Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3581
Gene name
LocationContig_23:8206..10111
Strand-
Gene length (bp)1905
Transcript length (bp)1800
Coding sequence length (bp)1800
Protein length (aa) 600

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00955 HCO3_cotransp HCO3- transporter family 1.3E-47 24 185
PF00955 HCO3_cotransp HCO3- transporter family 4.6E-39 196 468

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HGM6|YHW5_SCHPO Putative transporter C543.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC543.05c PE=3 SV=1 28 519 0.0E+00
sp|P53838|BOR1_YEAST Boron transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BOR1 PE=1 SV=1 31 530 6.0E-147
sp|P04919|B3AT_MOUSE Band 3 anion transport protein OS=Mus musculus GN=Slc4a1 PE=1 SV=1 4 523 8.0E-56
sp|P02730|B3AT_HUMAN Band 3 anion transport protein OS=Homo sapiens GN=SLC4A1 PE=1 SV=3 23 523 2.0E-55
sp|Q3E954|BOR6_ARATH Probable boron transporter 6 OS=Arabidopsis thaliana GN=BOR6 PE=2 SV=2 25 525 1.0E-54
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HGM6|YHW5_SCHPO Putative transporter C543.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC543.05c PE=3 SV=1 28 519 0.0E+00
sp|P53838|BOR1_YEAST Boron transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BOR1 PE=1 SV=1 31 530 6.0E-147
sp|P04919|B3AT_MOUSE Band 3 anion transport protein OS=Mus musculus GN=Slc4a1 PE=1 SV=1 4 523 8.0E-56
sp|P02730|B3AT_HUMAN Band 3 anion transport protein OS=Homo sapiens GN=SLC4A1 PE=1 SV=3 23 523 2.0E-55
sp|Q3E954|BOR6_ARATH Probable boron transporter 6 OS=Arabidopsis thaliana GN=BOR6 PE=2 SV=2 25 525 1.0E-54
sp|Q9SUU1|BOR7_ARATH Probable boron transporter 7 OS=Arabidopsis thaliana GN=BOR7 PE=2 SV=3 25 524 6.0E-52
sp|Q9SSG5|BOR5_ARATH Putative boron transporter 5 OS=Arabidopsis thaliana GN=BOR5 PE=3 SV=1 25 519 9.0E-52
sp|P23562|B3AT_RAT Band 3 anion transport protein OS=Rattus norvegicus GN=Slc4a1 PE=1 SV=3 4 523 8.0E-51
sp|Q93Z13|BOR3_ARATH Probable boron transporter 3 OS=Arabidopsis thaliana GN=BOR3 PE=1 SV=1 25 519 1.0E-50
sp|P15575|B3AT_CHICK Band 3 anion transport protein OS=Gallus gallus GN=SLC4A1 PE=2 SV=1 5 522 8.0E-50
sp|Q5RB85|B3A3_PONAB Anion exchange protein 3 OS=Pongo abelii GN=SLC4A3 PE=2 SV=1 24 529 9.0E-49
sp|P13808|B3A2_MOUSE Anion exchange protein 2 OS=Mus musculus GN=Slc4a2 PE=1 SV=1 25 523 3.0E-48
sp|Q9M1P7|BOR2_ARATH Probable boron transporter 2 OS=Arabidopsis thaliana GN=BOR2 PE=2 SV=1 25 519 4.0E-48
sp|P23347|B3A2_RAT Anion exchange protein 2 OS=Rattus norvegicus GN=Slc4a2 PE=1 SV=1 25 523 4.0E-48
sp|B1MTL0|B3A3_CALMO Anion exchange protein 3 OS=Callicebus moloch GN=SLC4A3 PE=3 SV=1 24 529 4.0E-48
sp|P04920|B3A2_HUMAN Anion exchange protein 2 OS=Homo sapiens GN=SLC4A2 PE=1 SV=4 25 523 2.0E-47
sp|Q6SJP2|B3A2_HORSE Anion exchange protein 2 OS=Equus caballus GN=SLC4A2 PE=2 SV=1 25 523 2.0E-47
sp|P48751|B3A3_HUMAN Anion exchange protein 3 OS=Homo sapiens GN=SLC4A3 PE=2 SV=2 24 529 3.0E-47
sp|P23348|B3A3_RAT Anion exchange protein 3 OS=Rattus norvegicus GN=Slc4a3 PE=1 SV=1 24 529 3.0E-47
sp|P16283|B3A3_MOUSE Anion exchange protein 3 OS=Mus musculus GN=Slc4a3 PE=1 SV=2 24 529 3.0E-47
sp|O18917|B3A3_RABIT Anion exchange protein 3 OS=Oryctolagus cuniculus GN=SLC4A3 PE=2 SV=1 24 529 4.0E-47
sp|P48746|B3A2_RABIT Anion exchange protein 2 OS=Oryctolagus cuniculus GN=SLC4A2 PE=2 SV=1 25 523 7.0E-47
sp|Q9XI23|BOR4_ARATH Boron transporter 4 OS=Arabidopsis thaliana GN=BOR4 PE=2 SV=1 23 394 8.0E-47
sp|Q8VYR7|BOR1_ARATH Boron transporter 1 OS=Arabidopsis thaliana GN=BOR1 PE=1 SV=1 25 519 1.0E-46
sp|P32847|B3AT_ONCMY Band 3 anion exchange protein OS=Oncorhynchus mykiss GN=slc4a1 PE=2 SV=2 6 519 3.0E-46
sp|Q5RD44|B3A2_PONAB Anion exchange protein 2 OS=Pongo abelii GN=SLC4A2 PE=2 SV=2 25 523 4.0E-46
sp|Q9Z0S8|B3A2_CAVPO Anion exchange protein 2 OS=Cavia porcellus GN=SLC4A2 PE=2 SV=1 25 523 8.0E-45
sp|Q8K4V2|B3A4_RAT Anion exchange protein 4 OS=Rattus norvegicus GN=Slc4a9 PE=1 SV=1 7 519 7.0E-36
sp|Q5DTL9|S4A10_MOUSE Sodium-driven chloride bicarbonate exchanger OS=Mus musculus GN=Slc4a10 PE=1 SV=2 24 566 1.0E-32
sp|Q8NBS3|S4A11_HUMAN Sodium bicarbonate transporter-like protein 11 OS=Homo sapiens GN=SLC4A11 PE=1 SV=2 5 519 1.0E-28
sp|Q4U116|S4A4_PIG Electrogenic sodium bicarbonate cotransporter 1 OS=Sus scrofa GN=SLC4A4 PE=1 SV=1 27 194 2.0E-25
sp|Q9GL77|S4A4_BOVIN Electrogenic sodium bicarbonate cotransporter 1 OS=Bos taurus GN=SLC4A4 PE=1 SV=1 27 194 3.0E-25
sp|Q9Y6R1|S4A4_HUMAN Electrogenic sodium bicarbonate cotransporter 1 OS=Homo sapiens GN=SLC4A4 PE=1 SV=1 27 194 3.0E-25
sp|Q9JI66|S4A4_RAT Electrogenic sodium bicarbonate cotransporter 1 OS=Rattus norvegicus GN=Slc4a4 PE=1 SV=1 27 194 4.0E-25
sp|Q9XSZ4|S4A4_RABIT Electrogenic sodium bicarbonate cotransporter 1 OS=Oryctolagus cuniculus GN=SLC4A4 PE=1 SV=1 27 194 7.0E-25
sp|O88343|S4A4_MOUSE Electrogenic sodium bicarbonate cotransporter 1 OS=Mus musculus GN=Slc4a4 PE=1 SV=2 27 194 8.0E-25
sp|Q6RI88|S4A5_RAT Electrogenic sodium bicarbonate cotransporter 4 OS=Rattus norvegicus GN=Slc4a5 PE=1 SV=1 15 186 2.0E-24
sp|Q9BY07|S4A5_HUMAN Electrogenic sodium bicarbonate cotransporter 4 OS=Homo sapiens GN=SLC4A5 PE=2 SV=2 15 186 2.0E-24
sp|A2AJN7|S4A11_MOUSE Sodium bicarbonate transporter-like protein 11 OS=Mus musculus GN=Slc4a11 PE=2 SV=1 26 519 2.0E-24
sp|Q9GKY1|B3A4_RABIT Anion exchange protein 4 OS=Oryctolagus cuniculus GN=SLC4A9 PE=1 SV=2 6 183 3.0E-24
sp|Q96Q91|B3A4_HUMAN Anion exchange protein 4 OS=Homo sapiens GN=SLC4A9 PE=2 SV=2 23 183 3.0E-24
sp|Q32LP4|S4A10_BOVIN Sodium-driven chloride bicarbonate exchanger OS=Bos taurus GN=SLC4A10 PE=2 SV=1 24 215 5.0E-23
sp|Q6U841|S4A10_HUMAN Sodium-driven chloride bicarbonate exchanger OS=Homo sapiens GN=SLC4A10 PE=2 SV=1 24 215 5.0E-23
sp|Q80ZA5|S4A10_RAT Sodium-driven chloride bicarbonate exchanger OS=Rattus norvegicus GN=Slc4a10 PE=1 SV=1 24 219 9.0E-23
sp|Q8BTY2|S4A7_MOUSE Sodium bicarbonate cotransporter 3 OS=Mus musculus GN=Slc4a7 PE=1 SV=2 4 190 1.0E-22
sp|Q9Y6M7|S4A7_HUMAN Sodium bicarbonate cotransporter 3 OS=Homo sapiens GN=SLC4A7 PE=1 SV=2 23 197 1.0E-22
sp|Q8JZR6|S4A8_MOUSE Electroneutral sodium bicarbonate exchanger 1 OS=Mus musculus GN=Slc4a8 PE=2 SV=1 24 197 2.0E-22
sp|O13134|S4A4_AMBTI Electrogenic sodium bicarbonate cotransporter 1 OS=Ambystoma tigrinum GN=SLC4A4 PE=2 SV=1 27 194 3.0E-22
sp|Q9R1N3|S4A7_RAT Sodium bicarbonate cotransporter 3 OS=Rattus norvegicus GN=Slc4a7 PE=1 SV=1 2 190 6.0E-22
sp|Q2Y0W8|S4A8_HUMAN Electroneutral sodium bicarbonate exchanger 1 OS=Homo sapiens GN=SLC4A8 PE=1 SV=1 24 197 9.0E-22
sp|O13134|S4A4_AMBTI Electrogenic sodium bicarbonate cotransporter 1 OS=Ambystoma tigrinum GN=SLC4A4 PE=2 SV=1 202 519 3.0E-21
sp|Q9Y6R1|S4A4_HUMAN Electrogenic sodium bicarbonate cotransporter 1 OS=Homo sapiens GN=SLC4A4 PE=1 SV=1 202 519 6.0E-19
sp|Q9XSZ4|S4A4_RABIT Electrogenic sodium bicarbonate cotransporter 1 OS=Oryctolagus cuniculus GN=SLC4A4 PE=1 SV=1 202 519 7.0E-19
sp|Q4U116|S4A4_PIG Electrogenic sodium bicarbonate cotransporter 1 OS=Sus scrofa GN=SLC4A4 PE=1 SV=1 202 519 8.0E-19
sp|Q9Y6M7|S4A7_HUMAN Sodium bicarbonate cotransporter 3 OS=Homo sapiens GN=SLC4A7 PE=1 SV=2 221 519 8.0E-19
sp|Q9JI66|S4A4_RAT Electrogenic sodium bicarbonate cotransporter 1 OS=Rattus norvegicus GN=Slc4a4 PE=1 SV=1 202 519 1.0E-18
sp|Q9R1N3|S4A7_RAT Sodium bicarbonate cotransporter 3 OS=Rattus norvegicus GN=Slc4a7 PE=1 SV=1 221 519 2.0E-18
sp|Q9GL77|S4A4_BOVIN Electrogenic sodium bicarbonate cotransporter 1 OS=Bos taurus GN=SLC4A4 PE=1 SV=1 202 519 2.0E-18
sp|O88343|S4A4_MOUSE Electrogenic sodium bicarbonate cotransporter 1 OS=Mus musculus GN=Slc4a4 PE=1 SV=2 202 519 3.0E-18
sp|Q6RI88|S4A5_RAT Electrogenic sodium bicarbonate cotransporter 4 OS=Rattus norvegicus GN=Slc4a5 PE=1 SV=1 218 519 7.0E-18
sp|Q80ZA5|S4A10_RAT Sodium-driven chloride bicarbonate exchanger OS=Rattus norvegicus GN=Slc4a10 PE=1 SV=1 190 566 7.0E-18
sp|Q32LP4|S4A10_BOVIN Sodium-driven chloride bicarbonate exchanger OS=Bos taurus GN=SLC4A10 PE=2 SV=1 217 566 4.0E-17
sp|Q6U841|S4A10_HUMAN Sodium-driven chloride bicarbonate exchanger OS=Homo sapiens GN=SLC4A10 PE=2 SV=1 217 566 6.0E-17
sp|Q2Y0W8|S4A8_HUMAN Electroneutral sodium bicarbonate exchanger 1 OS=Homo sapiens GN=SLC4A8 PE=1 SV=1 195 519 2.0E-16
sp|Q8JZR6|S4A8_MOUSE Electroneutral sodium bicarbonate exchanger 1 OS=Mus musculus GN=Slc4a8 PE=2 SV=1 195 519 4.0E-16
sp|Q9BY07|S4A5_HUMAN Electrogenic sodium bicarbonate cotransporter 4 OS=Homo sapiens GN=SLC4A5 PE=2 SV=2 218 519 6.0E-16
sp|Q96Q91|B3A4_HUMAN Anion exchange protein 4 OS=Homo sapiens GN=SLC4A9 PE=2 SV=2 217 519 5.0E-15
sp|Q6RVG2|S4A8_RAT Electroneutral sodium bicarbonate exchanger 1 OS=Rattus norvegicus GN=Slc4a8 PE=1 SV=1 195 519 5.0E-15
sp|Q9GKY1|B3A4_RABIT Anion exchange protein 4 OS=Oryctolagus cuniculus GN=SLC4A9 PE=1 SV=2 215 549 3.0E-14
sp|Q6RVG2|S4A8_RAT Electroneutral sodium bicarbonate exchanger 1 OS=Rattus norvegicus GN=Slc4a8 PE=1 SV=1 56 197 5.0E-14
sp|Q9XI23|BOR4_ARATH Boron transporter 4 OS=Arabidopsis thaliana GN=BOR4 PE=2 SV=1 364 519 3.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0006820 anion transport Yes
GO:0016021 integral component of membrane Yes
GO:0110165 cellular anatomical entity No
GO:0051179 localization No
GO:0008150 biological_process No
GO:0031224 intrinsic component of membrane No
GO:0051234 establishment of localization No
GO:0005575 cellular_component No
GO:0006810 transport No
GO:0006811 ion transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.5

Transmembrane Domains

Domain # Start End Length
1 49 71 22
2 86 108 22
3 129 151 22
4 199 221 22
5 228 250 22
6 281 300 19
7 326 348 22
8 405 427 22
9 464 498 34

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3581
MAVPPRHDAPQTRPAKEAWWKVHLFRGLINDIRRRAPYYASDWLDAWNYRVVPATVYMYFANILPALAFSLDMLS
KTDSHYGVNEVLLASVLGAVVFSLFAAQPLVIVGVTGPITVFNYTVYDIIKSKGINYMAFMCWIGIWALILHWIL
AITNSCNWLRWVTRFPCDIFGFYVALIYIQKGIQVLEPLGTGSPFYLSIVAALLVFMVAYICGMLGSSSLFKQPV
RVFIKDYGTPLTLIFFTGFVYIGRMAQVKLERLPTGIAFEPTSGRNWLVDFWNLDVGDIFLALPFALLLTILFWF
DHNVSSLIAQGSEFPLRKPAGFHWDLFLLGFTTGISGILGLPFPNGLIPQAPFHTESLCVTKAVKEVDEKGQGTG
EYSFEATHVVEQRVSNLVQGLMTLGTMTGPLLVVIHLIPHGVLAGLFFIMGVQALEANGITDKLLFLLRDSNLTA
ATHPLRTIKRRSAIWLFVAIELFGFGATFAITQTVAAVGFPVIIFALIPVRTLLLPHLFTEDELALLDSPTASDF
TMEGIGGAWGGASRPRGDSSASDLTAATSSTSLRRGHARDNDDLAELGRGPIGQTTATKRRNSVDRRSGVSIKE*
Coding >OphauB2|3581
ATGGCTGTGCCACCTCGACACGATGCTCCCCAAACACGGCCCGCCAAGGAAGCTTGGTGGAAGGTGCATCTCTTC
AGGGGCCTCATCAATGACATTAGGCGCCGCGCCCCCTACTATGCCAGCGACTGGCTAGATGCCTGGAACTACCGC
GTGGTGCCCGCCACCGTCTACATGTATTTTGCAAATATTCTGCCCGCCCTCGCATTCTCCCTCGACATGCTGTCC
AAGACGGACTCGCATTATGGCGTCAATGAGGTTCTGCTAGCCTCCGTCTTGGGCGCCGTCGTCTTTTCGCTTTTT
GCCGCCCAGCCTCTGGTCATTGTCGGCGTCACGGGCCCCATTACAGTCTTCAACTATACAGTCTACGACATCATC
AAGTCCAAAGGCATCAATTACATGGCCTTTATGTGCTGGATCGGCATATGGGCTCTCATTTTACACTGGATCCTT
GCCATTACCAATTCCTGCAACTGGCTGCGCTGGGTCACACGCTTCCCATGCGACATTTTTGGTTTTTATGTTGCT
CTCATCTATATTCAAAAGGGTATCCAGGTTCTCGAGCCCCTTGGAACCGGCAGTCCCTTTTACCTCTCCATCGTG
GCCGCCCTACTCGTCTTCATGGTGGCCTACATTTGTGGAATGCTGGGTTCGAGCAGCCTCTTCAAACAGCCTGTT
CGCGTCTTCATCAAGGACTATGGCACGCCTCTGACCCTCATCTTCTTCACTGGCTTTGTCTATATTGGCCGCATG
GCTCAAGTCAAACTGGAGCGCCTGCCCACGGGCATTGCGTTTGAGCCCACCTCTGGCCGCAACTGGCTTGTTGAT
TTCTGGAATCTCGACGTTGGCGACATCTTTCTAGCCTTGCCCTTTGCTCTTCTCCTTACAATTTTGTTCTGGTTT
GACCACAATGTCTCATCTTTGATTGCTCAAGGCAGCGAGTTCCCGCTTCGCAAGCCCGCTGGATTCCACTGGGAC
CTCTTTCTCCTCGGTTTCACCACTGGGATTTCTGGAATCCTGGGCCTTCCCTTCCCCAACGGCCTGATTCCCCAA
GCGCCCTTCCACACGGAGTCTCTTTGCGTCACAAAGGCCGTCAAGGAGGTGGACGAAAAGGGCCAAGGCACAGGC
GAATACTCTTTTGAGGCGACGCACGTTGTCGAACAGCGCGTATCAAACCTTGTCCAGGGCCTCATGACCTTGGGC
ACCATGACGGGCCCATTGTTGGTCGTGATACATTTAATTCCTCACGGAGTTCTTGCCGGTCTCTTTTTCATCATG
GGCGTTCAGGCACTCGAGGCAAACGGCATTACAGACAAGTTACTCTTCCTACTGCGCGACAGCAACCTCACAGCC
GCTACACACCCTCTCAGGACCATTAAGCGCCGCTCTGCCATTTGGCTCTTTGTCGCCATTGAGCTCTTTGGCTTT
GGAGCCACATTTGCAATCACACAAACAGTTGCCGCTGTCGGTTTCCCAGTCATTATATTTGCCTTGATTCCTGTA
CGCACGCTACTTTTGCCTCATTTATTTACAGAGGATGAACTTGCCTTGCTCGATAGCCCAACGGCATCCGATTTT
ACCATGGAGGGCATTGGTGGCGCCTGGGGTGGTGCTAGCCGTCCGCGCGGTGATAGCAGCGCTAGTGACTTGACT
GCTGCCACCAGTTCGACATCTTTGCGTCGTGGACATGCCCGTGATAATGACGACTTGGCCGAACTGGGACGCGGG
CCGATAGGTCAGACCACTGCAACCAAGAGACGGAACAGTGTGGACAGAAGATCTGGCGTCTCAATCAAGGAGTAA
Transcript >OphauB2|3581
ATGGCTGTGCCACCTCGACACGATGCTCCCCAAACACGGCCCGCCAAGGAAGCTTGGTGGAAGGTGCATCTCTTC
AGGGGCCTCATCAATGACATTAGGCGCCGCGCCCCCTACTATGCCAGCGACTGGCTAGATGCCTGGAACTACCGC
GTGGTGCCCGCCACCGTCTACATGTATTTTGCAAATATTCTGCCCGCCCTCGCATTCTCCCTCGACATGCTGTCC
AAGACGGACTCGCATTATGGCGTCAATGAGGTTCTGCTAGCCTCCGTCTTGGGCGCCGTCGTCTTTTCGCTTTTT
GCCGCCCAGCCTCTGGTCATTGTCGGCGTCACGGGCCCCATTACAGTCTTCAACTATACAGTCTACGACATCATC
AAGTCCAAAGGCATCAATTACATGGCCTTTATGTGCTGGATCGGCATATGGGCTCTCATTTTACACTGGATCCTT
GCCATTACCAATTCCTGCAACTGGCTGCGCTGGGTCACACGCTTCCCATGCGACATTTTTGGTTTTTATGTTGCT
CTCATCTATATTCAAAAGGGTATCCAGGTTCTCGAGCCCCTTGGAACCGGCAGTCCCTTTTACCTCTCCATCGTG
GCCGCCCTACTCGTCTTCATGGTGGCCTACATTTGTGGAATGCTGGGTTCGAGCAGCCTCTTCAAACAGCCTGTT
CGCGTCTTCATCAAGGACTATGGCACGCCTCTGACCCTCATCTTCTTCACTGGCTTTGTCTATATTGGCCGCATG
GCTCAAGTCAAACTGGAGCGCCTGCCCACGGGCATTGCGTTTGAGCCCACCTCTGGCCGCAACTGGCTTGTTGAT
TTCTGGAATCTCGACGTTGGCGACATCTTTCTAGCCTTGCCCTTTGCTCTTCTCCTTACAATTTTGTTCTGGTTT
GACCACAATGTCTCATCTTTGATTGCTCAAGGCAGCGAGTTCCCGCTTCGCAAGCCCGCTGGATTCCACTGGGAC
CTCTTTCTCCTCGGTTTCACCACTGGGATTTCTGGAATCCTGGGCCTTCCCTTCCCCAACGGCCTGATTCCCCAA
GCGCCCTTCCACACGGAGTCTCTTTGCGTCACAAAGGCCGTCAAGGAGGTGGACGAAAAGGGCCAAGGCACAGGC
GAATACTCTTTTGAGGCGACGCACGTTGTCGAACAGCGCGTATCAAACCTTGTCCAGGGCCTCATGACCTTGGGC
ACCATGACGGGCCCATTGTTGGTCGTGATACATTTAATTCCTCACGGAGTTCTTGCCGGTCTCTTTTTCATCATG
GGCGTTCAGGCACTCGAGGCAAACGGCATTACAGACAAGTTACTCTTCCTACTGCGCGACAGCAACCTCACAGCC
GCTACACACCCTCTCAGGACCATTAAGCGCCGCTCTGCCATTTGGCTCTTTGTCGCCATTGAGCTCTTTGGCTTT
GGAGCCACATTTGCAATCACACAAACAGTTGCCGCTGTCGGTTTCCCAGTCATTATATTTGCCTTGATTCCTGTA
CGCACGCTACTTTTGCCTCATTTATTTACAGAGGATGAACTTGCCTTGCTCGATAGCCCAACGGCATCCGATTTT
ACCATGGAGGGCATTGGTGGCGCCTGGGGTGGTGCTAGCCGTCCGCGCGGTGATAGCAGCGCTAGTGACTTGACT
GCTGCCACCAGTTCGACATCTTTGCGTCGTGGACATGCCCGTGATAATGACGACTTGGCCGAACTGGGACGCGGG
CCGATAGGTCAGACCACTGCAACCAAGAGACGGAACAGTGTGGACAGAAGATCTGGCGTCTCAATCAAGGAGTAA
Gene >OphauB2|3581
ATGGCTGTGCCACCTCGACACGATGCTCCCCAAACACGGCCCGCCAAGGAAGCTTGGTGGAAGGTGCATCTCTTC
AGGGGCCTCATCAATGACATTAGGCGCCGCGCCCCCTACTATGCCAGCGACTGGCTAGATGCCTGGAACTACCGC
GTGGTGCCCGCCACCGTCTACATGTATTTTGCAAAGTAGCCGCTGCCTCGACTCTATCCGCTCGACGACAATGGC
TGACTTGGCTGCAGTATTCTGCCCGCCCTCGCATTCTCCCTCGACATGCTGTCCAAGACGGACTCGCATTATGGC
GTCAATGAGGTTCTGCTAGCCTCCGTCTTGGGCGCCGTCGTCTTTTCGCTTTTTGCCGCCCAGCCTCTGGTCATT
GTCGGCGTCACGGGCCCCATTACAGTCTTCAACTATACAGTCTACGACATCATCAAGTCCAAAGGCATCAATTAC
ATGGCCTTTATGTGCTGGATCGGCATATGGGCTCTCATTTTACACTGGATCCTTGCCATTACCAATTCCTGCAAC
TGGCTGCGCTGGGTCACACGCTTCCCATGCGACATTTTTGGTTTTTATGTTGCTCTCATCTATATTCAAAAGGGT
ATCCAGGTTCTCGAGCCCCTTGGAACCGGCAGTCCCTTTTACCTCTCCATCGTGGCCGCCCTACTCGTCTTCATG
GTGGCCTACATTTGTGGAATGCTGGGTTCGAGCAGCCTCTTCAAACAGCCTGTTCGCGTCTTCATCAAGGACTAT
GGCACGCCTCTGACCCTCATCTTCTTCACTGGCTTTGTCTATATTGGCCGCATGGCTCAAGTCAAACTGGAGCGC
CTGCCCACGGGCATTGCGTTTGAGCCCACCTCTGGCCGCAACTGGCTTGTTGATTTCTGGAATCTCGACGTTGGC
GACATCTTTCTAGCCTTGCCCTTTGCTCTTCTCCTTACAATTTTGTTCTGGTTTGACCACAATGGTATGCGCTCC
TGCTCTGCTGTTCTGGGCCTTTTTGCTGACTCAACTTCAGTCTCATCTTTGATTGCTCAAGGCAGCGAGTTCCCG
CTTCGCAAGCCCGCTGGATTCCACTGGGACCTCTTTCTCCTCGGTTTCACCACTGGGATTTCTGGAATCCTGGGC
CTTCCCTTCCCCAACGGCCTGATTCCCCAAGCGCCCTTCCACACGGAGTCTCTTTGCGTCACAAAGGCCGTCAAG
GAGGTGGACGAAAAGGGCCAAGGCACAGGCGAATACTCTTTTGAGGCGACGCACGTTGTCGAACAGCGCGTATCA
AACCTTGTCCAGGGCCTCATGACCTTGGGCACCATGACGGGCCCATTGTTGGTCGTGATACATTTAATTCCTCAC
GGAGTTCTTGCCGGTCTCTTTTTCATCATGGGCGTTCAGGCACTCGAGGCAAACGGCATTACAGACAAGTTACTC
TTCCTACTGCGCGACAGCAACCTCACAGCCGCTACACACCCTCTCAGGACCATTAAGCGCCGCTCTGCCATTTGG
CTCTTTGTCGCCATTGAGCTCTTTGGCTTTGGAGCCACATTTGCAATCACACAAACAGTTGCCGCTGTCGGTTTC
CCAGTCATTATATTTGCCTTGATTCCTGTACGCACGCTACTTTTGCCTCATTTATTTACAGAGGATGAACTTGCC
TTGCTCGATAGCCCAACGGCATCCGATTTTACCATGGAGGGCATTGGTGGCGCCTGGGGTGGTGCTAGCCGTCCG
CGCGGTGATAGCAGCGCTAGTGACTTGACTGCTGCCACCAGTTCGACATCTTTGCGTCGTGGACATGCCCGTGAT
AATGACGACTTGGCCGAACTGGGACGCGGGCCGATAGGTCAGACCACTGCAACCAAGAGACGGAACAGTGTGGAC
AGAAGATCTGGCGTCTCAATCAAGGAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail