Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|358
Gene name
LocationContig_103:29181..29685
Strand+
Gene length (bp)504
Transcript length (bp)450
Coding sequence length (bp)450
Protein length (aa) 150

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 8.2E-14 40 109

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O42847|YFH9_SCHPO Uncharacterized RNA-binding protein C23A1.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC23A1.09 PE=3 SV=1 33 148 2.0E-36
sp|Q5D018|RBM8A_DANRE RNA-binding protein 8A OS=Danio rerio GN=rbm8a PE=2 SV=1 33 120 1.0E-35
sp|Q28BZ1|RBM8A_XENTR RNA-binding protein 8A OS=Xenopus tropicalis GN=rbm8a PE=2 SV=1 20 120 2.0E-35
sp|Q6PH90|RB8AB_XENLA RNA-binding protein 8A-B OS=Xenopus laevis GN=rbm8a-b PE=2 SV=1 20 120 3.0E-35
sp|Q9DF42|RB8AA_XENLA RNA-binding protein 8A-A OS=Xenopus laevis GN=rbm8a-a PE=2 SV=1 20 120 3.0E-35
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O42847|YFH9_SCHPO Uncharacterized RNA-binding protein C23A1.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC23A1.09 PE=3 SV=1 33 148 2.0E-36
sp|Q5D018|RBM8A_DANRE RNA-binding protein 8A OS=Danio rerio GN=rbm8a PE=2 SV=1 33 120 1.0E-35
sp|Q28BZ1|RBM8A_XENTR RNA-binding protein 8A OS=Xenopus tropicalis GN=rbm8a PE=2 SV=1 20 120 2.0E-35
sp|Q6PH90|RB8AB_XENLA RNA-binding protein 8A-B OS=Xenopus laevis GN=rbm8a-b PE=2 SV=1 20 120 3.0E-35
sp|Q9DF42|RB8AA_XENLA RNA-binding protein 8A-A OS=Xenopus laevis GN=rbm8a-a PE=2 SV=1 20 120 3.0E-35
sp|B5DGI7|RBM8A_SALSA RNA-binding protein 8A OS=Salmo salar GN=rbm8a PE=2 SV=1 33 120 3.0E-35
sp|Q9CWZ3|RBM8A_MOUSE RNA-binding protein 8A OS=Mus musculus GN=Rbm8a PE=1 SV=3 33 116 2.0E-32
sp|Q27W01|RBM8A_RAT RNA-binding protein 8A OS=Rattus norvegicus GN=Rbm8a PE=1 SV=1 33 116 2.0E-32
sp|Q9Y5S9|RBM8A_HUMAN RNA-binding protein 8A OS=Homo sapiens GN=RBM8A PE=1 SV=1 33 116 2.0E-32
sp|Q3ZCE8|RBM8A_BOVIN RNA-binding protein 8A OS=Bos taurus GN=RBM8A PE=2 SV=2 33 116 2.0E-32
sp|Q9V535|RBM8A_DROME RNA-binding protein 8A OS=Drosophila melanogaster GN=tsu PE=1 SV=1 33 119 8.0E-31
sp|Q1JQ73|ELV1A_XENLA ELAV-like protein 1-A OS=Xenopus laevis GN=elavl1-a PE=1 SV=1 16 113 1.0E-08
sp|Q5U259|ELV1B_XENLA ELAV-like protein 1-B OS=Xenopus laevis GN=elavl1-b PE=1 SV=1 37 113 3.0E-08
sp|Q6GLB5|ELAV1_XENTR ELAV-like protein 1 OS=Xenopus tropicalis GN=elavl1 PE=2 SV=1 37 113 5.0E-08
sp|Q5R723|PPIE_PONAB Peptidyl-prolyl cis-trans isomerase E OS=Pongo abelii GN=PPIE PE=2 SV=1 39 114 7.0E-08
sp|Q9UNP9|PPIE_HUMAN Peptidyl-prolyl cis-trans isomerase E OS=Homo sapiens GN=PPIE PE=1 SV=1 39 114 7.0E-08
sp|A4FV72|PPIE_BOVIN Peptidyl-prolyl cis-trans isomerase E OS=Bos taurus GN=PPIE PE=2 SV=1 39 114 7.0E-08
sp|Q4G338|PPIE_HAECO Peptidyl-prolyl cis-trans isomerase E OS=Haemonchus contortus PE=1 SV=1 40 119 7.0E-08
sp|Q9QZH3|PPIE_MOUSE Peptidyl-prolyl cis-trans isomerase E OS=Mus musculus GN=Ppie PE=1 SV=2 39 114 8.0E-08
sp|Q91584|ELAV3_XENLA ELAV-like protein 3 OS=Xenopus laevis GN=elavl3 PE=2 SV=1 37 113 1.0E-07
sp|Q28FX0|ELAV3_XENTR ELAV-like protein 3 OS=Xenopus tropicalis GN=elavl3 PE=2 SV=1 37 113 1.0E-07
sp|Q15717|ELAV1_HUMAN ELAV-like protein 1 OS=Homo sapiens GN=ELAVL1 PE=1 SV=2 37 113 1.0E-07
sp|P70372|ELAV1_MOUSE ELAV-like protein 1 OS=Mus musculus GN=Elavl1 PE=1 SV=2 37 113 1.0E-07
sp|Q12926|ELAV2_HUMAN ELAV-like protein 2 OS=Homo sapiens GN=ELAVL2 PE=1 SV=2 37 113 2.0E-07
sp|Q5R9Z6|ELAV2_PONAB ELAV-like protein 2 OS=Pongo abelii GN=ELAVL2 PE=2 SV=1 37 113 2.0E-07
sp|Q60899|ELAV2_MOUSE ELAV-like protein 2 OS=Mus musculus GN=Elavl2 PE=2 SV=1 37 113 2.0E-07
sp|Q8CH84|ELAV2_RAT ELAV-like protein 2 OS=Rattus norvegicus GN=Elavl2 PE=1 SV=1 37 113 2.0E-07
sp|Q61701|ELAV4_MOUSE ELAV-like protein 4 OS=Mus musculus GN=Elavl4 PE=1 SV=1 37 113 2.0E-07
sp|P26378|ELAV4_HUMAN ELAV-like protein 4 OS=Homo sapiens GN=ELAVL4 PE=1 SV=2 37 113 2.0E-07
sp|O09032|ELAV4_RAT ELAV-like protein 4 OS=Rattus norvegicus GN=Elavl4 PE=1 SV=1 37 113 2.0E-07
sp|Q28GD4|ELAV2_XENTR ELAV-like protein 2 OS=Xenopus tropicalis GN=elavl2 PE=2 SV=2 37 113 2.0E-07
sp|Q91903|ELAV2_XENLA ELAV-like protein 2 OS=Xenopus laevis GN=elavl2 PE=1 SV=2 37 113 3.0E-07
sp|Q09442|SF3B4_CAEEL Splicing factor 3B subunit 4 OS=Caenorhabditis elegans GN=sap-49 PE=1 SV=2 40 117 4.0E-07
sp|Q15427|SF3B4_HUMAN Splicing factor 3B subunit 4 OS=Homo sapiens GN=SF3B4 PE=1 SV=1 37 115 7.0E-07
sp|O14102|SAP49_SCHPO Spliceosome-associated protein 49 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sap49 PE=3 SV=2 32 117 8.0E-07
sp|Q6AYL5|SF3B4_RAT Splicing factor 3B subunit 4 OS=Rattus norvegicus GN=Sf3b4 PE=2 SV=1 37 115 8.0E-07
sp|Q8QZY9|SF3B4_MOUSE Splicing factor 3B subunit 4 OS=Mus musculus GN=Sf3b4 PE=1 SV=1 37 115 8.0E-07
sp|A4RHN3|EIF3G_MAGO7 Eukaryotic translation initiation factor 3 subunit G OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=TIF35 PE=3 SV=1 40 114 8.0E-07
sp|Q42404|RU17_ARATH U1 small nuclear ribonucleoprotein 70 kDa OS=Arabidopsis thaliana GN=RNU1 PE=1 SV=1 39 132 1.0E-06
sp|Q0U6E7|EIF3G_PHANO Eukaryotic translation initiation factor 3 subunit G OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=TIF35 PE=3 SV=2 40 114 1.0E-06
sp|Q2H0U6|EIF3G_CHAGB Eukaryotic translation initiation factor 3 subunit G OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=TIF35 PE=3 SV=1 40 114 2.0E-06
sp|Q9V3G3|PPIE_DROME Peptidyl-prolyl cis-trans isomerase E OS=Drosophila melanogaster GN=cyp33 PE=1 SV=1 40 114 2.0E-06
sp|Q60900|ELAV3_MOUSE ELAV-like protein 3 OS=Mus musculus GN=Elavl3 PE=1 SV=1 38 113 2.0E-06
sp|Q14576|ELAV3_HUMAN ELAV-like protein 3 OS=Homo sapiens GN=ELAVL3 PE=2 SV=3 38 113 2.0E-06
sp|O80678|UBA2B_ARATH UBP1-associated protein 2B OS=Arabidopsis thaliana GN=UBA2B PE=2 SV=1 40 102 2.0E-06
sp|Q9LES2|UBA2A_ARATH UBP1-associated protein 2A OS=Arabidopsis thaliana GN=UBA2A PE=1 SV=1 40 122 4.0E-06
sp|Q44554|RBPB_NOSS1 Putative RNA-binding protein RbpB OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpB PE=3 SV=3 40 112 4.0E-06
sp|B7P877|NCBP2_IXOSC Nuclear cap-binding protein subunit 2 OS=Ixodes scapularis GN=Cbp20 PE=3 SV=1 40 146 4.0E-06
sp|Q9WX39|RBPF_NOSS1 Putative RNA-binding protein RbpF OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpF PE=3 SV=3 40 114 4.0E-06
sp|Q93594|NCBP2_CAEEL Nuclear cap-binding protein subunit 2 OS=Caenorhabditis elegans GN=ncbp-2 PE=3 SV=2 9 113 5.0E-06
sp|Q9ZPX8|RS31A_ARATH Serine/arginine-rich splicing factor RS31A OS=Arabidopsis thaliana GN=RS31A PE=2 SV=1 51 143 5.0E-06
sp|Q6C747|EIF3G_YARLI Eukaryotic translation initiation factor 3 subunit G OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TIF35 PE=3 SV=1 40 114 6.0E-06
sp|Q4P7G1|EIF3G_USTMA Eukaryotic translation initiation factor 3 subunit G OS=Ustilago maydis (strain 521 / FGSC 9021) GN=TIF35 PE=3 SV=1 40 105 8.0E-06
sp|Q9C909|RBG5_ARATH Glycine-rich RNA-binding protein 5, mitochondrial OS=Arabidopsis thaliana GN=RBG5 PE=2 SV=1 14 96 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 61 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|358
MAETSEMDIDPPASPPARNDSQMQTHSKATAVRSIEGWIIMVTNVHEEADEEALQDKFGEYGEIKNMHLNLDRRS
GYVKGYALIEYATLEEARAAIDGAHETKLLDQTITVDFAFVRPPPGKSGRAGRTGGGRRGRSRSKSPDAKGRDD*
Coding >OphauB2|358
ATGGCTGAGACGTCAGAAATGGACATTGACCCTCCCGCATCGCCACCAGCGCGCAACGACTCTCAGATGCAAACA
CACTCCAAAGCAACCGCAGTGCGCTCCATTGAAGGATGGATCATCATGGTGACCAACGTCCACGAAGAAGCCGAC
GAAGAGGCCCTACAGGACAAGTTTGGCGAATACGGCGAAATCAAGAATATGCACTTGAATCTGGACCGCCGCAGT
GGTTACGTCAAGGGCTATGCACTGATAGAGTACGCAACGCTCGAGGAGGCGAGGGCGGCGATTGATGGGGCGCAT
GAGACAAAACTGCTCGATCAAACTATTACAGTCGACTTTGCCTTTGTGCGCCCGCCGCCAGGTAAGAGTGGACGC
GCGGGGCGGACGGGCGGTGGGCGCAGAGGACGGAGTCGCAGCAAGAGCCCTGATGCAAAGGGGCGTGACGATTGA
Transcript >OphauB2|358
ATGGCTGAGACGTCAGAAATGGACATTGACCCTCCCGCATCGCCACCAGCGCGCAACGACTCTCAGATGCAAACA
CACTCCAAAGCAACCGCAGTGCGCTCCATTGAAGGATGGATCATCATGGTGACCAACGTCCACGAAGAAGCCGAC
GAAGAGGCCCTACAGGACAAGTTTGGCGAATACGGCGAAATCAAGAATATGCACTTGAATCTGGACCGCCGCAGT
GGTTACGTCAAGGGCTATGCACTGATAGAGTACGCAACGCTCGAGGAGGCGAGGGCGGCGATTGATGGGGCGCAT
GAGACAAAACTGCTCGATCAAACTATTACAGTCGACTTTGCCTTTGTGCGCCCGCCGCCAGGTAAGAGTGGACGC
GCGGGGCGGACGGGCGGTGGGCGCAGAGGACGGAGTCGCAGCAAGAGCCCTGATGCAAAGGGGCGTGACGATTGA
Gene >OphauB2|358
ATGGCTGAGACGTCAGAAATGGACATTGACCCTCCCGCATCGCCACCAGCGCGCAACGACTCTCAGATGCAAACA
CACTCCAAAGCAACCGCAGTGCGCTCCATTGAAGGATGGATCATCATGGTGACCAACGTCCACGAAGAAGCCGAC
GAAGAGGCCCTACAGGACAAGTTTGGCGAATACGGCGAAATCAAGAATATGCACTTGAATCTGGACCGCCGCAGT
GGTTACGTCAAGGTATGTAGAGAGCAAGGGAGGAGCAAAGAGTGGGCAGCTGATTGCGGAGACTAGGGCTATGCA
CTGATAGAGTACGCAACGCTCGAGGAGGCGAGGGCGGCGATTGATGGGGCGCATGAGACAAAACTGCTCGATCAA
ACTATTACAGTCGACTTTGCCTTTGTGCGCCCGCCGCCAGGTAAGAGTGGACGCGCGGGGCGGACGGGCGGTGGG
CGCAGAGGACGGAGTCGCAGCAAGAGCCCTGATGCAAAGGGGCGTGACGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail