGGCCAACAGATCCAGCTCATGCCCGACATATACCGCACTGCAGCCTGTGTGCAAATT
TGTCTTGGCCGTGCCGATGCCAACGACAATGTCCCTGCTGCTCTTGCCCTGCTGCGCACCATTGCCGACTACTCA
CAGTACCTCGACGACACTGAGCACCCGGCCGGCGAGATTGGCACCAGGCTGGCCGCTGAGCGAGGCTTCGTGCTC
CCCAAGCCCAATGACCCTTGCTGGGCTGCGCTTCGGTCCTTTTGGCGCCGTCCTTGGTTCCGTCGGGTCTGGATC
ATTCAGGAATTCGTCTACGCTGCCGATGTCAACATGTTTTGCGGTGACCATTTAGTTGATTGGCGTCTTTTATGG
CTCGCATCCAAAGCCTACTGCGACAATCGTCAACTCATTTTTGCTGGTTTTCGCCCCGATTGGTATGGGCGACGC
CGCTTTGATGAGTATCGCGAAGCCCATGAGGGCTCTGCAGGCACCCTTCATGTCACCGACTTGCGCATGCGTGCC
TGGGGCTACATGTCCAAGATCTACATGGCCATGAGTTTAGACGCAGATGAAATGTCAGATCAATACTCAGGCCTG
ACAATCCGCAAAACGCTCGACTCCATTACAGAATTCGAACACGTCACACGCAGTAGATTGCTCCAGGATCGCGCG
CTTGGTACCACCTTCTCCTATGGTCGACCTGACATTATGGAGCTGTTGACCCGTACATCCAACTTTCACGCCACT
CAGCCTGTCGACCGAATATATGCCTTGCTTGGCCTAGCAGAAGACACATATGGAATCGAGCCTGTATACTCTCAT
CGAGATACTGTTGCTCGAGTAACGACGCGCCTTGCTGTTGCCTTAATCAACGGCGGCCGCCTTTCTGAAGTGCTC
GCCCTTGCCGGAGTCAGAGCAGACACATCAATGAATGGTGCGCCGTCATGGGTTCCAGACTGGACCAAGCAACTG
TATGCACAAGACAAGACTGTAGGTTTCACACGAATGTCCAACATGGGGCAGACAAGCGAGCTTCGCCAATACGTT
GGTCCTGCCAAAGACCCTGCAAGCGCGGACAAAGTAGATGCCGAGGCCGAAAAGCCAAAGCCCGAGGACATTATA
TACAATGCCGCACTGGACACAAACCCCGAGTTTCATCTCGACGAGGCTAATGGTACCCTGGCTGTCAAAGTCACC
GTTGTTGACAGAGTAGTCAATGTGCTGCCCGGACAGCTGCTCCTTGGCCTCCCCATGTACTCGGGCATGGCACAG
AAGCTAGGCCCGACGTATCCCACGGGCGAGTCTATTGAGGAAGCACTGTGGAGGACCTTGATTGGGAATCTCACC
TTTCACGGCGAGAAGCCATCGGAAGAATATGCAACTCAGTATGCCAACCTCAAAAGCCGCGAGCTGACACTTCTC
GTCCGAGCCACCATTATGCTTTTCTTGGGATTCATGTTTACTCTGCCTCTTGTCATATTTGCATTGAGGCGTCTT
CACCTCCTTGTGCTGGTGGGGTGCGTCGTCGTGTTGATCATGCTGAGGAGAGTGGCCCCTGTCCAAGGCGTCATG
TTACTCGTGCTGCTACCTGTGTTTCGCTGGCTGTGGACCATGTGCCTCGTACCCGCCTTGATGGCGCTGGCATGG
TATGGCACAGTCCACGTGTACCCAATGCAGACTCTGGAATTCTACAAATATCTGGGCGTGTCGGCCGTGGCAATA
AGGGGCACTGTACCGCCCGACTGTACAGCCTACCTAATGCGCTTCGCCATTATAAGCAACCGGTACAACCTGTGC
TTCACCGGGTACAATCTCATGGGACTGCTGCCTATTGCGACGCGTGCGGGAGACTTGGTGGTGATAGTACACGGG
TGTAACGTGCCGTTTGTCGTGCGGCCGACAGAGCGGGAGGGCTATTTTGGTCTGGTGGGCGAATGCTATGTGCAT
GGTGTCATGAATGGGGAGTGTTTGGTTGGACAGCCACAGAGCCTGACCCTAGTATAG
Gene >OphauB2|359
ATGCAAGCCTATCGCTATCAGCCTCTTCAGCCAGGCGAGATCCGTCTCCTCCGCCTCGACGCCCTCAGCCGGCCC
GACCAACCGCTCAGTGGAACTATTCTTCACCACAAGTTGACGAATCCCACATTTTGTCACGGCACAGCTGGCCAG
CTCGATACCCTCCAACATGCTCAGAGCTACGAGGCCATCTCGTATCATTGGGGCTCTGATTTCTCAACGCCCTAT
CAGCTTGCCATCCACTCTCCATACAATGACAGCATTCCTTCCGTCATACCAATTACGGCCTCTCTAGAGTACGTC
CTGCGCCGCCTGGCCTTGCCCAATCGCCCTCGGGTGCTCTGGGCCGACGCCATTTGCATCAACCAGGTCAACTCT
CGCGCCAATCAGGAAAAGGGCCAACAGATCCAGCTCATGCCCGACATATACCGCACTGCAGCCTGTGTGCAAATT
TGTCTTGGCCGTGCCGATGCCAACGACAATGTCCCTGCTGCTCTTGCCCTGCTGCGCACCATTGCCGACTACTCA
CAGTACCTCGACGACACTGAGCACCCGGCCGGCGAGATTGGCACCAGGCTGGCCGCTGAGCGAGGCTTCGTGCTC
CCCAAGCCCAATGACCCTTGCTGGGCTGCGCTTCGGTCCTTTTGGCGCCGTCCTTGGTTCCGTCGGGTCTGGATC
ATTCAGGAATTCGTCTACGCTGCCGATGTCAACATGTTTTGCGGTGACCATTTAGTTGATTGGCGTCTTTTATGG
CTCGCATCCAAAGCCTACTGCGACAATCGTCAACTCATTTTTGCTGGTTTTCGCCCCGATTGGTATGGGCGACGC
CGCTTTGATGAGTATCGCGAAGCCCATGAGGGCTCTGCAGGCACCCTTCATGTCACCGACTTGCGCATGCGTGCC
TGGGGCTACATGTCCAAGATCTACATGGCCATGAGTTTAGACGCAGATGAAATGTCAGATCAATACTCAGGCCTG
ACAATCCGCAAAACGCTCGACTCCATTACAGAATTCGAACACGTCACACGCAGTAGATTGCTCCAGGATCGCGCG
CTTGGTACCACCTTCTCCTATGGTCGACCTGACATTATGGAGCTGTTGACCCGTACATCCAACTTTCACGCCACT
CAGCCTGTCGACCGAATATATGCCTTGCTTGGCCTAGCAGAAGACACATATGGAATCGAGCCTGTATACTCTCAT
CGAGATACTGTTGCTCGAGTAACGACGCGCCTTGCTGTTGCCTTAATCAACGGCGGCCGCCTTTCTGAAGTGCTC
GCCCTTGCCGGAGTCAGAGCAGACACATCAATGAATGGTGCGCCGTCATGGGTTCCAGACTGGACCAAGCAACTG
TATGCACAAGACAAGACTGTAGGTTTCACACGAATGTCCAACATGGGGCAGACAAGCGAGCTTCGCCAATACGTT
GGTCCTGCCAAAGACCCTGCAAGCGCGGACAAAGTAGATGCCGAGGCCGAAAAGCCAAAGCCCGAGGACATTATA
TACAATGCCGCACTGGACACAAACCCCGAGTTTCATCTCGACGAGGCTAATGGTACCCTGGCTGTCAAAGTCACC
GTTGTTGACAGAGTAGTCAATGTGCTGCCCGGACAGCTGCTCCTTGGCCTCCCCATGTACTCGGGCATGGCACAG
AAGCTAGGCCCGACGTATCCCACGGGCGAGTCTATTGAGGAAGCACTGTGGAGGACCTTGATTGGGAATCTCACC
TTTCACGGCGAGAAGCCATCGGAAGAATATGCAACTCAGTATGCCAACCTCAAAAGCCGCGAGCTGACACTTCTC
GTCCGAGCCACCATTATGCTTTTCTTGGGATTCATGTTTACTCTGCCTCTTGTCATATTTGCATTGAGGCGTCTT
CACCTCCTTGTGCTGGTGGGGTGCGTCGTCGTGTTGATCATGCTGAGGAGAGTGGCCCCTGTCCAAGGCGTCATG
TTACTCGTGCTGCTACCTGTGTTTCGCTGGCTGTGGACCATGTGCCTCGTACCCGCCTTGATGGCGCTGGCATGG
TATGGCACAGTCCACGTGTACCCAATGCAGACTCTGGAATTCTACAAATATCTGGGCGTGTCGGCCGTGGCAATA
AGGGGCACTGTACCGCCCGACTGTACAGCCTACCTAATGCGCTTCGCCATTATAAGCAACCGGTACAACCTGTGC
TTCACCGGGTACAATCTCATGGGACTGCTGCCTATTGCGACGCGTGCGGGAGACTTGGTGGTGATAGTACACGGG
TGTAACGTGCCGTTTGTCGTGCGGCCGACAGAGCGGGAGGGCTATTTTGGTCTGGTGGGCGAATGCTATGTGCAT
GGTGTCATGAATGGGGAGTGTTTGGTTGGACAGCCACAGAGCCTGACCCTAGTATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail